CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP014903	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-4, complete sequence	0 crisprs	NA	0	0
NZ_CP014906	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-7, complete sequence	0 crisprs	NA	0	0
NZ_CP014905	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-6, complete sequence	0 crisprs	NA	0	0
NZ_CP014900	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-1, complete sequence	1 crisprs	NA	1	0
NZ_CP014904	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-5, complete sequence	0 crisprs	NA	0	0
NZ_CP014899	Lactobacillus backii strain TMW 1.2002 chromosome, complete genome	0 crisprs	csa3,cas3,DEDDh,DinG,cas14j	0	11
NZ_CP014902	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-3, complete sequence	0 crisprs	NA	0	0
NZ_CP014901	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-2, complete sequence	0 crisprs	NA	0	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP014900_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014900_1

28798-28899

Orphan

Consensus_repeat	Method
TGTCCGATTTTCGGATTTTCGCTCGTAGCAAGGGTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP014900_1

>merge|NZ_CP014900|1|28798-28899|CRISPRCasFinder
TGTCCGATTTTCGGATTTTCGCTCGTAGCAAGGGTTTGCGGGGTGTTGTCAACGAACTTTCGCGAATGTCCGATTTTCGGATTTTCGCTCGTAGCAAGGGTT

>NZ_CP014900|1|1|28798-28899|CRISPRCasFinder
TGTCCGATTTTCGGATTTTCGCTCGTAGCAAGGGTT	TGCGGGGTGTTGTCAACGAACTTTCGCGAA
TGTCCGATTTTCGGATTTTCGCTCGTAGCAAGGGTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014900.1\|WP_046870851.1\|27137_27872_-\|Fic-family-protein	unknown	unknown	gnl\|CDD\|376885
NZ_CP014900.1\|WP_046870788.1\|21012_21930_-\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP014900.1\|WP_054712554.1\|27922_28120_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014900.1\|WP_068281292.1\|18223_18772_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP014900.1\|WP_068281293.1\|18936_20199_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|378925
NZ_CP014900.1\|WP_024855745.1\|17236_17842_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_CP014900.1\|WP_068281294.1\|22396_23344_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133030
NZ_CP014900.1\|WP_011178835.1\|25303_25708_+\|GtrA-family-protein	unknown	unknown	gnl\|CDD\|377229
NZ_CP014900.1\|WP_050894606.1\|26553_26763_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014900.1\|WP_057877478.1\|23353_25288_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274774

Protein	Function_ID	Function_description	E-value
NZ_CP014900.1\|WP_046870851.1\|27137_27872_-\|Fic-family-protein	gnl\|CDD\|376885	pfam02661, Fic, Fic/DOC family. This family consists of the Fic (filamentation induced by cAMP) protein and doc (death on curing). The Fic protein is involved in cell division and is suggested to be involved in the synthesis of PAB or folate, indicating that the Fic protein and cAMP are involved in a regulatory mechanism of cell division via folate metabolism. This family contains a central conserved motif HPFXXGNG in most members. The exact molecular function of these proteins is uncertain. P1 lysogens of Escherichia coli carry the prophage as a stable low copy number plasmid. The frequency with which viable cells cured of prophage are produced is about 10(-5) per cell per generation. A significant part of this remarkable stability can be attributed to a plasmid-encoded mechanism that causes death of cells that have lost P1. In other words, the lysogenic cells appear to be addicted to the presence of the prophage. The plasmid withdrawal response depends on a gene named doc (death on curing) that is represented by this family. Doc induces a reversible growth arrest of E. coli cells by targetting the protein synthesis machinery. Doc hosts the C-terminal domain of its antitoxin partner Phd (prevents host death) through fold complementation, a domain that is intrinsically disordered in solution but that folds into an alpha-helix on binding to Doc.This domain forms complexes with Phd antitoxins containing pfam02604.	0.000949229
NZ_CP014900.1\|WP_046870788.1\|21012_21930_-\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	2.74185e-62
NZ_CP014900.1\|WP_068281292.1\|18223_18772_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.69547e-08
NZ_CP014900.1\|WP_068281293.1\|18936_20199_+\|ABC-transporter-permease	gnl\|CDD\|378925	pfam12698, ABC2_membrane_3, ABC-2 family transporter protein. This family is related to the ABC-2 membrane transporter family pfam01061.	1.91935e-07
NZ_CP014900.1\|WP_024855745.1\|17236_17842_-\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	8.79671e-45
NZ_CP014900.1\|WP_057877478.1\|23353_25288_+\|hypothetical-protein	gnl\|CDD\|274774	TIGR03766, hypothetical_protein_lp_2141, conserved hypothetical integral membrane protein. Models TIGR03110, TIGR03111, and TIGR03112 describe a three-gene system found in several Gram-positive bacteria, where TIGR03110 (XrtG) is distantly related to a putative transpeptidase, exosortase (TIGR02602). This model describes a small clade that correlates by both gene clustering and phyletic pattern, although imperfectly, to the three gene system. Both this narrow clade, and the larger set of full-length homologous integral membrane proteins, have an especially well-conserved region near the C-terminus with an invariant tyrosine. The function is unknown.	2.44223e-20
NZ_CP014900.1\|WP_011178835.1\|25303_25708_+\|GtrA-family-protein	gnl\|CDD\|377229	pfam04138, GtrA, GtrA-like protein. Members of this family are predicted to be integral membrane proteins with three or four transmembrane spans. They are involved in the synthesis of cell surface polysaccharides. The GtrA family are a subset of this family. GtrA is predicted to be an integral membrane protein with 4 transmembrane spans. It is involved is in O antigen modification by Shigella flexneri bacteriophage X (SfX), but does not determine the specificity of glucosylation. Its function remains unknown, but it may play a role in translocation of undecaprenyl phosphate linked glucose (UndP-Glc) across the cytoplasmic membrane. Another member of this family is a DTDP-glucose-4-keto-6-deoxy-D-glucose reductase, which catalyzes the conversion of dTDP-4-keto-6-deoxy-D-glucose to dTDP-D-fucose, which is involved in the biosynthesis of the serotype-specific polysaccharide antigen of Actinobacillus actinomycetemcomitans Y4 (serotype b). This family also includes the teichoic acid glycosylation protein, GtcA, which is a serotype-specific protein in some Listeria innocua and monocytogenes strains. Its exact function is not known, but it is essential for decoration of cell wall teichoic acids with glucose and galactose.	7.55387e-15
NZ_CP014900.1\|WP_068281294.1\|22396_23344_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	7.7636e-80

>NZ_CP014900.1|WP_054712554.1|27922_28120_-|hypothetical-protein
MTKPSKEIETIDQLLADPWAVNIQDIWEQAAHNPDPDKRKLFDALHTYLLDKRQEQIINEKHFVI
>NZ_CP014900.1|WP_046870851.1|27137_27872_-|Fic-family-protein
MAKTRTYMDKYKFTAAENQRFARANFTKLVHTNARFEGVNTTLPQTQTIMDGMSVAGVPVEDVLTIVNLKRGWQYITAQNSPLTLTMEKQINKIVAAEDALVPGELRQGKGGVNLGSDDFFEQPLINEKQEQSFLQKILADPRTTITDKALTVMYHNMRQQIFWDGNKRTATLSANKIMIDGGAGLINVPLDKWDQWNELIANYYRTNDMAKIKRWTYDNGIQGLQIRANLALKSVKDKTSKRI
>NZ_CP014900.1|WP_050894606.1|26553_26763_+|hypothetical-protein
MSQSNLEKQEAKLKQLNQKIKAEKNKIEQNLGKQIIRSANLDYGTLTTPQIKMIAKKVAAFLNQAQNNQ
>NZ_CP014900.1|WP_011178835.1|25303_25708_+|GtrA-family-protein
MEKPITTLYSKYDTALRYLIVGGLTTGINVVLFFGLTHLAMPWFWANIIAWVLSVLFAFIANKKVVFNSADMTFRTVVKEGASFFTLRGASLLADTAILFIGLTLMHGSPLIVKLIDQVVVIVLNYGFSKLIFA
>NZ_CP014900.1|WP_057877478.1|23353_25288_+|hypothetical-protein
MKKIKPAFLPAILILCLLIGSIGNLTSVLGVPALLVVVLLGAGLYFGAPRLDHLSTRQLRWGIGLGLLAMLIAQVVVLHVMPNTVYHDPYRVLSQADQLAAGHMTWDITYFWRYANNVPLAYLLSLWLRLTQLVGLSTNLSVHLLSILVLDSFIALALHTIWQLSQRASLLVVAFGFFALSPFAYTYYLQVFYSDLPTMLVLLIIIRSLLNWSQKTSRQRWFAGSGLVVAVMLGAMLKPNLVVLLPALLIVGLILARQHLWRQAKLTLPILLIVLGFGLSLPATKVFDVAANYQPRTAFSFPATHWILMGYNQHSNGGYSGKDVGRAIKQPSQADRQRYNLKTIPKRIKTLGVVGVIRLWVVKLGIVLNVQGIQRWYNGGFRAAPSWYSNHAGFYQGLTVIGYVAATLLMWGALMLKLLRWRPDLTDPHQILALLAVTTALGYLAFHTLLWEVEPRYGQAILPLLWVALAAIPRQASQSRPRWANQASLLNGATASLVAFGAAGVLGAQLPQKQVIAAQRSQLSVQYHAKPKTVTPGTVLAEVVDVNAPANYFSVQIHAGSQVQVTLTNLATGQHYRLTMAGSVARLHHQLAAGQYRITVQNLTTRGQQVDVTHTYHYQLAAHPLTVNGQSQPTASLIYTCMQR
>NZ_CP014900.1|WP_068281294.1|22396_23344_+|glycosyltransferase-family-2-protein
MATSKLTIVVPAYNEEEVLTSSVQKLLAVEDQIAAQTVLGQRADILIVDDGSMDHTWDIIEKLHAMTSRVRGLRFSRNFGHQSALIAGMSEAVKTADMIVTIDADLQDDPDKIGDMVDAYADGADIVYGVRNNRETDSWFKRTTAQGYYKTLKLLGVELVPNHADFRLMSKRAVETFLQYPERNIFIRGLIPKLGFKTAEVFYKRTPRMAGESKYPLKKMLAFAWDGITSLTIAPVRLILILGTLSCLLAVGMVVYAIVMKMLGLTVHGWSLLMVSLWFVGGIQMISLGVIGEYIGKLTTEVKHRPRYTVQTILD
>NZ_CP014900.1|WP_046870788.1|21012_21930_-|IS30-family-transposase
MTSLSSQERTVIQTLLELNYSIRAIARFINRSPATVSVEIHQVTPYKADIAHALALKKRHLRGRHHTLTPAIAVFLNEHIGILKWSPETAAHVLGLPFKTIYNWLNAGRLKLSLADLPDKGIRQKRQSDGRRQVFVHGRSIESRPKSVQARQDFGHFEVDTMQSGKKRGEVLVTITERLSRQHIVRQVSGRNSQAVTPVLIHFFQGIENAKSITVDRGREFVKYDEIEQKLGIPVYFAHPYSPEERGSNEILNRYVRRFIPKERKIETVSAKELDQINHWINARPMKTLNWQSPRKVFQQFAVFG
>NZ_CP014900.1|WP_068281293.1|18936_20199_+|ABC-transporter-permease
MFDVIRSKRYWLALLLVGAIIGIVSFALIGIRNSVKVKQIPVALVNEDKGTLSNKIESKLRKKFNGKDSKIKWVSPQKDGFNDQKYYGAFIIRSGFSKELQQQNESLKAQIISQKLTTLQKKEELPDSAKSQLLQAKFVTQKPVHPAQIKISINQGMNAQISQLLSQALPQIANALSSRISAQQQSVLSKNKINLSAKSWDLVSTPISVSTHESNKIEKNTVNGTAPMLLVALAWFSALIPSLILWREHTKRSASKFLNATTITSQLITGLVASILSATVGFLFVNVCFNLTIPNPINFIGLMSISIFVFYLIITCVLDWLGFAFYPLLLVVWFLASSVMSYAPEALDPLYRKGIYSWVPMRFSMQTLTNTLYFHNGSSTTMSSLLVLLIIGFVAAILMYSSGYLKHYLFTVRPHRKINN
>NZ_CP014900.1|WP_068281292.1|18223_18772_-|TetR/AcrR-family-transcriptional-regulator
MTDLRNKRTEMLIENSFIQLVRQQGFNNVSVIDISNKALINRQTFYRHYQDKYHLAAKMIQDFVSTYDSVLKKRSNLNKQNQNFLSITSILAPDIKNLLIKQREKILALRSIQLDSKDFSSEIKRVLRNNLVSMLEEKPDKFEMSLLTSLILGSFNYLIDEQELPDTSQIQHAITGILCLIS
>NZ_CP014900.1|WP_024855745.1|17236_17842_-|recombinase-family-protein
MATIGYARVSSKEQHLDRQLNALKNVDKLFTDKLSGATTNRPELQKMLAYIREGDIVLVTELDRLGRNNQDLTKIMNSIQDKGATLDVLNLPSMTGISDPNLRQLMTNLIIELYKYQAESERKRIIERQQQGIALAKQQGKYHGRKAQYNQDDPRLQHAFKLYQAGMSDVDVARNTGIKRTTFIRYRKKFKIVRGGVHEAT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP014900_1	1.1\|28834\|30\|NZ_CP014900\|CRISPRCasFinder	28834-28863	30	NZ_CP027191	Lactobacillus sp. CBA3605 plasmid pCBA3605-1, complete sequence	29360-29389	0	1.0
NZ_CP014900_1	1.1\|28834\|30\|NZ_CP014900\|CRISPRCasFinder	28834-28863	30	NZ_CP027195	Lactobacillus sp. CBA3606 plasmid pCBA3606-1, complete sequence	30410-30439	0	1.0
NZ_CP014900_1	1.1\|28834\|30\|NZ_CP014900\|CRISPRCasFinder	28834-28863	30	NZ_CP014874	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-1, complete sequence	6853-6882	0	1.0
NZ_CP014900_1	1.1\|28834\|30\|NZ_CP014900\|CRISPRCasFinder	28834-28863	30	NZ_CP014900	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-1, complete sequence	28834-28863	0	1.0
NZ_CP014900_1	1.1\|28834\|30\|NZ_CP014900\|CRISPRCasFinder	28834-28863	30	NZ_CP014920	Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-5, complete sequence	12633-12662	1	0.967
NZ_CP014900_1	1.1\|28834\|30\|NZ_CP014900\|CRISPRCasFinder	28834-28863	30	NZ_CP019982	Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence	10406-10435	1	0.967
NZ_CP014900_1	1.1\|28834\|30\|NZ_CP014900\|CRISPRCasFinder	28834-28863	30	NZ_CP019982	Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence	86925-86954	1	0.967
NZ_CP014900_1	1.1\|28834\|30\|NZ_CP014900\|CRISPRCasFinder	28834-28863	30	NC_017017	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-6, complete sequence	5386-5415	1	0.967
NZ_CP014900_1	1.1\|28834\|30\|NZ_CP014900\|CRISPRCasFinder	28834-28863	30	NZ_CP014928	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence	6823-6852	1	0.967
NZ_CP014900_1	1.1\|28834\|30\|NZ_CP014900\|CRISPRCasFinder	28834-28863	30	NC_017468	Lactobacillus helveticus H10 plasmid pH10, complete sequence	15843-15872	1	0.967
NZ_CP014900_1	1.1\|28834\|30\|NZ_CP014900\|CRISPRCasFinder	28834-28863	30	NZ_CP047125	Lactobacillus hilgardii strain FLUB plasmid unnamed4	5236-5265	1	0.967
NZ_CP014900_1	1.1\|28834\|30\|NZ_CP014900\|CRISPRCasFinder	28834-28863	30	NZ_CP033891	Lactobacillus plantarum strain LMT1-48 plasmid p_3, complete sequence	3329-3358	1	0.967
NZ_CP014900_1	1.1\|28834\|30\|NZ_CP014900\|CRISPRCasFinder	28834-28863	30	NZ_CP031200	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_B, complete sequence	39623-39652	1	0.967
NZ_CP014900_1	1.1\|28834\|30\|NZ_CP014900\|CRISPRCasFinder	28834-28863	30	NC_015421	Lactobacillus buchneri NRRL B-30929 plasmid pLBUC03, complete sequence	1006-1035	2	0.933
NZ_CP014900_1	1.1\|28834\|30\|NZ_CP014900\|CRISPRCasFinder	28834-28863	30	NC_006529	Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence	4741-4770	2	0.933
NZ_CP014900_1	1.1\|28834\|30\|NZ_CP014900\|CRISPRCasFinder	28834-28863	30	NC_008498	Lactobacillus brevis ATCC 367 plasmid 1, complete sequence	8761-8790	2	0.933

1. spacer 1.1|28834|30|NZ_CP014900|CRISPRCasFinder matches to NZ_CP027191 (Lactobacillus sp. CBA3605 plasmid pCBA3605-1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgttgtcaacgaactttcgcgaa	Protospacer
******************************

2. spacer 1.1|28834|30|NZ_CP014900|CRISPRCasFinder matches to NZ_CP027195 (Lactobacillus sp. CBA3606 plasmid pCBA3606-1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgttgtcaacgaactttcgcgaa	Protospacer
******************************

3. spacer 1.1|28834|30|NZ_CP014900|CRISPRCasFinder matches to NZ_CP014874 (Lactobacillus backii strain TMW 1.1989 plasmid pL11989-1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgttgtcaacgaactttcgcgaa	Protospacer
******************************

4. spacer 1.1|28834|30|NZ_CP014900|CRISPRCasFinder matches to NZ_CP014900 (Lactobacillus backii strain TMW 1.2002 plasmid pL12002-1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgttgtcaacgaactttcgcgaa	Protospacer
******************************

5. spacer 1.1|28834|30|NZ_CP014900|CRISPRCasFinder matches to NZ_CP014920 (Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-5, complete sequence) position: , mismatch: 1, identity: 0.967

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgtcgtcaacgaactttcgcgaa	Protospacer
**********.*******************

6. spacer 1.1|28834|30|NZ_CP014900|CRISPRCasFinder matches to NZ_CP019982 (Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence) position: , mismatch: 1, identity: 0.967

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggagtgttgtcaacgaactttcgcgaa	Protospacer
*****.************************

7. spacer 1.1|28834|30|NZ_CP014900|CRISPRCasFinder matches to NZ_CP019982 (Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence) position: , mismatch: 1, identity: 0.967

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggagtgttgtcaacgaactttcgcgaa	Protospacer
*****.************************

8. spacer 1.1|28834|30|NZ_CP014900|CRISPRCasFinder matches to NC_017017 (Pediococcus claussenii ATCC BAA-344 plasmid pPECL-6, complete sequence) position: , mismatch: 1, identity: 0.967

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgtcgtcaacgaactttcgcgaa	Protospacer
**********.*******************

9. spacer 1.1|28834|30|NZ_CP014900|CRISPRCasFinder matches to NZ_CP014928 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence) position: , mismatch: 1, identity: 0.967

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgtcgtcaacgaactttcgcgaa	Protospacer
**********.*******************

10. spacer 1.1|28834|30|NZ_CP014900|CRISPRCasFinder matches to NC_017468 (Lactobacillus helveticus H10 plasmid pH10, complete sequence) position: , mismatch: 1, identity: 0.967

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgtcgtcaacgaactttcgcgaa	Protospacer
**********.*******************

11. spacer 1.1|28834|30|NZ_CP014900|CRISPRCasFinder matches to NZ_CP047125 (Lactobacillus hilgardii strain FLUB plasmid unnamed4) position: , mismatch: 1, identity: 0.967

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgtcgtcaacgaactttcgcgaa	Protospacer
**********.*******************

12. spacer 1.1|28834|30|NZ_CP014900|CRISPRCasFinder matches to NZ_CP033891 (Lactobacillus plantarum strain LMT1-48 plasmid p_3, complete sequence) position: , mismatch: 1, identity: 0.967

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgtcgtcaacgaactttcgcgaa	Protospacer
**********.*******************

13. spacer 1.1|28834|30|NZ_CP014900|CRISPRCasFinder matches to NZ_CP031200 (Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_B, complete sequence) position: , mismatch: 1, identity: 0.967

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgtcgtcaacgaactttcgcgaa	Protospacer
**********.*******************

14. spacer 1.1|28834|30|NZ_CP014900|CRISPRCasFinder matches to NC_015421 (Lactobacillus buchneri NRRL B-30929 plasmid pLBUC03, complete sequence) position: , mismatch: 2, identity: 0.933

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcgggttgtcgtcaacgaactttcgcgaa	Protospacer
****** ***.*******************

15. spacer 1.1|28834|30|NZ_CP014900|CRISPRCasFinder matches to NC_006529 (Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence) position: , mismatch: 2, identity: 0.933

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgtcgtcaacggactttcgcgaa	Protospacer
**********.*******.***********

16. spacer 1.1|28834|30|NZ_CP014900|CRISPRCasFinder matches to NC_008498 (Lactobacillus brevis ATCC 367 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.933

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgtggggtgtcgtcaacgaactttcgcgaa	Protospacer
**.*******.*******************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP014899

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

185860 : 257904

Acinetobacter_phage(40.0%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068279055.1\|185860_187132_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_068279240.1\|187132_187360_-	hypothetical protein	NA	NA	NA	NA
WP_068279243.1\|187639_188521_-	proline iminopeptidase-family hydrolase	NA	NA	NA	NA
WP_068279246.1\|188590_189052_-	threonine/serine exporter family protein	NA	NA	NA	NA
WP_068279249.1\|189063_189822_-	threonine/serine exporter family protein	NA	NA	NA	NA
WP_068279253.1\|190305_191766_-	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	3.5e-76	39.6
WP_068281247.1\|192129_193443_-	proline reductase-associated electron transfer protein PrdC	NA	NA	NA	NA
WP_068279256.1\|193805_195170_-	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	1.0e-21	24.1
WP_068279259.1\|195845_196916_+	aminopeptidase P family protein	NA	NA	NA	NA
WP_068279262.1\|196995_198438_+	C69 family dipeptidase	NA	NA	NA	NA
WP_068279055.1\|198614_199886_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_068279265.1\|200269_201031_-	type I 3-dehydroquinate dehydratase	NA	NA	NA	NA
WP_068279268.1\|201175_202057_-	shikimate dehydrogenase	NA	NA	NA	NA
WP_068279271.1\|202231_203161_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_068279275.1\|203264_203915_+	hypothetical protein	NA	NA	NA	NA
WP_068279279.1\|205851_206751_-	FAD:protein FMN transferase	NA	NA	NA	NA
WP_068279282.1\|207034_208228_-	MFS transporter	NA	NA	NA	NA
WP_068279285.1\|208270_209491_-	MFS transporter	NA	NA	NA	NA
WP_068279289.1\|209496_210372_-	shikimate dehydrogenase	NA	NA	NA	NA
WP_068279292.1\|210408_211293_-	shikimate dehydrogenase	NA	NA	NA	NA
WP_068279295.1\|211428_212268_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_068279299.1\|212331_213168_-	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_068279302.1\|213673_214555_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_068279305.1\|214709_216470_-	HTH domain-containing protein	NA	NA	NA	NA
WP_068279308.1\|216487_217651_-	putative C-S lyase	NA	NA	NA	NA
WP_082918544.1\|217726_219271_-	PTS fructose-like transporter subunit IIBC	NA	NA	NA	NA
WP_068279311.1\|219289_219736_-	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_068223443.1\|219878_221054_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_068279314.1\|221494_223900_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	2.8e-54	58.1
WP_068279317.1\|224097_225009_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_068279320.1\|225000_225873_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_068279323.1\|225991_226555_+	UbiX family flavin prenyltransferase	NA	NA	NA	NA
WP_068279326.1\|226594_227005_+	hypothetical protein	NA	NA	NA	NA
WP_068279329.1\|227130_228606_-	UbiD family decarboxylase	NA	NA	NA	NA
WP_068279332.1\|229019_229463_+	nucleoside 2-deoxyribosyltransferase	NA	NA	NA	NA
WP_068279335.1\|229742_231719_-	cell division protein FtsI	NA	NA	NA	NA
WP_068279337.1\|232294_232753_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_068279340.1\|232798_236365_-	hypothetical protein	NA	NA	NA	NA
WP_068279342.1\|236912_238262_+	Trk family potassium uptake protein	NA	NA	NA	NA
WP_068279345.1\|238374_239037_+	TrkA family potassium uptake protein	NA	NA	NA	NA
WP_068279347.1\|239118_239535_+	hypothetical protein	NA	NA	NA	NA
WP_068279350.1\|239685_241188_-	ABC-F type ribosomal protection protein	A0A1B0RXA0	Streptococcus_phage	4.6e-23	23.1
WP_068225823.1\|241861_243226_-	hypothetical protein	NA	NA	NA	NA
WP_068225822.1\|243218_244184_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_068279353.1\|244201_245335_-	glycosyltransferase	NA	NA	NA	NA
WP_167574656.1\|245356_246421_-	glycosyltransferase	NA	NA	NA	NA
WP_082918546.1\|246488_247184_-	sugar transferase	NA	NA	NA	NA
WP_068279356.1\|247229_247829_-	hypothetical protein	NA	NA	NA	NA
WP_068225818.1\|247812_249324_-	lipopolysaccharide biosynthesis protein	NA	NA	NA	NA
WP_068279360.1\|249336_250461_-	DegT/DnrJ/EryC1/StrS family aminotransferase	NA	NA	NA	NA
WP_068225816.1\|250946_252077_-	glycosyltransferase	NA	NA	NA	NA
WP_056973869.1\|252231_253590_-\|transposase	transposase	NA	NA	NA	NA
WP_068279363.1\|253799_255167_-\|transposase	transposase	NA	NA	NA	NA
WP_068279366.1\|255764_256424_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_156520035.1\|256526_257904_+\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	2.0e-25	36.6

DBSCAN-SWA_2

476628 : 485152

Cyanophage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068279516.1\|476628_477117_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	4.5e-20	43.9
WP_068279519.1\|477097_478231_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_068279523.1\|478232_478964_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A1D7SLB8	Cyanophage	1.3e-39	40.4
WP_068279526.1\|478963_479227_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_068279528.1\|479223_479907_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_068279530.1\|479899_482119_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	8.0e-141	39.7
WP_068281252.1\|482103_483564_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.6e-52	34.7
WP_068279533.1\|483550_484564_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	1.4e-60	41.6
WP_068279536.1\|484564_485152_+	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	5.0e-26	38.0

DBSCAN-SWA_3

641806 : 709523

Lactobacillus_phage(27.27%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068279064.1\|641806_643117_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	2.7e-128	54.6
WP_100071605.1\|643368_644019_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_068226124.1\|644098_644575_+	universal stress protein	NA	NA	NA	NA
WP_068226294.1\|644779_645370_+	stage II sporulation protein M	NA	NA	NA	NA
WP_068226125.1\|645531_646062_-	hypothetical protein	NA	NA	NA	NA
WP_068226126.1\|646042_646414_-	DUF4430 domain-containing protein	NA	NA	NA	NA
WP_068226127.1\|646510_647236_+	TatD family hydrolase	NA	NA	NA	NA
WP_068279667.1\|647281_647527_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_068224565.1\|647669_648953_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	5.2e-44	32.1
WP_068279670.1\|649058_649676_+	hypothetical protein	NA	NA	NA	NA
WP_068226129.1\|650497_651433_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_068226130.1\|651635_652346_+	VIT family protein	NA	NA	NA	NA
WP_068226131.1\|652527_653010_-	DNA starvation/stationary phase protection protein	A0A291I9P0	Lactobacillus_phage	1.8e-13	29.9
WP_068226132.1\|653254_654118_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_068226295.1\|654291_654528_+	hypothetical protein	NA	NA	NA	NA
WP_068226133.1\|655757_657479_+	metallophosphoesterase	A0A2P0ZKZ2	Lactobacillus_phage	3.8e-13	22.2
WP_068226134.1\|658802_659555_+	threonine/serine exporter family protein	NA	NA	NA	NA
WP_068226135.1\|659661_660108_+	threonine/serine exporter family protein	NA	NA	NA	NA
WP_068226136.1\|660181_660385_+	hypothetical protein	NA	NA	NA	NA
WP_068226297.1\|660589_661081_+	universal stress protein	NA	NA	NA	NA
WP_068226137.1\|661210_661948_+	DNA/RNA nuclease SfsA	NA	NA	NA	NA
WP_068226138.1\|661936_662863_-	L-lactate dehydrogenase	NA	NA	NA	NA
WP_068226139.1\|662991_664242_-	MFS transporter	NA	NA	NA	NA
WP_068279673.1\|664496_665471_-	bile acid:sodium symporter family protein	NA	NA	NA	NA
WP_068226140.1\|665556_665883_-	metal-sulfur cluster assembly factor	NA	NA	NA	NA
WP_068226141.1\|665920_667687_-	dihydroxy-acid dehydratase	NA	NA	NA	NA
WP_068226142.1\|668347_668560_+	hypothetical protein	NA	NA	NA	NA
WP_068279676.1\|669170_670874_+	biosynthetic-type acetolactate synthase large subunit	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	6.7e-55	29.7
WP_068226144.1\|670874_671366_+	acetolactate synthase small subunit	NA	NA	NA	NA
WP_125982591.1\|671485_672511_+	ketol-acid reductoisomerase	NA	NA	NA	NA
WP_068279682.1\|672721_674002_+	threonine ammonia-lyase IlvA	NA	NA	NA	NA
WP_068226147.1\|674040_674823_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.8e-16	28.0
WP_068226148.1\|675351_675735_-	reactive intermediate/imine deaminase	NA	NA	NA	NA
WP_068226149.1\|676071_677103_+	branched-chain amino acid aminotransferase	NA	NA	NA	NA
WP_068226150.1\|677469_677814_+	hypothetical protein	NA	NA	NA	NA
WP_068279687.1\|679614_680763_+	hypothetical protein	NA	NA	NA	NA
WP_068226152.1\|680767_681091_-	hypothetical protein	NA	NA	NA	NA
WP_068226154.1\|681562_682228_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_068226155.1\|682573_684382_-	oligoendopeptidase F	NA	NA	NA	NA
WP_068226298.1\|684695_685349_-	LysM peptidoglycan-binding domain-containing protein	A0A249XZV3	Enterococcus_phage	1.2e-09	47.1
WP_068226156.1\|685871_687413_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2H4UUX5	Bodo_saltans_virus	5.0e-41	28.0
WP_068226157.1\|687612_689052_+	C69 family dipeptidase	NA	NA	NA	NA
WP_068226158.1\|689276_689606_+	hypothetical protein	NA	NA	NA	NA
WP_068279690.1\|690202_691477_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	9.4e-94	45.6
WP_068226160.1\|691749_692406_+	serine dehydratase	NA	NA	NA	NA
WP_068226161.1\|692420_693317_+	L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha	NA	NA	NA	NA
WP_068281256.1\|693634_695509_+	hypothetical protein	NA	NA	NA	NA
WP_068226162.1\|695689_696538_+	fructosamine kinase family protein	NA	NA	NA	NA
WP_068279693.1\|702381_705117_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_068226164.1\|705561_706479_-	FAD:protein FMN transferase	NA	NA	NA	NA
WP_068279699.1\|706740_707103_-\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	4.3e-28	54.7
WP_068279702.1\|707198_707573_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_017866964.1\|707608_707866_-\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	1.0e-15	47.1
WP_068279055.1\|708251_709523_-\|transposase	ISL3 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

1099225 : 1213319

119

Lactobacillus_phage(52.17%)

transposase,tRNA,protease,head,plate,terminase,tail,integrase,portal,capsid

attL 1109025:1109041|attR 1184330:1184346

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068225439.1\|1099225_1100689_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_068225438.1\|1100688_1102119_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_068225437.1\|1102318_1103293_+	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	2.3e-15	25.1
WP_068222411.1\|1103494_1103677_+	hypothetical protein	NA	NA	NA	NA
WP_068222408.1\|1103666_1104041_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_178378324.1\|1104049_1105603_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.9e-56	30.5
WP_068225436.1\|1105914_1107279_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	3.3e-129	49.0
WP_068280078.1\|1107481_1108351_-	DegV family protein	A0A1X9I5J4	Streptococcus_phage	2.7e-12	25.4
WP_164505762.1\|1108676_1110005_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	2.9e-45	34.2
1109025:1109041	attL	NA	NA	NA	NA
WP_068225433.1\|1110089_1111412_-	amino acid permease	NA	NA	NA	NA
WP_068225432.1\|1111913_1112663_+	hypothetical protein	NA	NA	NA	NA
WP_068225431.1\|1112800_1113187_-	DUF4828 domain-containing protein	NA	NA	NA	NA
WP_068225430.1\|1113337_1114333_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_068280081.1\|1114341_1115607_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	3.1e-33	29.9
WP_068225428.1\|1115716_1116130_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_068225426.1\|1116831_1117764_-	glycosyltransferase family 2 protein	V5USA4	Oenococcus_phage	1.5e-80	50.7
WP_068225425.1\|1117951_1118401_-	flavodoxin	NA	NA	NA	NA
WP_082918516.1\|1118955_1119864_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_068225424.1\|1119940_1120828_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	2.8e-68	47.6
WP_068225423.1\|1120943_1122311_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_068225422.1\|1122601_1124005_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	6.7e-85	36.7
WP_068226247.1\|1124468_1125266_+	recombination regulator RecX	NA	NA	NA	NA
WP_068225421.1\|1125371_1125905_+	DUF402 domain-containing protein	NA	NA	NA	NA
WP_068225420.1\|1126210_1126666_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_068281264.1\|1126792_1127926_+	AI-2E family transporter	NA	NA	NA	NA
WP_068225418.1\|1128159_1129464_+	HlyC/CorC family transporter	NA	NA	NA	NA
WP_068225417.1\|1129535_1131149_+	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	2.7e-13	33.8
WP_068225416.1\|1131289_1132399_-	MucBP domain-containing protein	NA	NA	NA	NA
WP_068225415.1\|1132657_1132951_-	DUF1827 family protein	NA	NA	NA	NA
WP_068225414.1\|1133277_1135515_-\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A2C9CXH0	Yersinia_phage	2.3e-127	42.1
WP_068225413.1\|1135745_1135937_+	hypothetical protein	NA	NA	NA	NA
WP_068225412.1\|1136186_1136453_+	phosphocarrier protein HPr	NA	NA	NA	NA
WP_068225411.1\|1136452_1138177_+	phosphoenolpyruvate--protein phosphotransferase	NA	NA	NA	NA
WP_068279055.1\|1138250_1139522_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_082920491.1\|1139856_1141104_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.6e-08	24.3
WP_068225410.1\|1141332_1142511_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_068225409.1\|1142529_1143558_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_068225408.1\|1143554_1144583_+	flippase-like domain-containing protein	NA	NA	NA	NA
WP_068225407.1\|1144715_1144952_+	YkuJ family protein	NA	NA	NA	NA
WP_068225406.1\|1145227_1147306_+	LTA synthase family protein	W6LM83	Streptococcus_phage	2.5e-152	46.0
WP_068225405.1\|1154680_1155187_-	monooxygenase	NA	NA	NA	NA
WP_068225404.1\|1155344_1156085_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_068225403.1\|1156266_1156665_+	Spx/MgsR family RNA polymerase-binding regulatory protein	NA	NA	NA	NA
WP_068225402.1\|1157139_1157832_+	adaptor protein MecA	NA	NA	NA	NA
WP_068279055.1\|1158001_1159273_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_068280087.1\|1159467_1160565_+	hypothetical protein	NA	NA	NA	NA
WP_068225400.1\|1160792_1161425_-	DsbA family protein	NA	NA	NA	NA
WP_068280089.1\|1161578_1162151_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_068225398.1\|1162294_1162984_+	GTP pyrophosphokinase family protein	NA	NA	NA	NA
WP_068225397.1\|1162992_1163802_+	NAD kinase	NA	NA	NA	NA
WP_068225396.1\|1163798_1164701_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_068280090.1\|1164762_1166136_+	magnesium transporter	NA	NA	NA	NA
WP_068225394.1\|1166255_1166900_-	copper homeostasis protein CutC	NA	NA	NA	NA
WP_068225393.1\|1166911_1167949_-	lactonase family protein	NA	NA	NA	NA
WP_068225392.1\|1168142_1168520_+	PTS glucitol/sorbitol transporter subunit IIA	NA	NA	NA	NA
WP_068225391.1\|1168843_1170001_+	AI-2E family transporter	NA	NA	NA	NA
WP_068225390.1\|1170064_1170334_-	30S ribosomal protein S14	NA	NA	NA	NA
WP_068225389.1\|1170408_1171386_-	GMP reductase	G3MBI2	Bacillus_virus	9.2e-142	74.8
WP_068225388.1\|1172515_1173352_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_068225387.1\|1173723_1174914_-\|integrase	site-specific integrase	A0A0M5M609	Bacillus_phage	6.0e-18	29.1
WP_068280093.1\|1175070_1175706_-	zinc-ribbon domain-containing protein	NA	NA	NA	NA
WP_068280095.1\|1175728_1175992_-	hypothetical protein	NA	NA	NA	NA
WP_068225384.1\|1176076_1176736_-	LexA family transcriptional regulator	B4XYR6	Lactobacillus_phage	8.6e-59	52.2
WP_068280097.1\|1176908_1177133_+	helix-turn-helix transcriptional regulator	A0A2K9VBT6	Staphylococcus_phage	1.9e-10	47.8
WP_068225382.1\|1177178_1177934_+	phage antirepressor KilAC domain-containing protein	A0A0A7DN31	Lactobacillus_phage	8.6e-71	62.6
WP_068225381.1\|1177948_1178230_+	hypothetical protein	NA	NA	NA	NA
WP_068225060.1\|1178632_1179175_+	host-nuclease inhibitor Gam family protein	NA	NA	NA	NA
WP_068280100.1\|1179186_1179498_+	hypothetical protein	NA	NA	NA	NA
WP_068280103.1\|1179490_1180186_+	ERF family protein	A0A2H4J7J4	uncultured_Caudovirales_phage	8.6e-25	42.6
WP_068280108.1\|1180185_1180857_+	hypothetical protein	U5U4M2	Lactobacillus_phage	7.1e-85	67.3
WP_068280112.1\|1180843_1181722_+	helix-turn-helix domain-containing protein	A0A2P1CD59	Lactobacillus_phage	3.9e-30	65.7
WP_068280115.1\|1181718_1182996_+	AAA family ATPase	A0A1P8VVQ6	Streptococcus_phage	3.0e-23	33.1
WP_068280118.1\|1183009_1183387_+	hypothetical protein	NA	NA	NA	NA
WP_068280122.1\|1183373_1183700_+	VRR-NUC domain-containing protein	A8ATF4	Listeria_phage	3.9e-12	40.6
WP_068280124.1\|1183701_1183947_+	hypothetical protein	NA	NA	NA	NA
WP_082920473.1\|1183939_1184302_+	single-stranded DNA-binding protein	A0A1S5SAA1	Streptococcus_phage	1.2e-38	63.1
WP_068280126.1\|1184320_1184890_+	hypothetical protein	NA	NA	NA	NA
1184330:1184346	attR	NA	NA	NA	NA
WP_068280128.1\|1184992_1185229_+	hypothetical protein	NA	NA	NA	NA
WP_068280130.1\|1185229_1185733_+	DUF1642 domain-containing protein	Q8LTB6	Lactobacillus_phage	1.5e-39	57.1
WP_068280133.1\|1185722_1186073_+	DUF1642 domain-containing protein	B4XYT7	Lactobacillus_phage	1.7e-13	39.5
WP_082920472.1\|1186092_1186836_+	site-specific DNA-methyltransferase	B4XYT3	Lactobacillus_phage	2.2e-103	71.4
WP_156520057.1\|1186875_1187028_+	hypothetical protein	NA	NA	NA	NA
WP_068280139.1\|1187290_1187536_+	hypothetical protein	NA	NA	NA	NA
WP_068280142.1\|1187555_1187825_+	hypothetical protein	NA	NA	NA	NA
WP_191980585.1\|1187886_1188132_+	hypothetical protein	Q5ULS7	Lactobacillus_virus	4.3e-24	74.2
WP_068280145.1\|1188161_1188473_+	hypothetical protein	A0A1S5SA91	Streptococcus_phage	2.9e-09	37.8
WP_167574660.1\|1188489_1188654_+	hypothetical protein	A0A2D1GPI6	Lactobacillus_phage	2.3e-21	88.5
WP_068280148.1\|1188643_1188898_+	hypothetical protein	NA	NA	NA	NA
WP_156520056.1\|1188966_1189185_+	hypothetical protein	NA	NA	NA	NA
WP_156520055.1\|1189433_1189577_+	hypothetical protein	NA	NA	NA	NA
WP_068280156.1\|1189910_1190114_+	hypothetical protein	NA	NA	NA	NA
WP_068280158.1\|1190128_1190413_+	hypothetical protein	NA	NA	NA	NA
WP_068280160.1\|1190427_1190652_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_156520054.1\|1190642_1191086_+	DUF1064 domain-containing protein	A0A1I9KKZ1	Lactobacillus_phage	1.1e-30	45.7
WP_068280166.1\|1191098_1191293_+	hypothetical protein	NA	NA	NA	NA
WP_156520053.1\|1191308_1191566_+	hypothetical protein	NA	NA	NA	NA
WP_068280173.1\|1191834_1192245_+	hypothetical protein	NA	NA	NA	NA
WP_082920490.1\|1192620_1193085_+	HNH endonuclease	E9LUP7	Lactobacillus_phage	5.1e-66	77.2
WP_068280179.1\|1193271_1193733_+\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	8.4e-53	67.1
WP_068280182.1\|1193722_1195630_+\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	8.3e-280	72.8
WP_082920239.1\|1195601_1195826_+	DUF1056 family protein	NA	NA	NA	NA
WP_068280185.1\|1195825_1197031_+\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	2.6e-130	58.8
WP_068280189.1\|1196996_1197776_+\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	1.5e-57	54.6
WP_068280192.1\|1197775_1199008_+\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	1.4e-142	66.7
WP_068280195.1\|1199052_1199247_+	hypothetical protein	NA	NA	NA	NA
WP_068280198.1\|1199259_1199616_+\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	1.3e-24	59.5
WP_068280201.1\|1199599_1199959_+\|head	phage head closure protein	E9LUQ5	Lactobacillus_phage	5.6e-36	56.3
WP_068280204.1\|1199951_1200386_+\|tail	phage tail protein	E9LUQ6	Lactobacillus_phage	2.6e-35	55.9
WP_068280207.1\|1200385_1200766_+	DUF806 family protein	E9LUQ7	Lactobacillus_phage	1.9e-34	55.1
WP_068280210.1\|1200766_1201408_+\|tail	phage tail protein	E9LUQ8	Lactobacillus_phage	2.6e-84	75.0
WP_068280213.1\|1201576_1201975_+	hypothetical protein	NA	NA	NA	NA
WP_143452801.1\|1201983_1202163_+	hypothetical protein	E9LUR0	Lactobacillus_phage	1.9e-16	69.5
WP_068280216.1\|1202178_1207107_+\|tail	phage tail tape measure protein	E9LUR1	Lactobacillus_phage	1.4e-100	40.7
WP_068280219.1\|1207120_1207960_+\|tail	phage tail family protein	A0A0M7RF73	Lactobacillus_phage	8.4e-43	35.3
WP_167574659.1\|1207919_1209071_+\|tail	phage tail protein	A0A0M7RDS2	Lactobacillus_phage	1.4e-83	47.9
WP_068280227.1\|1209722_1210325_+	collagen-like protein	NA	NA	NA	NA
WP_068280230.1\|1210335_1210701_+	hypothetical protein	NA	NA	NA	NA
WP_068280234.1\|1210693_1212310_+	hypothetical protein	NA	NA	NA	NA
WP_068280237.1\|1212341_1213319_+\|plate	BppU family phage baseplate upper protein	NA	NA	NA	NA

DBSCAN-SWA_5

1507078 : 1557533

Bacillus_phage(23.08%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068279055.1\|1507078_1508350_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_156520064.1\|1508605_1509286_+	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_068224757.1\|1509349_1509847_+	ComE operon protein 2	A7KUY9	Bacillus_phage	8.5e-35	56.9
WP_068280398.1\|1509859_1512085_+	DNA internalization-related competence protein ComEC/Rec2	Q332C0	Clostridium_botulinum_C_phage	7.2e-25	27.8
WP_068224752.1\|1512089_1513121_+	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_035457977.1\|1513355_1514627_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_068224746.1\|1514677_1514935_-	30S ribosomal protein S20	NA	NA	NA	NA
WP_068224744.1\|1515216_1515486_+	30S ribosomal protein S15	NA	NA	NA	NA
WP_068224742.1\|1515693_1516572_+	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_068281269.1\|1516611_1518273_+	ribonuclease J	NA	NA	NA	NA
WP_068224740.1\|1518423_1519386_+	hypothetical protein	NA	NA	NA	NA
WP_068224739.1\|1519610_1520798_+	elongation factor Tu	A0A076FFS6	Aureococcus_anophage	5.6e-32	27.6
WP_068224736.1\|1520979_1522305_+	trigger factor	NA	NA	NA	NA
WP_068224733.1\|1522539_1523790_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.4e-137	57.4
WP_068224730.1\|1524042_1524639_+	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_068224727.1\|1524638_1524923_+	nucleoside triphosphate pyrophosphohydrolase family protein	A0A1Q1PVZ6	Staphylococcus_phage	2.6e-20	52.1
WP_068224724.1\|1525204_1525963_-	3-oxoacyl-ACP reductase	NA	NA	NA	NA
WP_068224722.1\|1525959_1526184_-	DUF2829 domain-containing protein	G3MBC9	Bacillus_virus	1.8e-08	35.2
WP_164505765.1\|1526311_1526449_-	hypothetical protein	NA	NA	NA	NA
WP_068224719.1\|1526647_1528105_+	ABC transporter substrate-binding protein/permease	NA	NA	NA	NA
WP_156520063.1\|1528106_1528838_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	6.0e-29	36.4
WP_068224714.1\|1529065_1530838_+	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_156520052.1\|1530968_1531613_+	hypothetical protein	NA	NA	NA	NA
WP_068280404.1\|1531689_1533627_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_068224708.1\|1533742_1534657_-	1-phosphofructokinase	NA	NA	NA	NA
WP_068280407.1\|1534653_1535409_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.2e-24	35.9
WP_068224704.1\|1535598_1536894_+	GTPase ObgE	NA	NA	NA	NA
WP_068224702.1\|1537107_1539021_+	acetyltransferase	A0A1R3Y5Q6	Salmonella_virus	3.9e-27	27.5
WP_068280410.1\|1539211_1540141_+	ribonuclease Z	NA	NA	NA	NA
WP_068224696.1\|1540152_1540950_+	SDR family oxidoreductase	W8CYX9	Bacillus_phage	9.3e-07	39.5
WP_068224693.1\|1540991_1541408_+	DUF1049 domain-containing protein	NA	NA	NA	NA
WP_082918574.1\|1541522_1543829_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.5e-73	30.5
WP_068224688.1\|1543841_1544360_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	2.4e-24	38.7
WP_068224565.1\|1544508_1545792_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	5.2e-44	32.1
WP_068223783.1\|1546072_1548484_-	Xaa-Pro dipeptidyl-peptidase	NA	NA	NA	NA
WP_156519987.1\|1548650_1548803_-	hypothetical protein	NA	NA	NA	NA
WP_068223786.1\|1548807_1549242_-	universal stress protein	NA	NA	NA	NA
WP_068223789.1\|1549695_1551105_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_082920249.1\|1551510_1551819_+	hypothetical protein	NA	NA	NA	NA
WP_068226203.1\|1551861_1552041_+	hypothetical protein	NA	NA	NA	NA
WP_068223115.1\|1552546_1553896_+\|transposase	transposase	NA	NA	NA	NA
WP_068223792.1\|1554130_1554385_-	hypothetical protein	NA	NA	NA	NA
WP_156520051.1\|1554559_1555201_-	hypothetical protein	NA	NA	NA	NA
WP_068226204.1\|1555277_1555694_-	PAS domain-containing protein	NA	NA	NA	NA
WP_068223798.1\|1555920_1556187_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_068280414.1\|1556345_1556585_+	cytochrome B5	NA	NA	NA	NA
WP_068223803.1\|1556874_1557183_+	50S ribosomal protein L21	NA	NA	NA	NA
WP_068223806.1\|1557200_1557533_+\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA

DBSCAN-SWA_6

1606467 : 1642109

Streptococcus_phage(30.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068280476.1\|1606467_1607220_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_068280479.1\|1607272_1607602_-	hypothetical protein	NA	NA	NA	NA
WP_068223957.1\|1608180_1608528_+	50S ribosomal protein L19	NA	NA	NA	NA
WP_068279055.1\|1608666_1609938_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_068223960.1\|1610354_1611290_+	HNH endonuclease	NA	NA	NA	NA
WP_068280482.1\|1611291_1612857_+	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_068223965.1\|1613237_1613957_+	hypothetical protein	NA	NA	NA	NA
WP_068280485.1\|1614128_1615004_+	DUF1211 domain-containing protein	NA	NA	NA	NA
WP_068224077.1\|1615179_1616463_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.1e-45	32.1
WP_068280488.1\|1616728_1618222_-	glutamate/gamma-aminobutyrate family transporter YjeM	NA	NA	NA	NA
WP_068280491.1\|1618397_1619825_-	C69 family dipeptidase	NA	NA	NA	NA
WP_068223975.1\|1620066_1620954_+	YitT family protein	M1Q1P6	Streptococcus_phage	9.3e-24	28.9
WP_065928829.1\|1621076_1622102_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	3.3e-41	35.1
WP_068223978.1\|1622912_1623098_+	tautomerase family protein	NA	NA	NA	NA
WP_068280494.1\|1623273_1624584_+	diaminopimelate decarboxylase	NA	NA	NA	NA
WP_057823861.1\|1624738_1625461_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_143452886.1\|1625394_1626336_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	3.0e-20	28.0
WP_068280497.1\|1626399_1627578_-	class I SAM-dependent methyltransferase	A0A2K9L4K8	Tupanvirus	7.9e-47	34.5
WP_068280500.1\|1627930_1628893_+	2-hydroxyacid dehydrogenase family protein	M1NSB9	Streptococcus_phage	2.2e-23	34.3
WP_156520661.1\|1629082_1629520_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_082920463.1\|1629574_1630201_+	GyrI-like domain-containing protein	NA	NA	NA	NA
WP_068280506.1\|1630506_1630785_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_068280509.1\|1630784_1631150_+	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_068222411.1\|1631617_1631800_+	hypothetical protein	NA	NA	NA	NA
WP_068222408.1\|1631789_1632164_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_178378324.1\|1632172_1633726_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.9e-56	30.5
WP_068280512.1\|1633910_1634675_-	peroxide stress protein YaaA	NA	NA	NA	NA
WP_068280515.1\|1634856_1635300_-	DnaB-like helicase C-terminal domain-containing protein	A0A0P0IXJ2	Lactobacillus_phage	5.8e-27	48.6
WP_068280518.1\|1635296_1636058_-	hypothetical protein	A8YQM1	Lactobacillus_phage	1.0e-26	32.3
WP_068280521.1\|1636047_1636908_-	conserved phage C-terminal domain-containing protein	NA	NA	NA	NA
WP_068280523.1\|1637372_1638125_+	NADPH-dependent oxidoreductase	NA	NA	NA	NA
WP_068280526.1\|1638588_1638990_+	hypothetical protein	NA	NA	NA	NA
WP_068280529.1\|1638970_1640263_+	Y-family DNA polymerase	O64031	Bacillus_phage	2.3e-76	38.2
WP_068280532.1\|1640259_1640592_+	hypothetical protein	NA	NA	NA	NA
WP_068222179.1\|1640936_1642109_-\|transposase	IS256 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

1657650 : 1666629

Staphylococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068280559.1\|1657650_1658520_-	YitT family protein	M1Q1P6	Streptococcus_phage	4.6e-52	38.7
WP_068280563.1\|1658638_1659427_+	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_068280566.1\|1659423_1660632_+\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	5.5e-43	51.7
WP_068280570.1\|1661024_1662908_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2H4UUX5	Bodo_saltans_virus	9.1e-45	27.1
WP_191980582.1\|1662917_1663871_+	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	1.1e-120	65.3
WP_068280573.1\|1663883_1664378_+	dihydrofolate reductase	A0A0N9S8H6	Staphylococcus_phage	9.4e-26	37.7
WP_068280576.1\|1664982_1665630_-	hemolysin III family protein	NA	NA	NA	NA
WP_068224134.1\|1665783_1666629_+	DegV family protein	A0A0N9SI50	Staphylococcus_phage	1.5e-18	41.8

DBSCAN-SWA_8

1722923 : 1786808

Bacillus_phage(55.56%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_056973869.1\|1722923_1724282_+\|transposase	transposase	NA	NA	NA	NA
WP_156520050.1\|1724342_1724666_-	nitroreductase family protein	NA	NA	NA	NA
WP_068224269.1\|1727227_1728133_-	Abi family protein	NA	NA	NA	NA
WP_068224272.1\|1729056_1730187_-	class I SAM-dependent RNA methyltransferase	NA	NA	NA	NA
WP_068224275.1\|1730716_1731067_-	cell division regulator GpsB	NA	NA	NA	NA
WP_068280622.1\|1731126_1731693_-	DUF1273 domain-containing protein	NA	NA	NA	NA
WP_068224281.1\|1731767_1732415_+	Holliday junction resolvase RecU	A0A1C8E9C3	Bacillus_phage	1.8e-21	34.3
WP_068280624.1\|1732404_1734741_+	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_068280627.1\|1734916_1735567_-	endonuclease III	NA	NA	NA	NA
WP_068224288.1\|1735579_1736311_-	DnaD domain protein	A0A0N7AE27	Bacillus_phage	7.7e-16	38.7
WP_068280630.1\|1736491_1737790_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	8.7e-55	29.5
WP_068224293.1\|1737813_1739001_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_068224296.1\|1739019_1739514_-	DUF5590 domain-containing protein	NA	NA	NA	NA
WP_068280633.1\|1739592_1742397_-	ATP-dependent helicase	A0A127AW80	Bacillus_phage	1.2e-35	23.5
WP_068280636.1\|1742621_1743584_+	mevalonate kinase	NA	NA	NA	NA
WP_068280639.1\|1743583_1744555_+	diphosphomevalonate decarboxylase	NA	NA	NA	NA
WP_068280642.1\|1744648_1745722_+	phosphomevalonate kinase	NA	NA	NA	NA
WP_068280644.1\|1745884_1746925_+	type 2 isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
WP_068280646.1\|1747028_1748396_-	RsmF rRNA methyltransferase first C-terminal domain-containing protein	NA	NA	NA	NA
WP_068280650.1\|1748401_1749391_-	ABC transporter permease	NA	NA	NA	NA
WP_068280652.1\|1749519_1750296_-	hypothetical protein	NA	NA	NA	NA
WP_068224319.1\|1750432_1750771_-	metal-sulfur cluster assembly factor	NA	NA	NA	NA
WP_068280654.1\|1750861_1752364_-	glycerol kinase GlpK	NA	NA	NA	NA
WP_068280655.1\|1752561_1754001_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_068224328.1\|1754528_1755233_-	hypothetical protein	NA	NA	NA	NA
WP_068280657.1\|1755222_1756098_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.0e-16	28.6
WP_068224333.1\|1756078_1756462_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_068224335.1\|1756911_1757409_-	energy coupling factor transporter S component ThiW	NA	NA	NA	NA
WP_068224565.1\|1757851_1759135_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	5.2e-44	32.1
WP_156520049.1\|1759284_1759452_-	hypothetical protein	NA	NA	NA	NA
WP_068279064.1\|1759842_1761153_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	2.7e-128	54.6
WP_068280661.1\|1761330_1761906_-	hypothetical protein	NA	NA	NA	NA
WP_068280662.1\|1761964_1763200_-	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_068280663.1\|1763348_1763840_-	thioredoxin domain-containing protein	NA	NA	NA	NA
WP_068279055.1\|1764036_1765308_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_068224347.1\|1765873_1766452_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_068281277.1\|1767103_1768159_-	DUF916 and DUF3324 domain-containing protein	NA	NA	NA	NA
WP_068280666.1\|1768375_1769098_-	WxL domain-containing protein	NA	NA	NA	NA
WP_068280670.1\|1769113_1769485_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_068280673.1\|1769501_1771013_-	hypothetical protein	NA	NA	NA	NA
WP_068280676.1\|1771588_1773070_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_068224357.1\|1773516_1773828_-	DUF2316 family protein	NA	NA	NA	NA
WP_068280680.1\|1774245_1774881_-	NAD(P)H-binding protein	NA	NA	NA	NA
WP_068224360.1\|1775096_1775501_-	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_068280681.1\|1776047_1776917_+	hypothetical protein	NA	NA	NA	NA
WP_068224366.1\|1777290_1778019_+	hypothetical protein	NA	NA	NA	NA
WP_068224372.1\|1778238_1779192_-	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_068280685.1\|1779209_1779764_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_068280689.1\|1779932_1781168_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_082920457.1\|1781179_1782358_-	MFS transporter	NA	NA	NA	NA
WP_068280690.1\|1782350_1782902_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_158234248.1\|1782995_1783856_+	Rgg/GadR/MutR family transcriptional regulator	NA	NA	NA	NA
WP_068280691.1\|1784257_1785049_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_105782191.1\|1785681_1786566_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.2e-65	48.3
WP_017866964.1\|1786550_1786808_-\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	1.0e-15	47.1

DBSCAN-SWA_9

1817964 : 1876459

Leptospira_phage(17.65%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068280746.1\|1817964_1818663_-\|tRNA	tRNA (adenine(22)-N(1))-methyltransferase TrmK	NA	NA	NA	NA
WP_068280748.1\|1819005_1820121_-	RNA polymerase sigma factor RpoD	F4YCU2	Synechococcus_phage	2.9e-38	38.6
WP_068280751.1\|1820133_1821987_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.4e-50	34.2
WP_068280755.1\|1822226_1824308_-\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_068280758.1\|1824309_1825215_-\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
WP_178378319.1\|1825572_1826307_-	DNA repair protein RecO	NA	NA	NA	NA
WP_068224481.1\|1826405_1827314_-	GTPase Era	NA	NA	NA	NA
WP_068224484.1\|1827347_1827749_-	diacylglycerol kinase family protein	NA	NA	NA	NA
WP_068224488.1\|1827726_1828203_-	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_167574665.1\|1828239_1829151_-	PhoH family protein	L7TP00	Rhizobium_phage	1.7e-49	48.1
WP_068224494.1\|1829335_1829782_-	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	6.1e-16	37.0
WP_068224497.1\|1829818_1829995_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_068224499.1\|1830245_1831079_+	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_068224501.1\|1831081_1831984_-	deoxyribonuclease IV	A0A2H4UU70	Bodo_saltans_virus	5.5e-24	31.8
WP_068224503.1\|1832074_1832845_+	nitroreductase family protein	NA	NA	NA	NA
WP_068224508.1\|1832844_1834197_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_068224510.1\|1834483_1835359_-	YitT family protein	NA	NA	NA	NA
WP_068224515.1\|1835622_1836138_-	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_068280774.1\|1836138_1836591_-	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_125636215.1\|1836802_1837159_-	hypothetical protein	NA	NA	NA	NA
WP_068222411.1\|1837290_1837473_+	hypothetical protein	NA	NA	NA	NA
WP_068222408.1\|1837462_1837837_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_178378324.1\|1837845_1839399_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.9e-56	30.5
WP_068224524.1\|1839888_1841667_-\|tRNA	aspartate--tRNA ligase	NA	NA	NA	NA
WP_068224527.1\|1841683_1842973_-\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
WP_068224529.1\|1843621_1844890_+	N-acetylmuramoyl-L-alanine amidase	C8CHK8	Thermus_virus	5.8e-11	38.0
WP_178378324.1\|1845003_1846557_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.9e-56	30.5
WP_068222408.1\|1846565_1846940_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_068222411.1\|1846929_1847112_-	hypothetical protein	NA	NA	NA	NA
WP_068224533.1\|1847348_1847675_-	AzlD domain-containing protein	NA	NA	NA	NA
WP_068280776.1\|1847664_1848456_-	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_068224539.1\|1848537_1849161_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_068224542.1\|1849372_1849816_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_068280785.1\|1850055_1852293_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	S4TRQ0	Salmonella_phage	2.0e-06	42.3
WP_068224549.1\|1852396_1852741_-	hypothetical protein	NA	NA	NA	NA
WP_068224552.1\|1853109_1853856_-	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
WP_068224554.1\|1853855_1854806_-	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
WP_068224557.1\|1854826_1855321_-	DUF3013 family protein	NA	NA	NA	NA
WP_068280788.1\|1855317_1855947_-	DNA-3-methyladenine glycosylase	NA	NA	NA	NA
WP_068224562.1\|1856028_1856397_-	hypothetical protein	NA	NA	NA	NA
WP_068280791.1\|1856530_1858183_+	phosphoenolpyruvate carboxykinase (ATP)	NA	NA	NA	NA
WP_156520048.1\|1858411_1858564_-	hypothetical protein	NA	NA	NA	NA
WP_017866964.1\|1858644_1858902_+\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	1.0e-15	47.1
WP_105782191.1\|1858886_1859771_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.2e-65	48.3
WP_068280792.1\|1860289_1861384_-	FAD:protein FMN transferase	NA	NA	NA	NA
WP_068280793.1\|1861541_1862153_+	hypothetical protein	NA	NA	NA	NA
WP_068280799.1\|1862282_1863152_-	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	5.4e-08	33.3
WP_068280802.1\|1863529_1864864_+	glucosaminidase domain-containing protein	A0A0K2CP65	Brevibacillus_phage	4.8e-08	39.6
WP_068223443.1\|1864931_1866107_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_156520047.1\|1866670_1866823_+	hypothetical protein	NA	NA	NA	NA
WP_068224595.1\|1867076_1868915_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	1.4e-21	24.4
WP_068224598.1\|1869079_1870246_-	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	6.9e-19	24.1
WP_068280805.1\|1870438_1872301_-	molecular chaperone DnaK	A0A2P1EIW2	Megavirus	2.7e-134	45.8
WP_075168967.1\|1872336_1872969_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_068224608.1\|1872987_1874031_-	heat-inducible transcriptional repressor HrcA	NA	NA	NA	NA
WP_068222411.1\|1874350_1874533_+	hypothetical protein	NA	NA	NA	NA
WP_068222408.1\|1874522_1874897_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_178378324.1\|1874905_1876459_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.9e-56	30.5

DBSCAN-SWA_10

2077153 : 2146893

Streptomyces_phage(11.76%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082920486.1\|2077153_2078401_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	5.3e-09	24.7
WP_068223376.1\|2078477_2078801_-	thioredoxin	A0A1J0GW78	Streptomyces_phage	1.2e-16	43.0
WP_068280880.1\|2078953_2081311_-	endonuclease MutS2	Q94M10	Lactobacillus_phage	7.2e-23	67.6
WP_068223370.1\|2081460_2081994_-	CvpA family protein	NA	NA	NA	NA
WP_068223368.1\|2082017_2082281_-	cell division protein ZapA	NA	NA	NA	NA
WP_082925668.1\|2082596_2083364_-	Holliday junction resolvase RuvX	NA	NA	NA	NA
WP_068223359.1\|2083363_2083624_-	IreB family regulatory phosphoprotein	NA	NA	NA	NA
WP_068223356.1\|2083968_2086608_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	4.4e-61	33.3
WP_125636141.1\|2086957_2088307_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.1e-44	29.5
WP_068223350.1\|2088321_2089263_-	bifunctional oligoribonuclease/PAP phosphatase NrnA	NA	NA	NA	NA
WP_068280882.1\|2089271_2090576_-	CBS domain-containing protein	NA	NA	NA	NA
WP_068223344.1\|2090580_2090814_-	hypothetical protein	NA	NA	NA	NA
WP_068223341.1\|2090895_2092011_-	DNA polymerase IV	NA	NA	NA	NA
WP_068223338.1\|2092158_2093661_-	glucose-6-phosphate dehydrogenase	A0A1D8KKB7	Synechococcus_phage	2.3e-75	35.8
WP_068280888.1\|2093952_2096577_-	bifunctional acetaldehyde-CoA/alcohol dehydrogenase	NA	NA	NA	NA
WP_068280891.1\|2097352_2097748_-	preprotein translocase subunit YajC	NA	NA	NA	NA
WP_068223330.1\|2097827_2098970_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	8.1e-81	42.7
WP_068223326.1\|2099482_2100517_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_068223324.1\|2100544_2101555_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	9.6e-09	29.5
WP_068223321.1\|2101572_2102184_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_068223319.1\|2102283_2102598_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_068223316.1\|2102594_2102927_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_068223308.1\|2105206_2107912_-	DNA mismatch repair protein MutS	E3T5Q7	Cafeteria_roenbergensis_virus	1.5e-32	21.4
WP_068223305.1\|2107914_2108295_-	YlbF family regulator	NA	NA	NA	NA
WP_068223302.1\|2108308_2109118_-	TIGR00282 family metallophosphoesterase	NA	NA	NA	NA
WP_068223299.1\|2109213_2111043_-	APC family permease	NA	NA	NA	NA
WP_068280896.1\|2111917_2113558_-	chaperonin GroEL	A0A240F766	uncultured_virus	7.2e-155	53.8
WP_068223293.1\|2113720_2114005_-	co-chaperone GroES	A0A221S331	uncultured_virus	1.8e-13	41.1
WP_068223290.1\|2114201_2114840_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_068223287.1\|2115106_2115766_-	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_068223284.1\|2116108_2118067_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	6.1e-52	29.0
WP_068280899.1\|2118213_2119257_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	NA	NA	NA	NA
WP_158234209.1\|2119268_2119736_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_068223279.1\|2119740_2120289_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_068223276.1\|2120272_2121001_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_068223273.1\|2121322_2121862_-	folate family ECF transporter S component	NA	NA	NA	NA
WP_068223268.1\|2122577_2123552_+	asparaginase	NA	NA	NA	NA
WP_156519986.1\|2123617_2123761_+	hypothetical protein	NA	NA	NA	NA
WP_068223266.1\|2123817_2124717_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.2e-74	48.8
WP_068223262.1\|2125052_2125295_-	hypothetical protein	NA	NA	NA	NA
WP_068223259.1\|2125694_2125934_-	hypothetical protein	NA	NA	NA	NA
WP_068280902.1\|2126115_2126934_-	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_068280906.1\|2127095_2127275_+	hypothetical protein	NA	NA	NA	NA
WP_068280909.1\|2127644_2128478_+	metallophosphoesterase family protein	NA	NA	NA	NA
WP_068280911.1\|2129003_2129711_+	hypothetical protein	NA	NA	NA	NA
WP_068280914.1\|2131659_2132268_+	hypothetical protein	NA	NA	NA	NA
WP_068280917.1\|2132379_2132844_+	hypothetical protein	NA	NA	NA	NA
WP_068280921.1\|2133490_2133919_+	GtrA family protein	NA	NA	NA	NA
WP_178378324.1\|2134354_2135908_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.9e-56	30.5
WP_068222408.1\|2135916_2136291_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_068222411.1\|2136280_2136463_-	hypothetical protein	NA	NA	NA	NA
WP_068280930.1\|2136561_2138625_-	glycoside hydrolase family protein	A0A1B1P9G1	Acinetobacter_phage	2.3e-25	51.4
WP_082920485.1\|2138654_2139767_-	DUF1175 family protein	D2KRB9	Lactobacillus_phage	4.1e-13	38.2
WP_068280932.1\|2139897_2140776_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_068279055.1\|2141103_2142375_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_156520042.1\|2142544_2144524_-	C40 family peptidase	A0A1J0GW44	Streptomyces_phage	9.0e-19	40.5
WP_035457977.1\|2145621_2146893_+\|transposase	ISL3 family transposase	NA	NA	NA	NA

DBSCAN-SWA_11

2149941 : 2273870

112

Bacillus_phage(25.71%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017866964.1\|2149941_2150199_+\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	1.0e-15	47.1
WP_105782191.1\|2150183_2151068_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.2e-65	48.3
WP_068280948.1\|2151594_2153091_-	hypothetical protein	NA	NA	NA	NA
WP_068280951.1\|2153111_2154080_-	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	6.3e-50	37.7
WP_068280953.1\|2154225_2155155_-	glycosyltransferase	V5USA4	Oenococcus_phage	6.4e-84	52.8
WP_105782191.1\|2155754_2156639_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.2e-65	48.3
WP_017866964.1\|2156623_2156881_-\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	1.0e-15	47.1
WP_068280955.1\|2157200_2158376_-	acyltransferase family protein	NA	NA	NA	NA
WP_068280957.1\|2159289_2160213_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_068280960.1\|2160532_2162284_-	hypothetical protein	NA	NA	NA	NA
WP_068280963.1\|2162343_2162745_-	glycerol-3-phosphate cytidylyltransferase	A0A1V0SGE7	Hokovirus	7.6e-18	39.9
WP_068280967.1\|2162763_2164185_-	flippase	NA	NA	NA	NA
WP_068280974.1\|2164188_2165307_-	UDP-galactopyranose mutase	E4ZFQ1	Streptococcus_phage	4.7e-166	73.9
WP_082920451.1\|2165774_2166599_+	LicD family protein	A0A1V0SAS8	Catovirus	8.7e-08	36.8
WP_068280982.1\|2166646_2167870_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_068280985.1\|2167877_2168780_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_068280991.1\|2168807_2169929_-	glycosyltransferase	NA	NA	NA	NA
WP_068280994.1\|2169925_2170699_-	DUF4422 domain-containing protein	NA	NA	NA	NA
WP_068280999.1\|2170688_2172065_-	hypothetical protein	NA	NA	NA	NA
WP_068281005.1\|2172094_2172970_-	hypothetical protein	NA	NA	NA	NA
WP_068281007.1\|2173071_2173788_-	sugar transferase	NA	NA	NA	NA
WP_068281009.1\|2174395_2174803_+	hypothetical protein	NA	NA	NA	NA
WP_068281011.1\|2174871_2175576_-	NTP transferase domain-containing protein	NA	NA	NA	NA
WP_068281013.1\|2175596_2176541_-	DMT family transporter	NA	NA	NA	NA
WP_068281020.1\|2176527_2178390_-	phosphotransferase	NA	NA	NA	NA
WP_068281022.1\|2178750_2184801_-	KxYKxGKxW signal peptide domain-containing protein	NA	NA	NA	NA
WP_125636173.1\|2184906_2185377_-	glyoxalase/bleomycin resistance/extradiol dioxygenase family protein	NA	NA	NA	NA
WP_068223152.1\|2185880_2186144_-	hypothetical protein	NA	NA	NA	NA
WP_068223145.1\|2186220_2186403_-	hypothetical protein	NA	NA	NA	NA
WP_068281027.1\|2186562_2187846_-	DnaB-like helicase C-terminal domain-containing protein	A8YQM1	Lactobacillus_phage	2.1e-69	39.2
WP_068281031.1\|2187835_2188876_-	conserved phage C-terminal domain-containing protein	NA	NA	NA	NA
WP_068281035.1\|2189679_2190837_+	LCP family protein	NA	NA	NA	NA
WP_068281036.1\|2191097_2191856_-	hypothetical protein	NA	NA	NA	NA
WP_068281041.1\|2192261_2193146_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_068279055.1\|2194050_2195322_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_068281047.1\|2195737_2196298_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_068281050.1\|2196539_2196755_+	hypothetical protein	NA	NA	NA	NA
WP_068223118.1\|2197083_2197329_+	DUF2922 domain-containing protein	NA	NA	NA	NA
WP_068223113.1\|2197995_2198589_-	sulfurtransferase-like selenium metabolism protein YedF	NA	NA	NA	NA
WP_068281052.1\|2198974_2200165_-	cobalamin-independent methionine synthase II family protein	NA	NA	NA	NA
WP_068281053.1\|2200441_2201260_-	DUF1828 domain-containing protein	NA	NA	NA	NA
WP_068281054.1\|2201249_2201642_-	hypothetical protein	Q4ZCB9	Staphylococcus_virus	8.8e-11	38.8
WP_178378324.1\|2202076_2203630_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.9e-56	30.5
WP_068222408.1\|2203638_2204013_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_068222411.1\|2204002_2204185_-	hypothetical protein	NA	NA	NA	NA
WP_178378324.1\|2204360_2205914_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.9e-56	30.5
WP_068222408.1\|2205922_2206297_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_068222411.1\|2206286_2206469_-	hypothetical protein	NA	NA	NA	NA
WP_068281056.1\|2207112_2208144_-	sugar transferase	NA	NA	NA	NA
WP_068281061.1\|2208187_2209138_-	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	1.1e-11	40.0
WP_068281063.1\|2209187_2210255_-	glycosyltransferase	NA	NA	NA	NA
WP_068281066.1\|2210326_2211484_-	hypothetical protein	NA	NA	NA	NA
WP_068281067.1\|2211704_2212706_-	Stealth CR1 domain-containing protein	NA	NA	NA	NA
WP_068281068.1\|2212749_2213589_-	glycosyltransferase	NA	NA	NA	NA
WP_068281070.1\|2213575_2214250_-	sugar transferase	NA	NA	NA	NA
WP_191980583.1\|2214269_2215202_-	NAD-dependent epimerase/dehydratase family protein	A0A2K9L4U8	Tupanvirus	1.3e-39	34.3
WP_017866964.1\|2215423_2215681_+\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	1.0e-15	47.1
WP_105782191.1\|2215665_2216550_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.2e-65	48.3
WP_082920447.1\|2217118_2217475_+	hypothetical protein	NA	NA	NA	NA
WP_105782191.1\|2217506_2218391_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.2e-65	48.3
WP_017866964.1\|2218375_2218633_-\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	1.0e-15	47.1
WP_156520041.1\|2218821_2219334_+	hypothetical protein	NA	NA	NA	NA
WP_068281075.1\|2219508_2220267_-	acyl-ACP thioesterase	NA	NA	NA	NA
WP_068281077.1\|2220290_2221157_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.7e-78	56.2
WP_068281079.1\|2221615_2221990_-	DNA replication initiation control protein YabA	NA	NA	NA	NA
WP_068223103.1\|2222469_2223258_-	stage 0 sporulation family protein	NA	NA	NA	NA
WP_068281081.1\|2223354_2224335_-	DNA polymerase III subunit delta'	E7DN81	Pneumococcus_phage	5.8e-11	28.2
WP_068223100.1\|2224336_2224669_-	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_068223097.1\|2225192_2225837_-	dTMP kinase	M1PSC7	Streptococcus_phage	3.4e-52	51.9
WP_068223095.1\|2226136_2229532_-	SNF2 helicase associated domain-containing protein	S5NA49	Choristoneura_rosaceana_nucleopolyhedrovirus	6.9e-43	27.9
WP_068223093.1\|2230160_2230439_-	YaaL family protein	NA	NA	NA	NA
WP_068281083.1\|2230441_2231038_-	recombination protein RecR	NA	NA	NA	NA
WP_178378335.1\|2231192_2231510_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_068223084.1\|2231855_2233583_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	2.2e-53	37.2
WP_057823861.1\|2234301_2235024_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_143452886.1\|2234957_2235899_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	3.0e-20	28.0
WP_068223079.1\|2235975_2236929_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_068279064.1\|2237481_2238792_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	2.7e-128	54.6
WP_068281283.1\|2238980_2239661_+	MgtC/SapB family protein	G3MA03	Bacillus_virus	7.6e-18	43.1
WP_068226185.1\|2239796_2240270_-	nucleoside deaminase	NA	NA	NA	NA
WP_068223076.1\|2240329_2241178_-	aldo/keto reductase	A0A1V0SDE7	Indivirus	3.0e-11	24.7
WP_068223074.1\|2241301_2241640_-	hypothetical protein	NA	NA	NA	NA
WP_068223071.1\|2242805_2243033_+	glutaredoxin-like protein NrdH	A0A0M7REK7	Lactobacillus_phage	5.5e-13	48.6
WP_068281085.1\|2243362_2245534_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	1.1e-259	61.5
WP_068281087.1\|2245654_2246644_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	1.0e-119	65.4
WP_068223063.1\|2246880_2247246_-	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_082920247.1\|2247452_2250053_-	bifunctional lysylphosphatidylglycerol flippase/synthetase MprF	NA	NA	NA	NA
WP_068281284.1\|2250324_2250885_-\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	8.1e-50	57.4
WP_068279064.1\|2251073_2252384_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	2.7e-128	54.6
WP_167574658.1\|2252530_2252842_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_017866964.1\|2252877_2253135_-\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	1.0e-15	47.1
WP_068223055.1\|2253588_2254275_+	hypothetical protein	NA	NA	NA	NA
WP_068223052.1\|2254618_2254987_-	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_068223048.1\|2255140_2255653_-	50S ribosomal protein L10	NA	NA	NA	NA
WP_068223045.1\|2256194_2256893_-	50S ribosomal protein L1	NA	NA	NA	NA
WP_068223043.1\|2257058_2257484_-	50S ribosomal protein L11	NA	NA	NA	NA
WP_068223040.1\|2257632_2258595_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_068223037.1\|2258735_2259287_-	transcription termination/antitermination protein NusG	NA	NA	NA	NA
WP_068223036.1\|2259523_2259706_-	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_075168922.1\|2259714_2259864_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_100077720.1\|2260085_2261039_-	UbiA family prenyltransferase	NA	NA	NA	NA
WP_068223030.1\|2261896_2263867_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_068226184.1\|2264011_2264416_+	NusG domain II-containing protein	NA	NA	NA	NA
WP_068223028.1\|2264429_2265050_+	Gx transporter family protein	NA	NA	NA	NA
WP_068223025.1\|2265036_2266017_+	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_068279055.1\|2266311_2267583_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_068223023.1\|2267748_2268321_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_068223020.1\|2268670_2269204_-	NYN domain-containing protein	NA	NA	NA	NA
WP_068223017.1\|2269200_2270001_-	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_068223014.1\|2269978_2270404_-	Mini-ribonuclease 3	NA	NA	NA	NA
WP_068281089.1\|2270403_2271813_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	9.2e-50	31.2
WP_068223005.1\|2272379_2273870_-\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP014901

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 11053

Staphylococcus_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_057775598.1\|216_495_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_005917927.1\|484_787_+	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_167574667.1\|904_2107_-	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	1.4e-27	36.8
WP_068281298.1\|2094_2682_-	hypothetical protein	NA	NA	NA	NA
WP_010891346.1\|2674_3880_-	RepB family plasmid replication initiator protein	A0A1V0E006	Clostridioides_phage	9.1e-06	27.1
WP_156520065.1\|5147_5741_-	hypothetical protein	NA	NA	NA	NA
WP_068281300.1\|5783_6029_-	hypothetical protein	NA	NA	NA	NA
WP_014940888.1\|6222_6804_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	7.2e-33	45.1
WP_068281301.1\|6928_7954_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	8.2e-40	34.8
WP_068226392.1\|8138_9041_-	zinc ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_068226390.1\|9312_9720_-	hypothetical protein	NA	NA	NA	NA
WP_068281302.1\|10246_11053_+	ParA family protein	A0A1V0DZZ0	Clostridioides_phage	1.1e-20	29.4

DBSCAN-SWA_2

15436 : 20209

Streptococcus_phage(66.67%)

integrase

attL 11836:11849|attR 17372:17385

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
11836:11849	attL	NA	NA	NA	NA
WP_068281306.1\|15436_16024_-\|integrase	site-specific integrase	D2XR58	Bacillus_phage	1.7e-21	34.3
WP_068281307.1\|16100_16379_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_056986335.1\|16378_16735_+	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_068281308.1\|16838_18089_+	MFS transporter	A0A1B0RXG2	Streptococcus_phage	6.9e-57	33.8
17372:17385	attR	NA	NA	NA	NA
WP_068281309.1\|18163_20209_-	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	4.6e-58	29.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP014900

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP014899

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP014901

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection