CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP016071	Lactiplantibacillus plantarum strain NCU116 isolate Chinese pickle chromosome, complete genome	2 crisprs	DEDDh,cas3,DinG,csa3,WYL	0	7	10	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP016071_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016071_1

57478-59930

Orphan

Consensus_repeat	Method
CTGTCNGANTCNGANTCNCTNTC	CRT

27 spacers

The CRISPR arrays of NZ_CP016071_1

>merge|NZ_CP016071|1|57478-59930|CRT
CTGTCTGAGTCGGAATCACTATCCGAGTCGGAGTCACTGTCGGAATCGGAATCACTATCTGAGTCCGAGTCACTGTCGGAATCCGAATCGCTGTCCGAATCGGAATCACTATCCGAGTCCGAATCGGAGTCACTATCGGAATCGCTGTCTGAGTCGGAATCACTATCCGAATCCGAGTCACTGTCGCTATCCGAATCACTGTCAGAGTCTGAGTCGCTGTCCGAGTCGGAATCACTGTCTGAGTCGGAATCACTATCGGAATCCGAATCGCTGTCGCTATCTGAGTCACTGTCGGAGTCTGAGTCGCTGTCCGAATCTGAATCGCTATCAGAGTCGGAATCGCTGTCGGAATCGGAGTCACTATCTGAGTCTGAGTCGCTGTCTGAGTCAGAATCGGAATCACTATCAGAGTCTGAGTCACTGTCGCTATCCGAATCACTGTCCGAATCGGAATCGCTGTCGGAATCGCTGTCGCTATCAGAGTCGGAATCACTATCAGAGTCAGAATCACTATCCGAGTCCGAATCACTGTCAGTATCTGAGTCGCTATCGGAATCGCTGTCGCTATCAGAGTCGGAATCGCTGTCGCTATCGGAATCACTATCCGAGTCCGAATCACTGTCGCTGTCCGAATCACTATCGGAATCCGAGTCACTATCCGAGTCGGAATCACTGTCTGAATCCGAATCACTATCCGAGTCGGAGTCACTGTCGGAATCAGAATCACTATCCGAGTCCGAATCGGAGTCACTATCGGAATCGGAATCGCTGTCGGAATCTGAGTCACTGTCGCTATCCGAATCACTGTCTGAGTCGGAGTCGCTGTCGCTATCCGAATCACTGTCTGAGTCGGAGTCGCTGTCCGAGTCGGAATCTGAATCACTATCCGAATCCGAATCGCTGTCGGAATCGGAATCACTGTCTGAGTCGGAATCACTATCCGAGTCGGAGTCACTGTCGGAATCGGAATCGCTATCCGAATCCGAATCACTGTCGGAATCTGAGTCGCTGTCGGAATCAGAATCACTATCCGAGTCCGAATCGCTGTCGGAGTCTGAGTCGCTGTCGCTATCCGAATCACTGTCCGAATCGGAATCACTATCAGAGTCTGAATCGCTGTCGGAATCGGAATCACTGTCTGAGTCGGAATCACTATCGGAATCCGAATCGCTGTCGCTATCCGAATCACTGTCTGAGTCAGAATCACTATCAGAGTCTGAATCGCTGTCGGAATCGGAATCACTATCGGAATCCGAATCGCTGTCGCTATCCGAATCACTGTCTGAGTCAGAATCACTATCAGAGTCTGAGTCTGAGTCACTGTCGGAATCGGAGTCGCTATCCGAGTCTGAATCACTGTCAGAGTCAGAATCACTATCAGAGTCTGAGTCGCTGTCAGAATCGGAATCGCTGTCGCTATCTGAGTCACTGTCCGAGTCTGAGTCGCTGTCGCTATCCGAATCACTGTCAGAATCGGAATCGCTGTCAGAATCGGAATCGCTATCAGAGTCGGAATCGCTGTCGGAATCGGAGTCACTATCTGAGTCTGAATCGCTGTCGGAGTCTGAGTCGGAATCACTGTCAGAATCGGAATCACTGTCGCTATCCGAATCACTGTCACTGTCCGAATCGGAATCACTGTCTGAGTCGGAATCGCTGTCGGAATCGGAGTCGCTATCAGAGTCGGAATCACTATCAGAGTCTGAGTCACTGTCGGAATCTGAATCACTATCAGAGTCAGAATCACTATCCGAATCCGAGTCACTGTCGGAGTCGGAATCACTATCCGAATCCGAGTCGCTGTCCGAGTCCGAATCACTGTCGGAGTCGGAGTCACTGTCTGAATCCGAATCACTATAGGAATCTGAGTCGGAATCGCTGTCGGAGTCACTATCCGAGTCCGAATCACTGTCGGAGTCGGAATCACTGTCGGAGTCGGAATCACTGTCCGAATCTGAGTCACTGTCGCTGTCCGAATCACTATCGGAATCTGAGTCACTATCCGAGTCGGAATCACTGTCGCTATCTGAATCACTGTCCGAGTCGGAATCACTATCGGAATCTGAGTCACTGTCAGAGTCGGAATCACTGTCGGAATCTGAGTCACTATCGCTATCCGAGTCGCTGTCGGAATCCGAATCACTATCCGAGTCGGAATCACTGTCGCTATCTGAATCGCTGTCCGAGTCCGAGTCACTGTCAGAATCGGAGTCGCTATCGGAGTCGGAATCACTGTCGGAGTCCGAGTCGCTATCGGAATCCGAATCACTGTCAGAGTCGGAATCACTGTCGGAATCTGAGTCGCTGTCACTATCAGAATCACTATCAGAATCCGAGTCACTGTCGGAATCCGAATCACTATCAGAATCCGAATCACTATCAGAATCCGAGTCGCTGTCTGAGTCAGAATCACTGTCGGAATCCGAATCACTGTCAGAGTCCGAATCACTGTC

>NZ_CP016071|1|1|57478-59930|CRT
CTGTCTGAGTCGGAATCACTATC	CGAGTCGGAGTCACTGTCGGAATCGGAATCACTATCTGAGTCCGAGTCACTGTCGGAATCCGAATCGCTGTCCGAATCGGAATCACTATCCGAGTCCGAATCGGAGTCACTATCGGAATCG
CTGTCTGAGTCGGAATCACTATC	CGAATCCGAGTCACTGTCGCTATCCGAATCACTGTCAGAGTCTGAGTCGCTGTCCGAGTCGGAATCACTGTCTGAGTCGGAATCACTATCGGAATCCGAATCGCTGTCGCTATCTGAGTCACTGTCGGAGTCTGAGTCGCTGTCCGAATCTGAATCG
CTATCAGAGTCGGAATCGCTGTC	GGAATCGGAGTCACTATCTGAGTCTGAGTCGCTGTCTGAGTCAGAATCGGAATCACTATCAGAGTCTGAGTCACTGTCGCTATCCGAATCACTGTCCGAATCGGAATCGCTGTCGGAATCGCTGTCGCTATCAGAGTCGGAATCA
CTATCAGAGTCAGAATCACTATC	CGAGTCCGAATCACTGTCAGTATCTGAGTCGCTATCGGAATCGCTGTCGCTATCAGAGTCGGAATCGCTGTCGCTATCGGAATCACTATCCGAGTCCGAATCACTGTCGCTGTCCGAATCA
CTATCGGAATCCGAGTCACTATC	CGAGTCGGAATCACTGTCTGAATCCGAATCACTATCCGAGTCGGAGTCACTGTCGGAATCAGAATCACTATCCGAGTCCGAATCGGAGTCACTATCGGAATCGGAATCG
CTGTCGGAATCTGAGTCACTGTC	GCTATCCGAATCACTGTCTGAGTCGGAGTCGCTGTCGCTATCCGAATCACTGTCTGAGTCGGAGTCGCTGTCCGAGTCGGAATCTGAATCACTATCCGAATCCGAATCG
CTGTCGGAATCGGAATCACTGTC	TGAGTCGGAATCACTATCCGAGTCGGAGTCACTGTCGGAATCGGAATCGCTATCCGAATCCGAATCACTGTCGGAATCTGAGTCG
CTGTCGGAATCAGAATCACTATC	CGAGTCCGAATCGCTGTCGGAGTCTGAGTCGCTGTCGCTATCCGAATCACTGTCCGAATCGGAATCACTATCAGAGTCTGAATCG
CTGTCGGAATCGGAATCACTGTC	TGAGTCGGAATCACTATCGGAATCCGAATCGCTGTCGCTATCCGAATCACTGTCTGAGTCAGAATCACTATCAGAGTCTGAATCG
CTGTCGGAATCGGAATCACTATC	GGAATCCGAATCGCTGTCGCTATCCGAATCACTGTCTGAGTCAGAATCACTATCAGAGTCTGAGTCTGAGTCA
CTGTCGGAATCGGAGTCGCTATC	CGAGTCTGAATCACTGTCAGAGTCAGAATCACTATCAGAGTCTGAGTCG
CTGTCAGAATCGGAATCGCTGTC	GCTATCTGAGTCACTGTCCGAGTCTGAGTCGCTGTCGCTATCCGAATCACTGTCAGAATCGGAATCG
CTGTCAGAATCGGAATCGCTATC	AGAGTCGGAATCGCTGTCGGAATCGGAGTCACTATCTGAGTCTGAATCGCTGTCGGAGTCTGAGTCGGAATCA
CTGTCAGAATCGGAATCACTGTC	GCTATCCGAATCACTGTCACTGTCCGAATCGGAATCACTGTCTGAGTCGGAATCG
CTGTCGGAATCGGAGTCGCTATC	AGAGTCGGAATCACTATCAGAGTCTGAGTCA
CTGTCGGAATCTGAATCACTATC	AGAGTCAGAATCACTATCCGAATCCGAGTCA
CTGTCGGAGTCGGAATCACTATC	CGAATCCGAGTCGCTGTCCGAGTCCGAATCA
CTGTCGGAGTCGGAGTCACTGTC	TGAATCCGAATCACTATAG
GAATCTGAGTCGGAATCGCTGTC	GGAGTCACTATCCGAGTCCGAATCA
CTGTCGGAGTCGGAATCACTGTC	GGAGTCGGAATCACTGTCCGAATCTGAGTCA
CTGTCGCTGTCCGAATCACTATC	GGAATCTGAGTCACTATCCGAGTCGGAATCA
CTGTCGCTATCTGAATCACTGTC	CGAGTCGGAATCACTATCGGAATCTGAGTCACTGTCAGAGTCGGAATCA
CTGTCGGAATCTGAGTCACTATC	GCTATCCGAGTCGCTGTCGGAATCCGAATCACTATCCGAGTCGGAATCA
CTGTCGCTATCTGAATCGCTGTC	CGAGTCCGAGTCACTGTCAGAATCGGAGTCGCTATCGGAGTCGGAATCA
CTGTCGGAGTCCGAGTCGCTATC	GGAATCCGAATCACTGTCAGAGTCGGAATCA
CTGTCGGAATCTGAGTCGCTGTC	ACTATCAGAATCACTATCAGAATCCGAGTCACTGTCGGAATCCGAATCACTATCAGAATCCGAATCA
CTATCAGAATCCGAGTCGCTGTC	TGAGTCAGAATCACTGTCGGAATCCGAATCA
CTGTCAGAGTCCGAATCACTGTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016071.1\|WP_063723084.1\|54944_56579_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016071.1\|WP_063723088.1\|45193_46864_-\|polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|240529
NZ_CP016071.1\|WP_003643192.1\|68928_70425_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340855
NZ_CP016071.1\|WP_063723085.1\|53415_54918_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340855
NZ_CP016071.1\|WP_063723173.1\|65093_66596_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341045
NZ_CP016071.1\|WP_063723087.1\|47387_49814_-\|leucine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234743
NZ_CP016071.1\|WP_169484465.1\|66732_67923_-\|methionine-adenosyltransferase	unknown	unknown	gnl\|CDD\|235374
NZ_CP016071.1\|WP_003644232.1\|43472_44309_+\|NAD(P)H-hydrate-dehydratase	unknown	unknown	gnl\|CDD\|238576
NZ_CP016071.1\|WP_003644218.1\|70825_71755_-\|homocysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|181899
NZ_CP016071.1\|WP_003643194.1\|71868_73251_+\|amino-acid-permease	unknown	unknown	gnl\|CDD\|236904
NZ_CP016071.1\|WP_003643199.1\|77643_78162_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP016071.1\|WP_013355428.1\|73582_74557_+\|ferrochelatase	unknown	unknown	gnl\|CDD\|366291
NZ_CP016071.1\|WP_064971852.1\|44445_45186_-\|16S-rRNA-pseudouridine(516)-synthase	unknown	unknown	gnl\|CDD\|211327
NZ_CP016071.1\|WP_063723086.1\|51028_51556_+\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|377744
NZ_CP016071.1\|WP_064971853.1\|51878_53405_-\|accessory-Sec-system-glycosyltransferase-Asp1	unknown	unknown	gnl\|CDD\|340855
NZ_CP016071.1\|WP_003644215.1\|74528_75854_+\|Nramp-family-divalent-metal-transporter	unknown	unknown	gnl\|CDD\|234815
NZ_CP016071.1\|WP_003643191.1\|68133_68853_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016071.1\|WP_016511911.1\|76692_77529_+\|metallophosphoesterase-family-protein	unknown	unknown	gnl\|CDD\|378975
NZ_CP016071.1\|WP_003643183.1\|51651_51849_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016071.1\|WP_003643181.1\|50276_50960_+\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239486

Protein	Function_ID	Function_description	E-value
NZ_CP016071.1\|WP_063723088.1\|45193_46864_-\|polysaccharide-biosynthesis-protein	gnl\|CDD\|240529	cd13124, MATE_SpoVB_like, Stage V sporulation protein B, also known as Stage III sporulation protein F, and related proteins. The integral membrane protein SpoVB has been implicated in the biosynthesis of the peptidoglycan component of the spore cortex in Bacillus subtilis. This model represents a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	6.46612e-131
NZ_CP016071.1\|WP_003643192.1\|68928_70425_-\|glycosyltransferase	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	2.36438e-88
NZ_CP016071.1\|WP_063723085.1\|53415_54918_-\|glycosyltransferase	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	3.42224e-70
NZ_CP016071.1\|WP_063723173.1\|65093_66596_-\|MFS-transporter	gnl\|CDD\|341045	cd17502, MFS_Azr1_MDR_like, Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including various Saccharomyces cerevisiae proteins such as azole resistance protein 1 (Azr1p), vacuolar basic amino acid transporter 1 (Vba1p), vacuolar basic amino acid transporter 5 (Vba5p), and Sge1p (also known as Nor1p, 10-N-nonyl acridine orange resistance protein, and crystal violet resistance protein). MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.26017e-72
NZ_CP016071.1\|WP_063723087.1\|47387_49814_-\|leucine--tRNA-ligase	gnl\|CDD\|234743	PRK00390, leuS, leucyl-tRNA synthetase; Validated.	0
NZ_CP016071.1\|WP_169484465.1\|66732_67923_-\|methionine-adenosyltransferase	gnl\|CDD\|235374	PRK05250, PRK05250, S-adenosylmethionine synthetase; Validated.	0
NZ_CP016071.1\|WP_003644232.1\|43472_44309_+\|NAD(P)H-hydrate-dehydratase	gnl\|CDD\|238576	cd01171, YXKO-related, B.subtilis YXKO protein of unknown function and related proteins. Based on the conservation of the ATP binding site, the substrate binding site and the Mg2+binding site and structural homology this group is a member of the ribokinase-like superfamily.	2.72812e-84
NZ_CP016071.1\|WP_003644218.1\|70825_71755_-\|homocysteine-S-methyltransferase	gnl\|CDD\|181899	PRK09485, mmuM, homocysteine methyltransferase; Provisional.	2.70803e-161
NZ_CP016071.1\|WP_003643194.1\|71868_73251_+\|amino-acid-permease	gnl\|CDD\|236904	PRK11387, PRK11387, S-methylmethionine permease.	0
NZ_CP016071.1\|WP_013355428.1\|73582_74557_+\|ferrochelatase	gnl\|CDD\|366291	pfam00762, Ferrochelatase, Ferrochelatase.	7.70113e-117
NZ_CP016071.1\|WP_064971852.1\|44445_45186_-\|16S-rRNA-pseudouridine(516)-synthase	gnl\|CDD\|211327	cd02553, PseudoU_synth_RsuA, Pseudouridine synthase, Escherichia coli RsuA like. This group is comprised of eukaryotic and bacterial proteins similar to Escherichia coli RsuA. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi). No cofactors are required. E.coli RsuA makes psi516 in 16S RNA. Psi at this position is not generally conserved in other organisms.	3.00394e-87
NZ_CP016071.1\|WP_063723086.1\|51028_51556_+\|SAM-dependent-methyltransferase	gnl\|CDD\|377744	pfam06962, rRNA_methylase, Putative rRNA methylase. This family contains a number of putative rRNA methylases. Note that many family members are hypothetical proteins.	4.87517e-67
NZ_CP016071.1\|WP_064971853.1\|51878_53405_-\|accessory-Sec-system-glycosyltransferase-Asp1	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	2.35796e-108
NZ_CP016071.1\|WP_003644215.1\|74528_75854_+\|Nramp-family-divalent-metal-transporter	gnl\|CDD\|234815	PRK00701, PRK00701, divalent metal cation transporter MntH.	2.2402e-148
NZ_CP016071.1\|WP_016511911.1\|76692_77529_+\|metallophosphoesterase-family-protein	gnl\|CDD\|378975	pfam12850, Metallophos_2, Calcineurin-like phosphoesterase superfamily domain. Members of this family are part of the Calcineurin-like phosphoesterase superfamily.	4.17797e-10
NZ_CP016071.1\|WP_003643199.1\|77643_78162_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.80056e-08
NZ_CP016071.1\|WP_003643181.1\|50276_50960_+\|phosphatase-PAP2-family-protein	gnl\|CDD\|239486	cd03392, PAP2_like_2, PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase.	1.93944e-45

>NZ_CP016071.1|WP_063723084.1|54944_56579_-|hypothetical-protein
MQKSTVTKLKQALIATGNLKDYGTSTVTLALSVSDHRHRAQVRFYRCDSFKQAWIAVAQQLAKTPQASWVRLEAVQSTQKLPRETFEKRLAATFRMNYWRYGISFDADFKTALLEMESNGQAFFRPSKAHRIGKNRSGSWVDYDRVEPYLNKREGALPVDIRKTENVWVFTTAGVFTDGQKIWNLSEQEDCGKGVRVVTDEQSELQSAIEHGETFLINQLKDNEKFVYGYFPARQRVLSNYNVVRHFSSLYALLEAIPFTKRTEDCAKVKLAIQWGLKNATIEKEGAIFVDDNGELKLGGQALLILALSKYQDVTKDDTFMPVLMKAFKGVHFFQEPSGKLIHVLNPDLTAKAAYRIIYYEGEVAFALSRLYELTHDKNVMDLVKQILDYMVANDYGKYHDHWISYAINEALLVFPDNRDYMKLGLKNVFSHLKFIEERDTTYPTLLELVDAAVKMTDMIKRSGNEDLIAPYDLVRLRQVLRYRALYEITTGCFLPEIAMYLYNPQKFIGGFYARHDNFRTRIDDCEHFLSGLINYYNYTYRQA
>NZ_CP016071.1|WP_063723085.1|53415_54918_-|glycosyltransferase
MFYFINEYILGKNSSVEHAAINRVKLFNHYKAPARIVTKMYDRLLHQTMGTFQLANQQVLNMFDYFQQTTDVPTMHTDDMHLPVEYAVEVGANFSKIFNGDEHVSNVGFIPGTIGRVFYQEFFDNQGNLSSTDLWDWRGFKSSTQYFGQNGKLVLERFYNLQGETVIEQYYVPDTNGNPLASRLILKNYRDQAERFFQDANHLFRFFLAELSHLDKQTTTFISDRPGTSVKPLLELQDDSHKYVTVPIYQAKDINDPIHSPLDGFLTPAFDNLQHFDGFITATESQAQHLRTRFPKAKVTVLPTVTTSPLAQSKLQPITARPKQLLYVGRLAPDRQLDQLIRTIALVKQQVKEIQCDFYGYGDPEYLKTLNKLVEELKLTNNVHLLDYHPDLETRYDDYQLLLNTDIVDGGPMSMPEAMSHGIPVISYRFNYGPKDWIDDGHDGFIVDPGNQLALRDRVIELMTDTKKLTAFSEAAFKKLHTSQTDLKVWHRWQQLLGIK
>NZ_CP016071.1|WP_064971853.1|51878_53405_-|accessory-Sec-system-glycosyltransferase-Asp1
MYYFLNDNMQFSKSGIEQAEINRLTLFKKHHVAAKIVTRVFAMNLHDVLEGANIADADFVNLFDFFCGSQSVKRQRFDLADFEVPADAIKTRKDNQIQVMERGKLIMIIYLRAGTEAVSNVQYFDVNGRTLKMSWWDTRGFKCLEQLFDWDGKIAQEAYFGPDGLIHVEKLHLLNHAGQERITWRVLNYNEQSHTFNGMNELTRYFYDELNQLNDEQNVFICDRTVECAWGLFNMTTPAKKVLHLHNNHVSDAKDIMHSTLNNNYANALNNWAAWDAVISATPEQTKDVEARFGKDIPAFTIPVGYVDNATLKAAPVKFDQRQKDLVVQVARLAPEKQQNHSIEAFVEVHKQFPDAKLELWGYANGDIEKQLHAQVAAAHLEDVVLFKGYTTDVNAVYNRAQLGLLPSRAEGFSLMLLEAQAHGLPMVANDVKYGPSDIIQDHKSGILTTDGDVQQLTKTILELLKNQGQLAQYSAQAYENAKRYSEEAIFKQWQALLDYFKPAKVTA
>NZ_CP016071.1|WP_003643183.1|51651_51849_-|hypothetical-protein
MLMIMTIYGTVKMFTRMIVYCGIGGLVLIVRHHNRKKRRNEMDEGTKRIMRNTPKDENGKYPWEK
>NZ_CP016071.1|WP_063723086.1|51028_51556_+|SAM-dependent-methyltransferase
MNQVVNPGDHVIDATVGNGHDTVYLANLVGTTGHVDGFDIQSAAIEATTTALDKAALTHQVTLWQTGHEHIADKIAADQPIKCAVFNLGYLPGGDKQIITKPTTTLTAIKAIQEHLVTNGLIILLVYAGHPGGATEAQAVLDYVTNLDQHQFQVLQYQFINQVHVPPYLLAIQKR
>NZ_CP016071.1|WP_003643181.1|50276_50960_+|phosphatase-PAP2-family-protein
MAIIYLSEESVLKQRSWQRSDSLILLIFIGWLGWTAAVWQRAPWLTHFDTTVANFWHHSPQWFQHAMVTYTQLGNPHTITIITLIIGLALWLGHNPRGAVFFWVTTWLIAGYGNYLIKQVIMRPRPTAWRLVQIGGYSYPSGHSTTTTVLIGSLLVLAFDYWHRNALTGWLTALGITAILLMMISRVIVGVHYPSDTIGGLLLGSVLLYISARFSMRYRHGPLRLRP
>NZ_CP016071.1|WP_063723087.1|47387_49814_-|leucine--tRNA-ligase
MAYNHKVIERKWQHYWKENKTFKTLDTTDKKKYYALDMFPYPSGQGLHVGHPEGYTATDIMSRFKRMQGYNVLHPMGWDAFGLPAEQYALKTGHNPKDFTAKNIKNFKRQIRSLGFSYDWDREVNTTDPSYYKWTQWIFEQLYKKGLAYESETLVNWAPDMMGGTVVSNEEVVDGKTERGGYDVYRVPMKQWSLKITAYADRLIDDLDDIDWPENIKEQQRNWIGRSVGASIRFKVASQPDDTEIEVFSTRPDTLFGASYMVLAPEHDLVEQLTTPEQADAIKAYKAKIASKSDLERTDLNKDKTGVFTGSYGINPVNGEKLPIWIADYVLASYGTGAIMAVPAHDDRDFEFAQKFDLPIKPVIAGDNDYDQQAYTGDGEHINSGFVDGLAKQPAIDKMIDWLGEHHAGEKKVNYRLRDWIFSRQRYWGEPIPVIHWEDGETTLVPEDELPLRLPATKNLEPSGTGESPLANIDDWVNVVDENGRKGKRETNTMPQWAGSSWYFLRYVDPHNREALADYDKLKYWSPVDLYVGGAEHAVLHLLYARFWHKFLYDLGVVPTKEPFQKLVNQGMILGDNHEKMSKSRGNVVNPDDIVDQYGADTLRLYEMFMGPLEASIPWSTDGLHGANKWIERVWRLMIDENNRVRDRITTINDGKLTKIYNETVKKVTEDYEAMRFNIAISQMMVFVNEAYKVDDLPIIYIEGFVKLLSPIAPHLSEELWSLLGHDDTITYATWPTYDESKLVEDTVQIVLQVNGKVRSHAEVAKDMGKDELEKLALADEKIQEFTAGKTVRKVIAIPGKLVNVVAN
>NZ_CP016071.1|WP_063723088.1|45193_46864_-|polysaccharide-biosynthesis-protein
MSEESKANQPQNAHVNSEAEAHQKMVRGSAWMTAGSLFSRVLGAIYIIPWVIWMGADYTQGNALYAKGYNIYSFFLLIAIGGIPSAISKQLSEYNAMNEYAVGQRLFKRGLLLTSAFGIIGAIILWFGAGLISTAFGGYDANLIPVLHALAIALVILPSMSLTRGFFQGYQQMAPSAISQFVEQVFRVIYMLGATYFIMRVAHGDWVNAVTQSTFAAFVGAAASFLLLGWYYFRKRPELNALAAQSENKLVIPVWQLFRDIIIQAIPFIVIDTATTVFNLLDQATFQPMMRLVYHLGTKQIDTLYAYFAFNANKLVMIIVSLASAIAVTVVPILSESLASHNMRNIRKQLEDSIILFLFIMIPGALGMAAVAQPLNTLFYSYDQIGTLILQISAFTAIALGFFTVISALMQGLSRNRDIIRYYLIGLLVKIVIQLPCIYFLSTAGPLVATAIGMMVASLMAMYDLEVNFGIRYVKLLPKINRILVYSILTYVTARLVVYGLNFVLNEHSKTQSFLIVALAVIAGGAVYVYLAFRSRMADLMIGTKAAGLRRKLRIK
>NZ_CP016071.1|WP_064971852.1|44445_45186_-|16S-rRNA-pseudouridine(516)-synthase
MRVDKFLHAMRIGTRTQVRRLIKDGHITANGEPVISGKQQINPGSDTVFLGDVQVRYQQYFYYVMNKPVGVITATTDSAAKTVMDLFNTTDFRDDLFPVGRLDKDTEGILVITNDGALSHDLLSPNHHVTKVYEAEVTGEITAAQLANFNDGITLKDGTELQPAQAEIVQFHEIENFTTIRIMIHEGKYHQVKRMVGTLGERVVGLRRIKFGSLTLPVGLLAGNYRALTDDELTALKADANQPVGE
>NZ_CP016071.1|WP_003644232.1|43472_44309_+|NAD(P)H-hydrate-dehydratase
MQPITTEIVSRTIIKRPADSHKGNYGRIMLIGGNQNFGGAIIMAATAATYSGAGLVTVATDPSNFTSLHARLPEAMVIDYHQTDTLLNLLAGMDVIVIGPGLGTDTVADQLLTAVLAATHVPQRLVIDGSALTLLAQQARPLPATDIVVTPHQMEWQRLSGIAIKDQTPTANHDAQQRLGVTAVVKAHRTTVYTDERVWFNPGGTPAMATGGMGDTLAGMIGGFVSQFHNFTDAVLSAVYLHSAIADDLAATRYVVLPHQISARIPTYMHRFSQIERP
>NZ_CP016071.1|WP_063723173.1|65093_66596_-|MFS-transporter
MQQRKTNVMAVTVAIYVATFMSAIEGTIVSTALPTIVGDLHGVSLMNWVFSIYLLTNAMMTPIYGKLTDLVGRKPVMQAGLIIFIIGSMMSGLSNSMPVLIFWRAIQGIGAGALMPVSMTIIADIYSFERRAKVLGFNSSAWGIASVLAPLIGGLIVDKLSWHWIFFINVPVGLITLFLFQFYLREPKRHNNVKIDYLGSFWLMLFLLCLMLSFQLLGNATISWVAVGTAWIISALSLWLFIRRESRTDEPVISMDLFKNHTFIIQNAVAALVSGFLMAVEVYIPTWTQGILGVPASLAGFAVTPSSLMWIVGSFVTGRLLAKWAPRRILYLSLAFILVTSICLAWLPVNTAFPWFFLITAIGGVGFGITITATTVTSQHLVPAENVGVATSFNTLSRTIGQTLMISIFGIALNVGMNQGIQHHAGTNMAMMNKLINPQTATQLPSHLLPTLHRILYTGLHWVYLIGLVLVILAFIVNSLDRGPQKTAAQHAADLNQNQD
>NZ_CP016071.1|WP_169484465.1|66732_67923_-|methionine-adenosyltransferase
MVSERHLFTSESVSEGHPDKIADQISDAILDAMLAQDPQARVAVETSVTTGLVLVFGEVSTKAYVDIQKVVRDTIKSIGYVDGQYGFDGDNCAVLVSLDEQSPDIAQGVDDSLETRSGDADPLDQIGAGDQGMMFGYAINETPELMPLPIALSHRLMRKIAALRKDGTIKWLRPDAKAQVTVEYDEDNQPKRIDTVVLSTQHDPDVDLDTIRQTVIDQVIKAVLPADLLDDQTKYLVNPTGRFVIGGPQGDAGLTGRKVIVDTYGGFAHHGGGAFSGKDATKVDRSASYAARYIAKNVVAAGLADQVEVQLAYAIGVAEPVSIAVDTAGTGKVSDEALINAIRENFDLRPAGIIKMLDLQRPIYRQTAAYGHFGRTDIDLPWEHTDKVDALKAAFK
>NZ_CP016071.1|WP_003643191.1|68133_68853_+|hypothetical-protein
MIRIGKLHIKRDYIALAIFTIVQSIISWWAALDYGRSFQTASFSAAQLPLIGYTLAVAAAVFIILDRRIAPQWSLIAIGITVAFAFTNIIAKESELLYLLLTCSAWLLVMAVPRFGMQNYFGLVVFGVIMTFTIPVAVFDLQNNYLSTTFLWKLTPMLASYVFLYVPSFSRQRQINQLISAITGLLLVITIFLQPLTWQTIVAILITIAVWFSQQSFGRTRLHLMINVAVQLALILLLY
>NZ_CP016071.1|WP_003643192.1|68928_70425_-|glycosyltransferase
MYYFVGTGLGLKLTGIEKAQLNRLALFDAAGYQARCVYVTYNPRLHEHAARFGAEGKCFSLYDFFQGTMPEAVTKIHHDWMHYWQAVCHFKVIQVPNTTDFRVLDTDGQYLMYVHFVDAGRQQLDYVNYFDNQGVKVRREFYDNRGFLSRTSFLVKHQEVHTEVYYDLQGQVKIIKQYDITGPEPKLRLITLKNYQQRDFFFNTEQAFQTFFFNELATADDVYFCDRNRQTAAALGHTRPATRVCSVLHSTHLRIGEDVVSGHLKSVYRYVLAHPDQFHRIIVSTEHQKRDLLARYDNLPPVVVIPVGYTTVHPVKIDGRDPHRIISVARYSPEKQLPHQLEVVRRLVGEFPDLTLQLFGHGQKIEMQMRQFIQANHLEKNIVIRGFLPNLAEEYQRASLALMTSVEEGFSLATMEAESYGVPVIGYRIAYGPEDIIEDGVNGYLVTPNDVDELTMKVRQYLQHPERQAQLITNAYNSATRYSKQTIIEKWRQLIAAL
>NZ_CP016071.1|WP_003644218.1|70825_71755_-|homocysteine-S-methyltransferase
MLSLTEQLNRGPVVSDGAMATELEKRGVATNSALWSATAMLDHPDAIQAVHQSYLDAGAKIMTTNTYQANVPAFEQAGIAAAQARQLIQQAVTIAHTARDASHVTDAVIAGSIGPYGAYLADGSEYTGAYQLTPSAYQDFHRERLALIMAAGVDVLALETMPRLDEVQALVQLITTTWPQQPYWVSFSIKDPQTLCDGTSLAAAAKWVAAQPNVVAVGVNCTTLENIAPALTTLKAAVAVPLIVYPNSGDQYDPVTKTWQETHLSHQFASFVPQWLAAGARIIGGCCRTTPKDIATVARALSVSDSAKL
>NZ_CP016071.1|WP_003643194.1|71868_73251_+|amino-acid-permease
MSKQTHLSRQMESRHVLMISLGGVIGTGLFLSSGYTIHQAGPIGTLLAYTIGAILVYLVMLCLGELSVAMPYTGAFHVYAKKYIGPGTGFTVAILYWLTWTIALGSEFTAAGLIMQTWFPHIATWIWSLVFMVVIFTVNALSVRWFAEAEFWFASIKVIAIIAFIVLGGLAMVGILPLHGHTSAPFLSNYTRNGWFPNGFGGVFTTMLTVNFAFSGTELIGITAGETKDPAHTIPTAIKTTLWRLIIFFIGSMSVMAALIPYKQAGVTQSPFVLVFKAIGIPYAADLMNFVVLTAIMSAANSGLYASTRMLWSLANEGTIPKVFKRTTKRDVPLVALITSMLGGILALLSSVYAAGSVYLVLVSISGLAVVIVWMAIALSEINFRKTYLKSGQSLDQLTFKTPGYPVVPWLAFILSGLSCILIWFDPNQRIALYYTIPFVAICYLGYYLNQRYRRTHAAK
>NZ_CP016071.1|WP_013355428.1|73582_74557_+|ferrochelatase
MHPGLLLVNLGSPASPRTKDVKAYLQEFLSDPSVIEMPAALWQPLLRGIILPTRSWRSATFYQDSWLPQGSPLIVYSQAICQQVQAALPDWDVRLAMTYGQPDIGATLKAMVADGCEKPIILPLFPQYTQSTHGGIHRQVEATGLPHTFIDSFYDQPTYIHLLATKVWQSYQAHHYDAVIFSYHSIPTAMVRHGDPYQRECEATTKAVLTERPELPADKVITAYQSKFGPMPWLKPYLKNELMQLVELGKRNVLVVTPSFVVDCLETLEEDYVQNYQTFRASGGDRFDLVPPMNKDTGFSQFLADLAIQKQEASNHAIASSSKS
>NZ_CP016071.1|WP_003644215.1|74528_75854_+|Nramp-family-divalent-metal-transporter
MQSHRHQSLEEINQSVAVPDVHQTAFWRKFLAYSGPGALVAVGYMDPGNWLTSLAGGGQFQYRLLAVLALAIIVAMFMQGLAIRLGVVARQDLAQAIASKLPRPVRYAAWILNEVAMMATDMTGVIGTAIALKMLFGLPLLAGILLTIADVLVVLLFLRFGIRRVEVIVLVAILTVGIIFGIEVGRAHVQFGNVLLGLVPTPLIVKNHTALVLSLGILGATIMPHNLYLHSSLAQSRRYDYHNPAQVTEALRFANWDSTVHLIAAFLINALLLVLGGTLFFGHTNALASLQAVFDGLKSTTVVGALASQVMSWLFALALLITGLISSITSTLAGQIVMEGYLHIRLPLWQRRLLTRAVTLIPILIIGMLVGFSDAAFENLIIYAQVALSIALPFTLLPLVALTNDASLMKTHVNRPTVTWLGYGLAGIITVLNIYLVYSLF
>NZ_CP016071.1|WP_016511911.1|76692_77529_+|metallophosphoesterase-family-protein
MVKIAVLSDVHGNATALEAVLADAQKQHVDEYWTVGDMTVRGPESERCLTLLDRVHPTAYVLGNHEENYQKVMAANPNTFTKPKQIMATVLTAFDRRQLSSTHFERLLNLPMTVIKHVGPLTIRLQHVLPTVASGHALAPTASQANFDQAAEGDVDIVIYAHTHQPIMRYATTGQLILNAGTVGLPTAINPHLRQPRANYLLLTIDETGLQHIDYRAVDFDWQRAITIAQNTHLPYFEFYEQTLRTNTYQYAPSAVAAYNTQHDMAREARKILLENRH
>NZ_CP016071.1|WP_003643199.1|77643_78162_+|GNAT-family-N-acetyltransferase
MYFKKATLDDLDTIIDILSDGRNQLAEAGVNQWQGDYPSRKQITADIMQGSAYLFNADDNATVGAVAVVPSPDETYDTAKAEWLNTTAPYVVIHRVAIHSSHAGHGYATQLFEKIIAHIAADHPEIKSIRIDTHADNQAMQHLIAKMNFKRVGEMVGVYHVDDVCYVYEKML

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP016071_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016071_2

2614075-2614376

Orphan

Consensus_repeat	Method
GCTACTGCTAAGGCTCAAAGTACAGCTGACAATGCGTTTAGCCAAGC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP016071_2

>merge|NZ_CP016071|2|2614075-2614376|CRISPRCasFinder
AAGATTATCAATGCTCAAAATACGGCTGATAATGCGGCTAGCCAAGCAGGAAATGCTGATAGCGCTGCTTTAATTGCACAGTCTACAGCGAATGCCGCTAAATCAGCCGCAGATAGCAATTACAACTACGCCAATTCAGAAATAGCCGTCCAGTCTAATGCTACTGCTAAGGCTCAAAGTACAGCTGACAATGCGTTTAGCCAAGCTCAGGCAGTTGGTAGCCAAGCTAGTGCTGGGATAAGCAACAACTCTACAGCTACTGCTAAGGCTCAAAGTACAGCTGATAATGCGTTTAGCCAAGC

>NZ_CP016071|2|1|2614075-2614376|CRISPRCasFinder
AAGATTATCAATGCTCAAAATACGGCTGATAATGCGGCTAGCCAAGC	AGGAAATGCTGATAGCGCTGCTTTAATTGCACAGTCTACAGCGAATGCCGCTAAATCAGCCGCAGATAGCAATTACAACTACGCCAATTCAGAAATAGCCGTCCAGTCTAAT
GCTACTGCTAAGGCTCAAAGTACAGCTGACAATGCGTTTAGCCAAGC	TCAGGCAGTTGGTAGCCAAGCTAGTGCTGGGATAAGCAACAACTCTACA
GCTACTGCTAAGGCTCAAAGTACAGCTGATAATGCGTTTAGCCAAGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016071.1\|WP_063722569.1\|2603170_2603809_+\|phage-tail-protein	unknown	unknown	gnl\|CDD\|309671
NZ_CP016071.1\|WP_064972054.1\|2604594_2609736_+\|phage-tail-protein	unknown	unknown	gnl\|CDD\|381605
NZ_CP016071.1\|WP_064972058.1\|2618555_2619440_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016071.1\|WP_003645638.1\|2626123_2626915_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224041
NZ_CP016071.1\|WP_003644510.1\|2620627_2620891_+\|hemolysin-XhlA-family-protein	unknown	unknown	gnl\|CDD\|371241
NZ_CP016071.1\|WP_063722567.1\|2602349_2602790_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016071.1\|WP_003641410.1\|2618410_2618572_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016071.1\|WP_063722568.1\|2602786_2603170_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016071.1\|WP_016058334.1\|2604010_2604394_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016071.1\|WP_016058329.1\|2601675_2602014_+\|phage-gp6-like-head-tail-connector-protein	unknown	unknown	gnl\|CDD\|153446
NZ_CP016071.1\|WP_003644507.1\|2624362_2626105_+\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|227319
NZ_CP016071.1\|WP_064972055.1\|2609807_2611577_+\|phage-tail-family-protein	unknown	unknown	gnl\|CDD\|368574
NZ_CP016071.1\|WP_016058330.1\|2601997_2602360_+\|phage-head-closure-protein	unknown	unknown	gnl\|CDD\|273692
NZ_CP016071.1\|WP_064972060.1\|2620902_2621439_+\|holin	unknown	unknown	gnl\|CDD\|227833
NZ_CP016071.1\|WP_044430958.1\|2618155_2618407_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016071.1\|WP_016058335.1\|2604390_2604582_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016071.1\|WP_064972056.1\|2611640_2614010_+\|phage-tail-protein	unknown	unknown	gnl\|CDD\|273743
NZ_CP016071.1\|WP_064972059.1\|2619455_2620628_+\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|119377
NZ_CP016071.1\|WP_064972061.1\|2622672_2623884_+\|FtsW/RodA/SpoVE-family-cell-cycle-protein	unknown	unknown	gnl\|CDD\|223843
NZ_CP016071.1\|WP_053339307.1\|2615416_2616592_+\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151

Protein	Function_ID	Function_description	E-value
NZ_CP016071.1\|WP_063722569.1\|2603170_2603809_+\|phage-tail-protein	gnl\|CDD\|309671	pfam04630, Phage_TTP_1, Phage tail tube protein. This is a family of phage tail tube proteins from Myoviridae.	2.75406e-69
NZ_CP016071.1\|WP_064972054.1\|2604594_2609736_+\|phage-tail-protein	gnl\|CDD\|381605	cd13402, LT_TF-like, lytic transglycosylase-like domain of tail fiber-like proteins and similar domains. These tail fiber-like proteins are multi-domain proteins that include a lytic transglycosylase (LT) domain. Members of the LT family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, and the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL). LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.	3.77762e-46
NZ_CP016071.1\|WP_003645638.1\|2626123_2626915_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224041	COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism].	1.25723e-96
NZ_CP016071.1\|WP_064972061.1\|2622672_2623884_+\|FtsW/RodA/SpoVE-family-cell-cycle-protein	gnl\|CDD\|223843	COG0772, FtsW, Bacterial cell division membrane protein [Cell division and chromosome partitioning].	3.50029e-73
NZ_CP016071.1\|WP_003644510.1\|2620627_2620891_+\|hemolysin-XhlA-family-protein	gnl\|CDD\|371241	pfam10779, XhlA, Haemolysin XhlA. XhlA is a cell-surface associated haemolysin that lyses the two most prevalent types of insect immune cells (granulocytes and plasmatocytes) as well as rabbit and horse erythrocytes. This family has had DUF1267, pfam06895, merged into it.	4.53032e-09
NZ_CP016071.1\|WP_016058329.1\|2601675_2602014_+\|phage-gp6-like-head-tail-connector-protein	gnl\|CDD\|153446	cd08054, gp6, Head-Tail Connector Protein gp6 of Bacteriophage HK97 and similar proteins. The bacteriophage HK97 gp6 protein is critical in the assembly of the connector, a specialized structure that serves as an interface for head and tail attachment, as well as a point at which DNA exits the head during infection by the bacteriophage. It forms a dodecameric ring structure that comprises the middle ring of the connector, located between the portal protein (attached to the head) and the gp7 ring (attached to the tail). It is a component of the mature phage and the absence of HK97 gp6 results in defective head-tail joining and the absence of mature phage particles. Although the crystal structure of HK97 gp6 shows an unexpected 13-mer ring, the biological form present in the mature phage is believed to be a dodecamer.	1.24587e-20
NZ_CP016071.1\|WP_003644507.1\|2624362_2626105_+\|ABC-transporter-permease-subunit	gnl\|CDD\|227319	COG4986, COG4986, ABC-type anion transport system, duplicated permease component [Inorganic ion transport and metabolism].	2.36203e-89
NZ_CP016071.1\|WP_064972055.1\|2609807_2611577_+\|phage-tail-family-protein	gnl\|CDD\|368574	pfam05709, Sipho_tail, Phage tail protein. This family consists of several Siphovirus and other phage tail component proteins as well as some bacterial proteins of unknown function.	8.17337e-08
NZ_CP016071.1\|WP_016058330.1\|2601997_2602360_+\|phage-head-closure-protein	gnl\|CDD\|273692	TIGR01563, hypothetical_protein_AGR_C_1752, phage head-tail adaptor, putative, SPP1 family. This family describes a small protein of about 100 amino acids found in bacteriophage and in bacterial prophage regions. Examples include gp9 of phage HK022 and gp16 of phage SPP1. This minor structural protein is suggested to be a head-tail adaptor protein (although the source of this annotation was not traced during construction of this model). [Mobile and extrachromosomal element functions, Prophage functions].	8.05503e-09
NZ_CP016071.1\|WP_064972060.1\|2620902_2621439_+\|holin	gnl\|CDD\|227833	COG5546, COG5546, Small integral membrane protein [Function unknown].	0.000923758
NZ_CP016071.1\|WP_064972056.1\|2611640_2614010_+\|phage-tail-protein	gnl\|CDD\|273743	TIGR01665, structural_protein, phage minor structural protein, N-terminal region. This model represents the conserved N-terminal region, typically from about residue 25 to about residue 350, of a family of uncharacterized phage proteins 500 to 1700 residues in length. [Mobile and extrachromosomal element functions, Prophage functions].	4.79447e-13
NZ_CP016071.1\|WP_064972059.1\|2619455_2620628_+\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|119377	cd06415, GH25_Cpl1-like, Cpl-1 lysin (also known as Cpl-9 lysozyme / muramidase) is a bacterial cell wall endolysin encoded by the pneumococcal bacteriophage Cp-1, which cleaves the glycosidic N-acetylmuramoyl-(beta1,4)-N-acetylglucosamine bonds of the pneumococcal glycan chain, thus acting as an enzymatic antimicrobial agent (an enzybiotic) against streptococcal infections. Cpl-1 belongs to the CP family of lysozymes (CPL lysozymes) which includes the Cpl-7 lysin. Cpl-1 has a glycosyl hydrolase family 25 (GH25) catalytic domain with an irregular (beta/alpha)5-beta3 barrel and a C-terminal cell wall-anchoring module formed by six similar choline-binding repeats (ChBr's). The ChBr's facilitate the anchoring of Cpl-1 to the choline-containing teichoic acid of the pneumococcal cell wall. Other members of this domain family have an N-terminal CHAP (cysteine, histidine-dependent amidohydrolases/peptidases) domain similar to that of the firmicute CHAP lysins and associated with endopeptidase activity. The Cpl-7 lysin is also included here as is LysB of Lactococcus phage, and the Mur lysin of Lactobacillus phage.	1.04388e-62
NZ_CP016071.1\|WP_053339307.1\|2615416_2616592_+\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	1.00481e-108

>NZ_CP016071.1|WP_064972056.1|2611640_2614010_+|phage-tail-protein
MALNNQYLILDSNLKRIGTLTVDGATKFSNDSVKIQLADADTTSTSYDDDVNIGTQDNFNGTINLNAQSKKFDHQGSLDVLQGQPDSDKVVAGNNLAYYDALSGHWYVMRIYSVEESNTAATKHVTTANFTNLCLYTLAHHYPVAITASDSSIQTAFNQCFNATGWTLDYQTTNVMTPTITIDGKTKASTLVQTLIQAYNVEIDPYVEIDSQGNITKKVCVITDKLNTDVVYNEAVFGKNMTSIKRTTVSTPVTKLIAYGDNGNTMSEVNDGKPYIVDDAANQKYNPDWQSGLYYEAVITANSIEDPSGIKAWAEEMLQLYNHPRTYYEVSVTSKFNPPLGATIRFKDELIKPALNASGRVIQRTISFSNPYGNTVGFGEYVTVPVATPAWMQGYQSAINSAIEKAREDASSVKPVALTPDGNNFTDTAQTKRLILQAWEGNTNISAYIDNKGFIWHRYNTDGTLDTSFNQTGYLVQAAYNSVGTLHGTIETRYIQDEPEIKLQTSAIRSLGSFSPDDSTLGITDAAQYMCLLSNGQYITSRAINQSTTSDVMFVLHDTNFKPISKMIVSHGGHGSSFSIEEVDGAIYIWSATKPNLDVNEYAVSRIPYLANVTLGNDDDRIMRFCTVDRYIRVSVDFKHGYVLCGYVNGKHDVLRLDEVKQGNYDVLYSFDVANYGFDESKQTYQSQGIDFPYVYFHSGDYNMKDPRMVYAVNVVHGGQEFASNYLLDMNLGLTDDVIEPETCNIIYSQTNQPELLVTFNCKYQGDSLERVFVIPIKERLPMNTISND
>NZ_CP016071.1|WP_064972055.1|2609807_2611577_+|phage-tail-family-protein
MSVLNKNDFEYAGLNSRDDLQAIMGAVTLPSAPAMAEQATDIPGMYGNQFNGMDYTSRTISIPITIIARGSQDKYKQIMHNLSGLLLSDDPSDNGKEYPLVFGFEPKVTYWGHITAISDPQFINQGAWDATLTITFVQSDPRATLPQVETPLKNGLNTITVDGTARTEPVIQVIPKRDLKYIGFSLNGGQFGLGPESPGDQATAVQPYTKVVDDPLGTMAMWTNDANAISNMKTGETYTYQGHSEIKTATNVMRPAVTSAGYDFGTIPTTGEDRWYGPAYRYTGMTNSLTDWRVRTGIHQFKYSGTHNGRAMGRVEVLLLDPSGNTIGRFGMRDMAYGAKPMARLQICEPGSTLEYGDRYTDLYYGSGPAGSFTNKPDQKIKIKTGTTTKTVTKYGRSRGKVTKKTIKETVDTYTTVVNKEEDSALAGAWLVLDITKRGQVFTWSITQYSTKTGRPFLDPNIHMLVHGTYVDTQNKYQTALGGIGSVFLKHPITEDKYKIAYRNPFMSMTDLQIWQVNKVDTTKPTYIANAGEEIVMDCESDTVTVNGKLVSPVWSTDFPKLKPGVNGLSMIGDLDDAQMALKYLPRIL
>NZ_CP016071.1|WP_064972054.1|2604594_2609736_+|phage-tail-protein
MATEKIQGYEFAINMDDGGMTRTLREIKNEAKLLKSGMQANFAEIRSGEGIMAAYAGKVKDAGRAIEAQRLVIERLKSEQNGLDQTTQKGREAYVKYENQINAAKRSIASLEGQQERAQKSLDLQKSGVLQLKEATEISAKVTDSYVAKLKAEGHEFEANKVKASGLHQSYNELNKQLEAEQSRLNKIASASGNSSKEFKEQQIRVNELGTKIAQTRVKMKELDEQLSKKPQSGLTSVISQLNRVNEHADKANHLFGKILGAHLVASGITSAFQSITSHIHEAISAGMEYEKEQQKMTATWLTLTGAVGKSNAMVKTINDLSVKTGQAVDVVNELEQGFYHLHSNKKESDELTKSMLNMSDAVGLDKQQIQAVTQDMVNGLSRGKANAGMLNQISQYFPMFREQLAKYESGLKKTGDTAASTGKGAAKAVSAYNKKMTLMFEGMHYGTNNSLSDLETYRQKGIVSAQQFTVFSKQIASGHKVTNAEIKQAIKVNSQYAAQQETNAQKTHKSSKVTVADLSEMAKEGKISAKDIENTFNQLGSGKYDKAADNMLHTMVGMERTIKARVPALIGDIEKPILTAQNPIYGAVSKWVSDKRTDKEFNKVGVAAEKGISTITKAFAKAFDVKSAPKAMNDAMDNLAKGVTKASDSIAKNAPEIVNFFKTVKNLGGLGFETLIESLKITNAILKPLLSMVGGHTETIAKFGAAWWLTSKAVKETSSVLSTFKKISDTVSWAEKVLGIKQETKALEEQNAVLKTNAELSTASEENIGTGYRRVKGRKAGNTGADLSSISVEAENTEKIAKSSKWSLLGGTIGTRIINGAGLAMTAWDAGSSIAKAVSSGKASDKYKATGKTAGTLIGGGIGAALGSVIPGAGTAAGAMLGASIGDGVGGTKTANTIVKRISDALKGKSIEAPKIKTESTKRSLSDLGKAYSSYYSKKQKQDLNDVNVLHKAGMLTDAEYKKQLASIKKNDSETNRFEKMSASDRNAIAKYYAQQKASIISKWNARERKTSSSWDAKIASDERQFGANSIIVQKDMSKKKAAIQAEENKKSAALDKLRIKSATETTAQEAHLHTTLTGKIKSAANKQNDILRNLAKSKGKITREQANDAISQSNKEYKKTVSLANQEYKDRVSAAEKQHNKVIKAAERQASEAISQAKSQYSKTVDAAKNQYSGNSKYAEKQRAAIISKAKDQKQKSIDNALEQENKTEQHADRQYKHTTDDADKQRSQVVKHAKDQNSSVVDQAKSQSKGVLGHAVKQANGSMKAADKQGSGIHSIWKNITSFFSNLVKGFGIKPINVGAYPSGYTPVTMGAYASGGIVDTARALVGEGGVEAKIDRDNGKVSFLGMNGAEVVNVKPGDQILNAGDTAKLFNGGLGHTLPGYAKGTVDIASFLKKIKSGATSIFDSVSDKAMDALSKITHPLKTLKSMALKTFDPTKTPGVGSIGHDLGKGLVDRALKGFAKAISDLADNFGGAGGSVGNPAGSSVSRWKPYVVRALKANGFGATASQVSAWMRVIARESNGNPRAINLWDSNAKKGIPSMGLVQTIRPTFEAYKFSGHGQIYNGYDDLLAGINYMKHIYGKGDSAFARVSGPEGYANGGFGNKAGVYKLFEGNLPEAIVPMDLSKRSRAYQIMQQIMAKFGAQDGANVINTGNDQIDSDEAFKQRVIASLDALVTGQGDVKAVVANSDVVNAVKSNTKKTSQYSQMMGY
>NZ_CP016071.1|WP_016058335.1|2604390_2604582_+|hypothetical-protein
MIWQLDNFIQDIDYIANQLISQGILPSDFYQSSFSEMQTALNAKSRKDRVQDPLELARQIGAL
>NZ_CP016071.1|WP_016058334.1|2604010_2604394_+|hypothetical-protein
MAKSVKFDGKKIGTGTQYTLIDSGQNVEKMAEAYKKFIKTTEETEDSITGVVELTPKLAKVVAETTCDLLELNASQKKRVMSMEFSVSDEYDFFNDCLKQFLGVELPSVGNSSDQEEEEDPKLPKPE
>NZ_CP016071.1|WP_063722569.1|2603170_2603809_+|phage-tail-protein
MATLGLNMLYTGIKADDGSTIIDADKGLSAAGVYPIDTSKANGNLGTKTANITGLSGTVSKITGNNEVVDVSNPPSAPSVAIDSNEINFIVKQKLLGRVSDGKGGYSDTDKPVEAGLIIESRSPIFRTAIYYCFGRGIFNEAGQNIQTNTDTAETRDDDNLTFTALNYDGFGGQPYKVYAESDPKFDKQAMFDAVFPGQTFYKNASNGTSGQ
>NZ_CP016071.1|WP_063722568.1|2602786_2603170_+|hypothetical-protein
MTPVAFIKSIIVTNINEIPELAVEHIHSFFIPINDTSTDEPIAVISGLPERSQDYGNGIPFQSTKQVQIQLYYPKDYLGDMDAIESGLKQVLLTNDIRCYSDAGQTLTPDSESITNTLKFNYIKEAI
>NZ_CP016071.1|WP_063722567.1|2602349_2602790_+|hypothetical-protein
MANEIKHADSFEHILDTMAEGFGREEKLKANAAGADQFIKIMKPKIPVGKLRKVHGHAEKAHLRDSLIAVDHPNGSVNVGFTAKGEKGYIARFQNDGWDVVDRNGSKHSHVSGKHFWETTQREAKGQVGKAVVEQLKTAMDKKVGK
>NZ_CP016071.1|WP_016058330.1|2601997_2602360_+|phage-head-closure-protein
MTKAINPTRMNFRLEFGTQAATGKVNPNTGNPITDFVPQFSLYAGEWSLSFQQRLALNGDTSQQNAVYFVRHNLKITTGMQLRRNHQDVYQIDDVAYDDGLPPDGFDLITCHKVVIGRGE
>NZ_CP016071.1|WP_016058329.1|2601675_2602014_+|phage-gp6-like-head-tail-connector-protein
MAADLKTLKSSLRIDGNDDDELLTGYLSAATSYIKQAIGDENGVTGFYEMEGVNDLFETAVYALAGSYWTYRTSITAIAVNPVDLVVDSIIGQLRGLYSQKQYEAGTNDESN
>NZ_CP016071.1|WP_053339307.1|2615416_2616592_+|IS256-family-transposase
MNELTTEIIAALAQKQDLDEVFRHHLEIAINQLLQTELAGFLGYERYSYAGINTGNNRNGSYERSFDTKYGQLNLTIPRDRNGRFENHTLPAYGRHSDNLETTVIQLYTKGITTAEIAELIEKMYGAHYSKATVSNMTKAVNEQVQAFQQRRLASQYAAIFLDATYLPLKRDTVQKEAVHIAIGIRPDGTKEVLNYQVAPTESTGIWTELLGTLIKQGVKDVLLFVADGLVGLDEGLNRHFPKAKRQRCLVHVGRNLMNKVRVKDRKAVISDFKQVHRAANREAAELKLNEFANNWHQTYPKLIKDLLKMPNLLTFMDFPPAIRQSLYSTNLIENFNKHLKRTTHHKEQFPTEDSLDRFLVSQFNVYNEKSLRRIHRGFKGLQDTLEASFI
>NZ_CP016071.1|WP_044430958.1|2618155_2618407_+|hypothetical-protein
MDSILITNYKPDYTNNIMTISIQINTLGISSQVSITMDDFNTAIAGGAGGTDRVKLKVLNTLIDSLTALKPVTTTTTTTTQEA
>NZ_CP016071.1|WP_003641410.1|2618410_2618572_+|hypothetical-protein
MNIDAQALINKLTSNYAQAIALKDQQLAMAQVQIDQLNAKLAEKEAPKDGENA
>NZ_CP016071.1|WP_064972058.1|2618555_2619440_+|hypothetical-protein
MAKTLSFTDTSPQTVKIGDTTTSFTLICGDDNVATDLTNVTSITVKLGNTSGYLKSATVDPTSLTDPTTGQVTVNFNADLMTSLTAGSYAIEVWVVDSTGTSIYPSDGTTGFTITNNIQSTNGTTITTITFDDFVAAMNKAASTIAKGDKGDKGDTGPQGVMTNDQVNTLIDNKIKYTSGNLDVTPAFYKAGTTSSTGALNYVRTGNKLHVSGVVSPSADLAIGSATTLFNLPSSIGIIAENVAVVQQSSGWNLYCLSWNPNGAVSVLKHNIAGTATAITTTTQLQVCADILIK
>NZ_CP016071.1|WP_064972059.1|2619455_2620628_+|LysM-peptidoglycan-binding-domain-containing-protein
MNKHKLKALILTVGAIFMAFLMVNVTSQASTSRDQGPDWSKYNGNSGTFGYSSDKFVFSQAGGFYGGTNIPQTTYNSQVKSAQQAGKRVHTYLWDGVGGNMTNAKAMMAYYLPRVRTPKGSIVALDYEDGASNSVTANTNVILAQMKLIKDAGYTPMLYSGKAYLNYHVNVSLILKAYGSCLWVPEYPDYLVRTSPDYNYFPSMDGMAIFQFTSMYKAGGLDGNVDLTGITKLGYTTASKKQAQTNVKQAQAAKKANFKVVKYNQRGVFYPNRTLAVRYTDSDKVRQVATYYKGESVTYNAVIIEHDYVWARYTRSNGLYGFIKLGITNGQAYGKRVTGQPVSHTYYTVKSGDSWWTIAQRNGLSMTTLASQNAKSIYTTIYPGQRLVVR
>NZ_CP016071.1|WP_003644510.1|2620627_2620891_+|hemolysin-XhlA-family-protein
MAQYDDTTKLLMDIQKDVAATKTKVENIEEKLNQVDDIGDKADKALAKSIEASHQIDRVTTIQNWLIGVLVSGVLVTLVIYIAEKFL
>NZ_CP016071.1|WP_064972060.1|2620902_2621439_+|holin
MTKFLNVIQATLKANYKKPAYWAQIIGSVLIIGLAVATVFFGVKIDANAVVLVITAVGAILAFVGAITDNSILEDTGNTIKTKSNALASTEQTVVEALAEAQAKIEAANSAAASQAEAQASQAVVAAYSQAASAAAVGDTATASSAATLASSLAANLDSNAQPDAETASESTSQAGEK
>NZ_CP016071.1|WP_064972061.1|2622672_2623884_+|FtsW/RodA/SpoVE-family-cell-cycle-protein
MNNRELGRWQEHKHIGDYGWGIILCVIILCCIGMWAVYYACLHDLKVIDPVRTTMMQCLWYLVGALIATTMLHLSEKQLMQWAPIGYSIGMLLLILLLVFYSREYYVQTRAKSWFAIGTLTFQPVEVMKPLYILMMGRLIVQDQQWGPHNNFNADWRLTRRLVIYTFPIIVALKIINDFGTTLVFLTIFIGMLIVSPCRFSFLWRVLLVAGSIGVVLILLATSSTGQSLLSHIGFKLYQFDRINTWLNPSNGVSDQSYQLWQSMRAVGVGGLTGNGVTHNAVYVPVRESDMIFSVVGETTGFIGCSVLLIVYMYLFYLIFRSAFASRRRFYVYVFTGVAVMLAFHMFENIGMTIGLLPLTGIPLPFVSQGGSAIIGDFMGVGLVLATQYPNVRSIFSVPRIFH
>NZ_CP016071.1|WP_003644507.1|2624362_2626105_+|ABC-transporter-permease-subunit
MTSLKRGIKVRSVVGTMMWLGLSIGILLMIGWCIAKMNLPLSRLPTQGYLDTTGGKDYLTMSHLVAAALRTTTRLFIGMGYSILFSLIFGILAARYRSARYVILPIVNLLESVPLLGFLTFTTAWFMGLFPNNVLGVEAVAIFGVFTAQAWNIMLALYQSLRVTPEDLMTVAKQFGCNSWQRFWRLEFLYATPSILWNIVISQSAAWFALVACEQATIVVPKNETLVLPGIGSYIQIALDTANFGAVINAVIALVICVLLVNVFIFQPLIKGTAHYKYGTSTDSQLPQQSQVYDLMVMAKVPLLVKRLHRHIRYWWLYGAPKQWQKLGFSRIIRILKKYTVYWRIAWWLVIAVGLYRLGVLLIKYLDWINLSVLFKWTFLTTSRVLIAVLLSALIFIPLAVWVASNARRLKLIQPVGQVLGSIPADIYIPIVALMITLTGTTQHWWVIPLIMTGTQWYFFFNIIAGYLAIPSDIKDVVNIFHLSGWRWWTHFLIPSLFPSFITAIINAAGAAWNADIAAELISWGTHQYAVTGLGAYIAQNINNKPAEATGVLIICVIVGLCVVLIWQPLYRFAERRFHY
>NZ_CP016071.1|WP_003645638.1|2626123_2626915_+|ABC-transporter-ATP-binding-protein
MKKAVLLDVDHVSKSFILSKQRQSELILEAVSLQVQTHQFISIIGSSGVGKSTLLRMIAGIIRPSYGAITFDGNLVTAPNRRMSMVFQNFALFPWLTVRQNIMFGLESQLNSDCQYVDNQIDNLINLIGLKGLKNAYPYELSGGMKQRVGFARALAVEPELLLLDEPFSALDVLTGQRLGQDLITLWERRKFKMQAIVLITHNISEAVRLSDVIYVLGGKPAQIMNTYQIKTPRNQRTEQQIWAKTMAITDQFKRDMNEMRGD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151480-151510	1	0.968
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155563-155593	1	0.968
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153895-153925	1	0.968
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151408-151438	2	0.935
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151444-151474	2	0.935
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154171-154201	2	0.935
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157285-157315	2	0.935
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157411-157441	2	0.935
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1042-1072	2	0.935
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2260-2290	2	0.935
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1528-1558	2	0.935
NZ_CP016071_1	1.19\|59361\|25\|NZ_CP016071\|CRT	59361-59385	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2548-2572	2	0.92
NZ_CP016071_1	1.19\|59361\|25\|NZ_CP016071\|CRT	59361-59385	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153055-153079	2	0.92
NZ_CP016071_1	1.19\|59361\|25\|NZ_CP016071\|CRT	59361-59385	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156649-156673	2	0.92
NZ_CP016071_1	1.19\|59361\|25\|NZ_CP016071\|CRT	59361-59385	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157291-157315	2	0.92
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155509-155539	2	0.935
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156289-156319	2	0.935
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154777-154807	2	0.935
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155173-155203	2	0.935
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155227-155257	2	0.935
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155407-155437	2	0.935
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156415-156445	2	0.935
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1114-1144	2	0.935
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3154-3184	2	0.935
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3382-3412	2	0.935
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3694-3724	2	0.935
NZ_CP016071_1	1.27\|59877\|31\|NZ_CP016071\|CRT	59877-59907	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1546-1576	2	0.935
NZ_CP016071_1	1.15\|59157\|31\|NZ_CP016071\|CRT	59157-59187	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155191-155221	3	0.903
NZ_CP016071_1	1.15\|59157\|31\|NZ_CP016071\|CRT	59157-59187	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155425-155455	3	0.903
NZ_CP016071_1	1.16\|59211\|31\|NZ_CP016071\|CRT	59211-59241	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156325-156355	3	0.903
NZ_CP016071_1	1.16\|59211\|31\|NZ_CP016071\|CRT	59211-59241	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3046-3076	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153193-153223	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153439-153469	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153955-153985	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154615-154645	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154849-154879	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155047-155077	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155281-155311	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155599-155629	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155635-155665	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155815-155845	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155923-155953	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156811-156841	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156979-157009	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151516-151546	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151864-151894	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151954-151984	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153349-153379	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153475-153505	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153493-153523	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154651-154681	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154723-154753	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154777-154807	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154921-154951	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154993-155023	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155119-155149	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155173-155203	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155227-155257	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155353-155383	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155407-155437	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155545-155575	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2392-2422	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3028-3058	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3154-3184	3	0.903
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1060-1090	3	0.903
NZ_CP016071_1	1.19\|59361\|25\|NZ_CP016071\|CRT	59361-59385	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1390-1414	3	0.88
NZ_CP016071_1	1.19\|59361\|25\|NZ_CP016071\|CRT	59361-59385	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1534-1558	3	0.88
NZ_CP016071_1	1.19\|59361\|25\|NZ_CP016071\|CRT	59361-59385	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2020-2044	3	0.88
NZ_CP016071_1	1.19\|59361\|25\|NZ_CP016071\|CRT	59361-59385	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3520-3544	3	0.88
NZ_CP016071_1	1.19\|59361\|25\|NZ_CP016071\|CRT	59361-59385	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151834-151858	3	0.88
NZ_CP016071_1	1.19\|59361\|25\|NZ_CP016071\|CRT	59361-59385	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153091-153115	3	0.88
NZ_CP016071_1	1.19\|59361\|25\|NZ_CP016071\|CRT	59361-59385	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153607-153631	3	0.88
NZ_CP016071_1	1.19\|59361\|25\|NZ_CP016071\|CRT	59361-59385	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154459-154483	3	0.88
NZ_CP016071_1	1.19\|59361\|25\|NZ_CP016071\|CRT	59361-59385	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155737-155761	3	0.88
NZ_CP016071_1	1.19\|59361\|25\|NZ_CP016071\|CRT	59361-59385	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156703-156727	3	0.88
NZ_CP016071_1	1.19\|59361\|25\|NZ_CP016071\|CRT	59361-59385	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157417-157441	3	0.88
NZ_CP016071_1	1.20\|59409\|31\|NZ_CP016071\|CRT	59409-59439	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3712-3742	3	0.903
NZ_CP016071_1	1.20\|59409\|31\|NZ_CP016071\|CRT	59409-59439	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3046-3076	3	0.903
NZ_CP016071_1	1.20\|59409\|31\|NZ_CP016071\|CRT	59409-59439	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3298-3328	3	0.903
NZ_CP016071_1	1.20\|59409\|31\|NZ_CP016071\|CRT	59409-59439	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151606-151636	3	0.903
NZ_CP016071_1	1.20\|59409\|31\|NZ_CP016071\|CRT	59409-59439	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153331-153361	3	0.903
NZ_CP016071_1	1.20\|59409\|31\|NZ_CP016071\|CRT	59409-59439	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154009-154039	3	0.903
NZ_CP016071_1	1.20\|59409\|31\|NZ_CP016071\|CRT	59409-59439	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154153-154183	3	0.903
NZ_CP016071_1	1.20\|59409\|31\|NZ_CP016071\|CRT	59409-59439	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156013-156043	3	0.903
NZ_CP016071_1	1.20\|59409\|31\|NZ_CP016071\|CRT	59409-59439	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156325-156355	3	0.903
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155833-155863	3	0.903
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154993-155023	3	0.903
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1564-1594	3	0.903
NZ_CP016071_1	1.27\|59877\|31\|NZ_CP016071\|CRT	59877-59907	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3136-3166	3	0.903
NZ_CP016071_1	1.27\|59877\|31\|NZ_CP016071\|CRT	59877-59907	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3454-3484	3	0.903
NZ_CP016071_1	1.15\|59157\|31\|NZ_CP016071\|CRT	59157-59187	31	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21037-21067	4	0.871
NZ_CP016071_1	1.15\|59157\|31\|NZ_CP016071\|CRT	59157-59187	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15532-15562	4	0.871
NZ_CP016071_1	1.15\|59157\|31\|NZ_CP016071\|CRT	59157-59187	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15658-15688	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151239-151269	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151372-151402	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151552-151582	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151588-151618	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151786-151816	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152995-153025	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153121-153151	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153157-153187	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153403-153433	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153637-153667	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154063-154093	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155671-155701	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156205-156235	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156943-156973	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157213-157243	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157249-157279	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157465-157495	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157483-157513	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157555-157585	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1114-1144	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1696-1726	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2332-2362	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3514-3544	4	0.871
NZ_CP016071_1	1.19\|59361\|25\|NZ_CP016071\|CRT	59361-59385	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151486-151510	4	0.84
NZ_CP016071_1	1.19\|59361\|25\|NZ_CP016071\|CRT	59361-59385	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153163-153187	4	0.84
NZ_CP016071_1	1.19\|59361\|25\|NZ_CP016071\|CRT	59361-59385	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154585-154609	4	0.84
NZ_CP016071_1	1.19\|59361\|25\|NZ_CP016071\|CRT	59361-59385	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155569-155593	4	0.84
NZ_CP016071_1	1.19\|59361\|25\|NZ_CP016071\|CRT	59361-59385	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157075-157099	4	0.84
NZ_CP016071_1	1.19\|59361\|25\|NZ_CP016071\|CRT	59361-59385	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157111-157135	4	0.84
NZ_CP016071_1	1.20\|59409\|31\|NZ_CP016071\|CRT	59409-59439	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3400-3430	4	0.871
NZ_CP016071_1	1.20\|59409\|31\|NZ_CP016071\|CRT	59409-59439	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3226-3256	4	0.871
NZ_CP016071_1	1.20\|59409\|31\|NZ_CP016071\|CRT	59409-59439	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153259-153289	4	0.871
NZ_CP016071_1	1.20\|59409\|31\|NZ_CP016071\|CRT	59409-59439	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153739-153769	4	0.871
NZ_CP016071_1	1.20\|59409\|31\|NZ_CP016071\|CRT	59409-59439	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155527-155557	4	0.871
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154507-154537	4	0.871
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151786-151816	4	0.871
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153859-153889	4	0.871
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154381-154411	4	0.871
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154471-154501	4	0.871
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156559-156589	4	0.871
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157141-157171	4	0.871
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157555-157585	4	0.871
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1492-1522	4	0.871
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1852-1882	4	0.871
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2068-2098	4	0.871
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2104-2134	4	0.871
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3364-3394	4	0.871
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3490-3520	4	0.871
NZ_CP016071_1	1.27\|59877\|31\|NZ_CP016071\|CRT	59877-59907	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1060-1090	4	0.871
NZ_CP016071_1	1.27\|59877\|31\|NZ_CP016071\|CRT	59877-59907	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1618-1648	4	0.871
NZ_CP016071_1	1.27\|59877\|31\|NZ_CP016071\|CRT	59877-59907	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1960-1990	4	0.871
NZ_CP016071_1	1.27\|59877\|31\|NZ_CP016071\|CRT	59877-59907	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2638-2668	4	0.871
NZ_CP016071_1	1.27\|59877\|31\|NZ_CP016071\|CRT	59877-59907	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3550-3580	4	0.871
NZ_CP016071_1	1.27\|59877\|31\|NZ_CP016071\|CRT	59877-59907	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3676-3706	4	0.871
NZ_CP016071_1	1.27\|59877\|31\|NZ_CP016071\|CRT	59877-59907	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151317-151347	4	0.871
NZ_CP016071_1	1.27\|59877\|31\|NZ_CP016071\|CRT	59877-59907	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151918-151948	4	0.871
NZ_CP016071_1	1.27\|59877\|31\|NZ_CP016071\|CRT	59877-59907	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153913-153943	4	0.871
NZ_CP016071_1	1.27\|59877\|31\|NZ_CP016071\|CRT	59877-59907	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157105-157135	4	0.871
NZ_CP016071_1	1.27\|59877\|31\|NZ_CP016071\|CRT	59877-59907	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	988-1018	4	0.871
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1456-1486	5	0.839
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1738-1768	5	0.839
NZ_CP016071_1	1.20\|59409\|31\|NZ_CP016071\|CRT	59409-59439	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1174-1204	6	0.806
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154099-154129	6	0.806
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154135-154165	6	0.806
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155461-155491	6	0.806
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156241-156271	6	0.806
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1168-1198	6	0.806
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1-31	6	0.806
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2887814-2887844	7	0.774
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153829-153859	7	0.774
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155749-155779	7	0.774
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156103-156133	7	0.774
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156577-156607	7	0.774
NZ_CP016071_1	1.25\|59733\|31\|NZ_CP016071\|CRT	59733-59763	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154189-154219	7	0.774
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153829-153859	8	0.742
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156103-156133	8	0.742
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156577-156607	8	0.742
NZ_CP016071_1	1.17\|59265\|31\|NZ_CP016071\|CRT	59265-59295	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2122-2152	8	0.742
NZ_CP016071_1	1.27\|59877\|31\|NZ_CP016071\|CRT	59877-59907	31	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2887814-2887844	9	0.71

1. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
cgaatccgagtcgctgtccgagtccgaatcg	Protospacer
******************************.

2. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
cgaatccgagtcgctgtccgagtccgaatcg	Protospacer
******************************.

3. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
cgaatccgagtcgctgtcggagtccgaatca	Protospacer
****************** ************

4. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
cgaatccgagtcgctgtcggagtccgaatcg	Protospacer
****************** ***********.

5. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
cgaatccgagtcgctgtccgaatccgaatcg	Protospacer
*********************.********.

6. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
cgaatccgagtcgctgtcagagtccgaatcg	Protospacer
****************** ***********.

7. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
ggaatcggagtcgctgtccgagtccgaatca	Protospacer
 ***** ************************

8. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agagtccgagtcgctgtccgagtccgaatca	Protospacer
 **.***************************

9. spacer 1.17|59265|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgagtcgctgtcagagtccgaatca	Protospacer
 ***************** ************

10. spacer 1.17|59265|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgaatcgctgtccgagtccgaatca	Protospacer
 ********.*********************

11. spacer 1.17|59265|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
cgagtcagagtcgctgtccgagtccgaatca	Protospacer
***.** ************************

12. spacer 1.19|59361|25|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

ggagtcactatccgagtccgaatca	CRISPR spacer
ggagtcactatcagagtccgaatcg	Protospacer
************ ***********.

13. spacer 1.19|59361|25|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

ggagtcactatccgagtccgaatca	CRISPR spacer
ggagtcactgtccgaatccgaatca	Protospacer
*********.*****.*********

14. spacer 1.19|59361|25|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

ggagtcactatccgagtccgaatca	CRISPR spacer
ggagtcactgtcggagtccgaatca	Protospacer
*********.** ************

15. spacer 1.19|59361|25|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

ggagtcactatccgagtccgaatca	CRISPR spacer
ggagtcgctgtccgagtccgaatca	Protospacer
******.**.***************

16. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
ggagtccgaatcactgtcagagtcggaatcg	Protospacer
***.**************************.

17. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
ggagtccgaatcactgtcagagtcggaatcg	Protospacer
***.**************************.

18. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
ggaatccgagtcgctgtcagagtcggaatca	Protospacer
*********.**.******************

19. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
ggaatccgagtcgctgtcagagtcggaatca	Protospacer
*********.**.******************

20. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
ggaatccgagtcgctgtcagagtcggaatca	Protospacer
*********.**.******************

21. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
ggaatccgagtcgctgtcagagtcggaatca	Protospacer
*********.**.******************

22. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
ggaatcggaatcactgtcggagtcggaatca	Protospacer
****** ***********.************

23. spacer 1.25|59733|31|NZ_CP016071|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.935

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
agaatccgaatcgctgtcagagtcggaatca	Protospacer
.***********.******************

24. spacer 1.25|59733|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
ggaatccgaatcgctgtcagagtccgaatca	Protospacer
************.*********** ******

25. spacer 1.25|59733|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
ggagtccgaatcgctgtcagagtcggaatca	Protospacer
***.********.******************

26. spacer 1.25|59733|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
ggagtccgaatcgctgtcagagtcggaatca	Protospacer
***.********.******************

27. spacer 1.27|59877|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

tgagtcagaatcactgtcggaatccgaatca	CRISPR spacer
cgagtccgaatcactgtcggaatccgaatca	Protospacer
.***** ************************

28. spacer 1.15|59157|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

agagtcggaatcactatcagagtctgagtca	CRISPR spacer
agagtcggaatcactgtcagagtccgagtcg	Protospacer
***************.********.*****.

29. spacer 1.15|59157|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

agagtcggaatcactatcagagtctgagtca	CRISPR spacer
agagtcggaatcactgtcagagtccgagtcg	Protospacer
***************.********.*****.

30. spacer 1.16|59211|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

agagtcagaatcactatccgaatccgagtca	CRISPR spacer
cgagtccgaatcactgtccgaatccgagtca	Protospacer
 ***** ********.***************

31. spacer 1.16|59211|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

agagtcagaatcactatccgaatccgagtca	CRISPR spacer
cgagtccgaatcactgtccgaatccgagtca	Protospacer
 ***** ********.***************

32. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
ggaatccgagtcgctgtccgaatccgaatcg	Protospacer
 ********************.********.

33. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgagtcgctgtcagagtccgaatcg	Protospacer
 ***************** ***********.

34. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
ggaatccgagtcgctgtcagagtccgaatcg	Protospacer
 ***************** ***********.

35. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgagtcgctgtcagagtccgaatcg	Protospacer
 ***************** ***********.

36. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgagtcgctgtcagagtccgaatcg	Protospacer
 ***************** ***********.

37. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgagtcgctgtcggagtccgaatcg	Protospacer
 ***************** ***********.

38. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgagtcgctgtcggagtccgaatcg	Protospacer
 ***************** ***********.

39. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgagtcgctgtcagagtccgaatcg	Protospacer
 ***************** ***********.

40. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgagtcgctgtcagagtccgaatcg	Protospacer
 ***************** ***********.

41. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgagtcgctgtccgaatccgaatcg	Protospacer
 ********************.********.

42. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
ggaatccgagtcgctgtccgaatccgaatcg	Protospacer
 ********************.********.

43. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
ggaatccgagtcgctgtcggagtccgaatcg	Protospacer
 ***************** ***********.

44. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
ggaatccgagtcgctgtcggagtccgaatcg	Protospacer
 ***************** ***********.

45. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
cgaatccgagtcgctgtcggagtcggaatcg	Protospacer
****************** ***** *****.

46. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
ggaatccgagtcgctgtccgaatcggaatca	Protospacer
 ********************.** ******

47. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
cgaatccgagtcgctgtcagaatccgaatcg	Protospacer
****************** **.********.

48. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
cgaatccgagtcgctgtcagagtccgagtcg	Protospacer
****************** ********.**.

49. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
cgaatccgagtcgctgtccgaatccgagtcg	Protospacer
*********************.*****.**.

50. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
cgaatccgagtcgctgtccgaatccgagtcg	Protospacer
*********************.*****.**.

51. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
cgaatccgaatcgctgtccgaatccgaatcg	Protospacer
*********.***********.********.

52. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
ggaatccgagtcgctgtccgaatcggaatca	Protospacer
 ********************.** ******

53. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
ggaatccgagtcgctgtcagagtcggaatca	Protospacer
 ***************** ***** ******

54. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
ggaatccgagtcgctgtccgaatcggaatca	Protospacer
 ********************.** ******

55. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgagtcgctgtcagagtcggaatca	Protospacer
 ***************** ***** ******

56. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
ggaatccgagtcgctgtccgaatcggaatca	Protospacer
 ********************.** ******

57. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
ggaatccgagtcgctgtcagagtcggaatca	Protospacer
 ***************** ***** ******

58. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
ggaatccgagtcgctgtcagagtcggaatca	Protospacer
 ***************** ***** ******

59. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
ggaatccgagtcgctgtccgaatcggaatca	Protospacer
 ********************.** ******

60. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
ggaatccgagtcgctgtcagagtcggaatca	Protospacer
 ***************** ***** ******

61. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
cgaatccgagtcgctgtccgaatccgagtcg	Protospacer
*********************.*****.**.

62. spacer 1.17|59265|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgagtcgctgtcggagtccgaatcg	Protospacer
 ***************** ***********.

63. spacer 1.17|59265|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agcatccgaatcgctgtccgagtccgaatca	Protospacer
 * ******.*********************

64. spacer 1.17|59265|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
ggaatccgaatcgctgtcagagtccgaatca	Protospacer
 ********.******** ************

65. spacer 1.17|59265|31|NZ_CP016071|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.903

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgagtcgctgtcggagtccgaatcg	Protospacer
 ***************** ***********.

66. spacer 1.19|59361|25|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

ggagtcactatccgagtccgaatca	CRISPR spacer
ggagtcactgtcagagtccgaatcg	Protospacer
*********.** ***********.

67. spacer 1.19|59361|25|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

ggagtcactatccgagtccgaatca	CRISPR spacer
agagtcgctgtccgagtccgaatca	Protospacer
.*****.**.***************

68. spacer 1.19|59361|25|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

ggagtcactatccgagtccgaatca	CRISPR spacer
ggagtcactgtcagagtccgaatcg	Protospacer
*********.** ***********.

69. spacer 1.19|59361|25|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

ggagtcactatccgagtccgaatca	CRISPR spacer
ggagtcgctgtccgagtccgaatcg	Protospacer
******.**.**************.

70. spacer 1.19|59361|25|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggagtcactatccgagtccgaatca	CRISPR spacer
ggagtcactgtccgaatccgaatcg	Protospacer
*********.*****.********.

71. spacer 1.19|59361|25|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggagtcactatccgagtccgaatca	CRISPR spacer
ggagtcactgtcggagtccgaatcg	Protospacer
*********.** ***********.

72. spacer 1.19|59361|25|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggagtcactatccgagtccgaatca	CRISPR spacer
ggagtcactgtccgaatccgaatcg	Protospacer
*********.*****.********.

73. spacer 1.19|59361|25|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggagtcactatccgagtccgaatca	CRISPR spacer
agagtcactgtcagagtccgaatca	Protospacer
.********.** ************

74. spacer 1.19|59361|25|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggagtcactatccgagtccgaatca	CRISPR spacer
ggagtcactgtcggagtccgaatcg	Protospacer
*********.** ***********.

75. spacer 1.19|59361|25|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggagtcactatccgagtccgaatca	CRISPR spacer
ggagtcactgtcagagtccgaatcg	Protospacer
*********.** ***********.

76. spacer 1.19|59361|25|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggagtcactatccgagtccgaatca	CRISPR spacer
cgagtcgctgtccgagtccgaatca	Protospacer
 *****.**.***************

77. spacer 1.20|59409|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ggagtcggaatcactgtccgaatctgagtca	CRISPR spacer
agagtcggaatcactgtccgaatcggagtcg	Protospacer
.*********************** *****.

78. spacer 1.20|59409|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ggagtcggaatcactgtccgaatctgagtca	CRISPR spacer
cgagtccgaatcactgtccgaatccgagtca	Protospacer
 ***** *****************.******

79. spacer 1.20|59409|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ggagtcggaatcactgtccgaatctgagtca	CRISPR spacer
ggagtcggaatcactgtcagaatcggagtcg	Protospacer
****************** ***** *****.

80. spacer 1.20|59409|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ggagtcggaatcactgtccgaatctgagtca	CRISPR spacer
ggagtcggaatcgctgtccgaatccgagtcg	Protospacer
************.***********.*****.

81. spacer 1.20|59409|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ggagtcggaatcactgtccgaatctgagtca	CRISPR spacer
ggaatcggaatcactgtccgaatccgagtcg	Protospacer
***.********************.*****.

82. spacer 1.20|59409|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ggagtcggaatcactgtccgaatctgagtca	CRISPR spacer
ggagtcggaatcgctgtccgaatccgagtcg	Protospacer
************.***********.*****.

83. spacer 1.20|59409|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ggagtcggaatcactgtccgaatctgagtca	CRISPR spacer
ggagtcggaatcgctgtccgaatccgagtcg	Protospacer
************.***********.*****.

84. spacer 1.20|59409|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ggagtcggaatcactgtccgaatctgagtca	CRISPR spacer
tgagtcggaatcgctgtccgaatcggagtca	Protospacer
 ***********.*********** ******

85. spacer 1.20|59409|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ggagtcggaatcactgtccgaatctgagtca	CRISPR spacer
cgagtccgaatcactgtccgaatccgagtca	Protospacer
 ***** *****************.******

86. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
cgaatccgaatcgctgtcagagtcggaatcg	Protospacer
 ***********.*****************.

87. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
agaatccgagtcgctgtcagagtcggaatca	Protospacer
.********.**.******************

88. spacer 1.25|59733|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
ggaatccgaatcactgtcggagtcggagtcg	Protospacer
******************.********.**.

89. spacer 1.27|59877|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgagtcagaatcactgtcggaatccgaatca	CRISPR spacer
agagtcggaatcactgtcggaatccgaatcg	Protospacer
 *****.***********************.

90. spacer 1.27|59877|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

tgagtcagaatcactgtcggaatccgaatca	CRISPR spacer
agagtcagagtcactgtcggaatccgaatcg	Protospacer
 ********.********************.

91. spacer 1.15|59157|31|NZ_CP016071|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 4, identity: 0.871

agagtcggaatcactatcagagtctgagtca	CRISPR spacer
tgaatcggaatcactatctgagtctgagtcg	Protospacer
 **.************** ***********.

92. spacer 1.15|59157|31|NZ_CP016071|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

agagtcggaatcactatcagagtctgagtca	CRISPR spacer
tgaatcggaatcactatctgagtctgagtcg	Protospacer
 **.************** ***********.

93. spacer 1.15|59157|31|NZ_CP016071|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

agagtcggaatcactatcagagtctgagtca	CRISPR spacer
tgaatcggaatcactatctgagtctgagtcg	Protospacer
 **.************** ***********.

94. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgagtcgctgtcggagtccgagtcg	Protospacer
 ***************** ********.**.

95. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agagtccgagtcgctgtcggagtccgaatcg	Protospacer
 **.************** ***********.

96. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
ggaatccgagtcgctgtcggagtcggaatcg	Protospacer
 ***************** ***** *****.

97. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
ggaatccgagtcgctgtcggagtcggaatcg	Protospacer
 ***************** ***** *****.

98. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgaatcgctgtcagagtccgaatcg	Protospacer
 ********.******** ***********.

99. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
ggagtccgagtcgctgtcagagtccgaatcg	Protospacer
 **.************** ***********.

100. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatcggagtcgctgtcagagtccgaatcg	Protospacer
 ***** *********** ***********.

101. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgagtcactgtcggagtccgaatcg	Protospacer
 ***********.***** ***********.

102. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgagtcgctgtcagagtccgagtcg	Protospacer
 ***************** ********.**.

103. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
ggaatccgaatcgctgtcggagtccgaatcg	Protospacer
 ********.******** ***********.

104. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
ggaatccgagtcgctgtcggagtcggaatcg	Protospacer
 ***************** ***** *****.

105. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgagtcgctgtcagagtccgagtcg	Protospacer
 ***************** ********.**.

106. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgagtcgctgtcggagtccgagtcg	Protospacer
 ***************** ********.**.

107. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgagtcgctgtcggagtcggaatcg	Protospacer
 ***************** ***** *****.

108. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgagtcgctgtcagagtccgagtcg	Protospacer
 ***************** ********.**.

109. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agagtccgagtcgctgtcagagtccgaatcg	Protospacer
 **.************** ***********.

110. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agagtccgagtcgctgtcagagtccgaatcg	Protospacer
 **.************** ***********.

111. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agagtccgaatcgctgtccgagtccgaatcg	Protospacer
 **.*****.********************.

112. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgaatcgctgtcagagtccgaatcg	Protospacer
 ********.******** ***********.

113. spacer 1.17|59265|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agagtccgagtcgctgtcggagtccgaatcg	Protospacer
 **.************** ***********.

114. spacer 1.17|59265|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgagtcgctgtcagagtccgagtcc	Protospacer
 ***************** ********.**

115. spacer 1.17|59265|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agagtccgagtcgctgtccgagtccgagtcc	Protospacer
 **.***********************.**

116. spacer 1.17|59265|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
ggagtcggagtcgctgtccgagtccgaatcg	Protospacer
 **.** ***********************.

117. spacer 1.19|59361|25|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggagtcactatccgagtccgaatca	CRISPR spacer
cgagtcgctgtccgagtccgaatcg	Protospacer
 *****.**.**************.

118. spacer 1.19|59361|25|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggagtcactatccgagtccgaatca	CRISPR spacer
cgagtcactgtcggagtccgaatcg	Protospacer
 ********.** ***********.

119. spacer 1.19|59361|25|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggagtcactatccgagtccgaatca	CRISPR spacer
agagtcactgtcagagtccgaatcg	Protospacer
.********.** ***********.

120. spacer 1.19|59361|25|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggagtcactatccgagtccgaatca	CRISPR spacer
cgagtcgctgtccgagtccgaatcg	Protospacer
 *****.**.**************.

121. spacer 1.19|59361|25|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggagtcactatccgagtccgaatca	CRISPR spacer
agagtcactgtcagagtccgaatcg	Protospacer
.********.** ***********.

122. spacer 1.19|59361|25|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggagtcactatccgagtccgaatca	CRISPR spacer
agagtcactgtcggagtccgaatcg	Protospacer
.********.** ***********.

123. spacer 1.20|59409|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

ggagtcggaatcactgtccgaatctgagtca	CRISPR spacer
agagtcggaatcactgtccgagtcagagtcg	Protospacer
.********************.** *****.

124. spacer 1.20|59409|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

ggagtcggaatcactgtccgaatctgagtca	CRISPR spacer
gctgtcggaatcgctgtccgaatcggagtca	Protospacer
*  *********.*********** ******

125. spacer 1.20|59409|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

ggagtcggaatcactgtccgaatctgagtca	CRISPR spacer
agagtcggaatcactgtcagaatcggagtcg	Protospacer
.***************** ***** *****.

126. spacer 1.20|59409|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

ggagtcggaatcactgtccgaatctgagtca	CRISPR spacer
agagtcggaatcactgtcagaatcggagtcg	Protospacer
.***************** ***** *****.

127. spacer 1.20|59409|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

ggagtcggaatcactgtccgaatctgagtca	CRISPR spacer
agagtcggaatcgctgtccgaatccgagtcg	Protospacer
.***********.***********.*****.

128. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
actatccgaatcgctgtcagagtcggaatca	Protospacer
.  *********.******************

129. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
agaatccgaatcgctgtcagagtccgaatcg	Protospacer
.***********.*********** *****.

130. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
tgaatcggaatcactgtcagagtccgaatcg	Protospacer
 ***** ***************** *****.

131. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
agaatcggaatcgctgtcagagtcggaatcg	Protospacer
.***** *****.*****************.

132. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
agagtccgaatcactgtcggagtcggaatcg	Protospacer
.**.**************.***********.

133. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
agaatccgaatcactgtcagaatccgaatcg	Protospacer
.********************.** *****.

134. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
agagtccgaatcgctgtcagagtcggaatcg	Protospacer
.**.********.*****************.

135. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
agaatccgaatcgctgtcagagtccgaatcg	Protospacer
.***********.*********** *****.

136. spacer 1.25|59733|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
cgaatccgaatcactgtcggagtccgaatcg	Protospacer
 *****************.***** *****.

137. spacer 1.25|59733|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
agaatccgaatcgctgtcggagtcggaatcg	Protospacer
.***********.*****.***********.

138. spacer 1.25|59733|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
agaatccgagtcactgtcagagtcagaatcg	Protospacer
.********.**************.*****.

139. spacer 1.25|59733|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
agaatccgagtcactgtcagagtcggagtcg	Protospacer
.********.*****************.**.

140. spacer 1.25|59733|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
cgaatccgaatcactgtcggagtccgaatcg	Protospacer
 *****************.***** *****.

141. spacer 1.25|59733|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
agaatccgagtcactgtcagagtcggagtcg	Protospacer
.********.*****************.**.

142. spacer 1.27|59877|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgagtcagaatcactgtcggaatccgaatca	CRISPR spacer
agagtccgaatcactgtcagaatccgaatcg	Protospacer
 ***** ***********.***********.

143. spacer 1.27|59877|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgagtcagaatcactgtcggaatccgaatca	CRISPR spacer
agaatccgaatcactgtcggaatccgaatcg	Protospacer
 **.** ***********************.

144. spacer 1.27|59877|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgagtcagaatcactgtcggaatccgaatca	CRISPR spacer
agagtccgaatcactgtcggaatcggaatcg	Protospacer
 ***** ***************** *****.

145. spacer 1.27|59877|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgagtcagaatcactgtcggaatccgaatca	CRISPR spacer
ggagtcggagtcactgtcggaatccgaatcg	Protospacer
 *****.**.********************.

146. spacer 1.27|59877|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgagtcagaatcactgtcggaatccgaatca	CRISPR spacer
agaatccgaatcactgtcggaatccgaatcg	Protospacer
 **.** ***********************.

147. spacer 1.27|59877|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

tgagtcagaatcactgtcggaatccgaatca	CRISPR spacer
ggagtccgaatcactgtcggagtccgaatcg	Protospacer
 ***** **************.********.

148. spacer 1.27|59877|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgagtcagaatcactgtcggaatccgaatca	CRISPR spacer
cgagtcagagtcactgtcagaatccgaatcg	Protospacer
.********.********.***********.

149. spacer 1.27|59877|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgagtcagaatcactgtcggaatccgaatca	CRISPR spacer
cgagtcagagtcactgtcagaatccgaatcg	Protospacer
.********.********.***********.

150. spacer 1.27|59877|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgagtcagaatcactgtcggaatccgaatca	CRISPR spacer
ggagtccgaatcactgtcagaatccgaatcg	Protospacer
 ***** ***********.***********.

151. spacer 1.27|59877|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

tgagtcagaatcactgtcggaatccgaatca	CRISPR spacer
agagtcagagtcactgtcggagtccgaatcg	Protospacer
 ********.***********.********.

152. spacer 1.27|59877|31|NZ_CP016071|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.871

tgagtcagaatcactgtcggaatccgaatca	CRISPR spacer
agagtccgaatcactgtcggaatcggaatcg	Protospacer
 ***** ***************** *****.

153. spacer 1.17|59265|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.839

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agcatccgagtcgctgtccgagtcagagtcg	Protospacer
 * ********************* **.**.

154. spacer 1.17|59265|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.839

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agcatccgaatcgctgtcggagtccgaatcg	Protospacer
 * ******.******** ***********.

155. spacer 1.20|59409|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

ggagtcggaatcactgtccgaatctgagtca	CRISPR spacer
ggagtcggagtcgctgtccgaatcactgtcg	Protospacer
*********.**.***********   ***.

156. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
actatccgaatcgctgtcggagtcggaatcg	Protospacer
.  *********.*****.***********.

157. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
actatccgaatcgctgtcggagtcggaatcg	Protospacer
.  *********.*****.***********.

158. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
agagtcggaatcactgtcagagtcgctgtca	Protospacer
.**.** ******************  .***

159. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
agagtcggaatcactgtcagagtcgctgtca	Protospacer
.**.** ******************  .***

160. spacer 1.25|59733|31|NZ_CP016071|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 6, identity: 0.806

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
agaatcggagtcactgtcagagtcgctgtca	Protospacer
.***** **.***************  .***

161. spacer 1.25|59733|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
agaatcggagtcactgtcagagtcgctgtca	Protospacer
.***** **.***************  .***

162. spacer 1.17|59265|31|NZ_CP016071|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.774

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
cgtcgacgaatcgctgtcggagtccgaatcg	Protospacer
**    ***.******** ***********.

163. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
agaatccgaatcgctgtcggagtcgctgtct	Protospacer
.***********.*****.******  .**

164. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
ggagtccgaatcgctgtcagagtcactgtcg	Protospacer
***.********.***********.  .**.

165. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
agaatccgaatcgctgtcggagtcgctgtct	Protospacer
.***********.*****.******  .**

166. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
agaatccgaatcgctgtcggagtcgctgtct	Protospacer
.***********.*****.******  .**

167. spacer 1.25|59733|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

ggaatccgaatcactgtcagagtcggaatca	CRISPR spacer
agagtccgaatcgctgtcagagtcactgtca	Protospacer
.**.********.***********.  .***

168. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.742

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgaatcgctgtcggagtcgctgtct	Protospacer
 ********.******** *****   .**

169. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.742

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgaatcgctgtcggagtcgctgtct	Protospacer
 ********.******** *****   .**

170. spacer 1.17|59265|31|NZ_CP016071|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.742

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agaatccgaatcgctgtcggagtcgctgtct	Protospacer
 ********.******** *****   .**

171. spacer 1.17|59265|31|NZ_CP016071|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.742

cgaatccgagtcgctgtccgagtccgaatca	CRISPR spacer
agagtcggagtcgctgtccgagtcactgtcg	Protospacer
 **.** *****************   .**.

172. spacer 1.27|59877|31|NZ_CP016071|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.71

tgagtcagaatcactgtcggaatccgaatca	CRISPR spacer
cgtcgacgaatcgctgtcggagtccgaatcg	Protospacer
.*     *****.********.********.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

236 : 11066

Lactobacillus_phage(77.78%)

integrase

attL 3684:3697|attR 17285:17298

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172821796.1\|236_413_-	hypothetical protein	A0A2P0ZLB1	Lactobacillus_phage	3.7e-25	91.4
WP_064971842.1\|393_675_-	hypothetical protein	NA	NA	NA	NA
WP_064971843.1\|765_1131_-	DUF771 domain-containing protein	E9LUT3	Lactobacillus_phage	1.8e-26	65.1
WP_047674555.1\|1130_1334_-	hypothetical protein	A0A2P0ZLA4	Lactobacillus_phage	3.1e-28	92.5
WP_015380155.1\|1337_1547_-	hypothetical protein	A0A2P0ZL97	Lactobacillus_phage	1.6e-30	98.6
WP_064971844.1\|1611_1989_+	DUF2513 domain-containing protein	NA	NA	NA	NA
WP_155123378.1\|1985_2150_-	hypothetical protein	NA	NA	NA	NA
WP_064971846.1\|2465_2846_+	helix-turn-helix transcriptional regulator	A0A2P0ZLA1	Lactobacillus_phage	3.7e-54	80.6
WP_003643876.1\|2855_3287_+	hypothetical protein	A0A2P0ZLA0	Lactobacillus_phage	7.6e-80	100.0
WP_064971847.1\|3379_4003_+	hypothetical protein	NA	NA	NA	NA
3684:3697	attL	NA	NA	NA	NA
WP_064971848.1\|4125_6909_+	class I SAM-dependent DNA methyltransferase	Q6NE04	Leptospira_phage	2.9e-156	36.7
WP_064971849.1\|7080_8211_+\|integrase	tyrosine-type recombinase/integrase	A0A0M9JJ77	Lactobacillus_phage	1.6e-92	48.2
WP_016511343.1\|8798_11066_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	8.8e-119	31.5
17285:17298	attR	NA	NA	NA	NA

DBSCAN-SWA_2

164136 : 171743

Escherichia_phage(50.0%)

integrase

attL 159949:159963|attR 180371:180385

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
159949:159963	attL	NA	NA	NA	NA
WP_063722497.1\|164136_165084_-	SDR family NAD(P)-dependent oxidoreductase	A0A1V0SAI6	Catovirus	6.8e-41	34.5
WP_027822000.1\|165101_165875_-	tyrosine protein phosphatase	NA	NA	NA	NA
WP_063722498.1\|165861_166590_-	CpsD/CapB family tyrosine-protein kinase	NA	NA	NA	NA
WP_063722499.1\|166601_167372_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_080440298.1\|167728_168307_+\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	9.3e-33	42.5
WP_063722500.1\|168338_169181_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	2.5e-34	36.8
WP_064971857.1\|169250_170279_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	2.4e-68	41.8
WP_003644155.1\|170288_170870_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	4.3e-38	45.1
WP_024002619.1\|170873_171743_-	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	9.2e-101	61.2
180371:180385	attR	NA	NA	NA	NA

DBSCAN-SWA_3

602615 : 611239

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063722777.1\|602615_603611_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.2e-50	37.9
WP_003640969.1\|603749_604535_-	acyl-ACP thioesterase	NA	NA	NA	NA
WP_003643942.1\|604538_605435_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	9.9e-82	55.7
WP_003640967.1\|605533_605881_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_063722776.1\|605905_606925_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	7.4e-33	33.9
WP_003640965.1\|606941_607271_-	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_011101140.1\|607267_607933_-	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640957.1\|608330_608582_-	YaaL family protein	NA	NA	NA	NA
WP_003637790.1\|608596_609196_-	recombination protein RecR	NA	NA	NA	NA
WP_003640956.1\|609211_609520_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003643940.1\|609541_611239_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0

DBSCAN-SWA_4

741045 : 802233

uncultured_Mediterranean_phage(22.22%)

bacteriocin,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060684287.1\|741045_742317_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.6e-96	43.9
WP_063722864.1\|742783_744397_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	9.6e-144	49.9
WP_003642041.1\|744569_745178_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_003642040.1\|745222_745663_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_024971479.1\|746025_746958_+	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_169484456.1\|746966_748325_+	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	5.2e-26	32.9
WP_015379810.1\|748344_749154_+	sugar-phosphatase	NA	NA	NA	NA
WP_024971609.1\|749322_750309_-	hypothetical protein	NA	NA	NA	NA
WP_015379808.1\|750391_751414_-	YdcF family protein	NA	NA	NA	NA
WP_003643830.1\|751702_752683_-	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	4.9e-42	36.3
WP_063722865.1\|753048_753873_-	serine hydrolase	NA	NA	NA	NA
WP_003642031.1\|754108_755491_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L140	Tupanvirus	5.7e-28	33.2
WP_003642030.1\|755559_756396_-	pur operon repressor	NA	NA	NA	NA
WP_063722866.1\|756888_757152_-	hypothetical protein	NA	NA	NA	NA
WP_063722867.1\|757166_757709_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_162899478.1\|758258_758420_-	hypothetical protein	NA	NA	NA	NA
WP_003646500.1\|758788_759586_-	metal ABC transporter permease	NA	NA	NA	NA
WP_003642023.1\|759578_760277_-	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	1.2e-15	27.8
WP_063722868.1\|760545_761490_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003643828.1\|761799_762666_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_003642020.1\|762798_763050_-	Veg family protein	NA	NA	NA	NA
WP_003642019.1\|763154_764045_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_022638211.1\|764041_764605_-	ribonuclease M5	NA	NA	NA	NA
WP_003643825.1\|764591_765368_-	TatD family hydrolase	NA	NA	NA	NA
WP_064971879.1\|765619_766108_-	hypothetical protein	NA	NA	NA	NA
WP_043992601.1\|766670_767561_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_015379798.1\|767594_768779_-	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_063722871.1\|769059_769434_-	hypothetical protein	NA	NA	NA	NA
WP_003643823.1\|769912_771964_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8
WP_011101012.1\|772285_772675_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_003642012.1\|773271_774114_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_003646490.1\|774113_774818_-	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_064971880.1\|774839_775799_-	IpaB/EvcA family protein	NA	NA	NA	NA
WP_063722873.1\|775791_777066_-	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_003642008.1\|777111_778029_-	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_047672680.1\|778997_780131_-	hypothetical protein	NA	NA	NA	NA
WP_027822753.1\|780585_781599_-\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_003642004.1\|781711_782458_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_080475163.1\|782607_783504_-	ROK family protein	NA	NA	NA	NA
WP_027821494.1\|783584_785021_-	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	1.3e-30	25.5
WP_003643816.1\|785038_786394_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003642000.1\|786616_787039_-	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003641999.1\|787028_787217_-	hypothetical protein	NA	NA	NA	NA
WP_003641998.1\|787223_788585_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641997.1\|788657_789368_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_015825134.1\|789773_790790_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_064971881.1\|791228_792005_-	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_064971882.1\|792263_794573_+	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_064971883.1\|794667_794871_-	hypothetical protein	NA	NA	NA	NA
WP_027821497.1\|795008_795695_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_053339247.1\|795788_796469_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_027821499.1\|796555_797224_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_027821500.1\|797291_797981_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_027821501.1\|798070_799447_-	HlyD family secretion protein	NA	NA	NA	NA
WP_027821502.1\|799463_801614_-	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	3.6e-45	27.9
WP_064971884.1\|801879_802050_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_003643811.1\|802074_802233_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA

DBSCAN-SWA_5

2042307 : 2050818

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645861.1\|2042307_2042790_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0
WP_064971978.1\|2042773_2043904_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_021356104.1\|2043906_2044638_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	2.1e-37	37.3
WP_003642588.1\|2044639_2044894_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_011101895.1\|2044893_2045574_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_021356102.1\|2045566_2047786_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.5e-144	39.1
WP_003642591.1\|2047770_2049225_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
WP_003645866.1\|2049221_2050247_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.7e-59	41.0
WP_003645867.1\|2050239_2050818_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9

DBSCAN-SWA_6

2243866 : 2277175

Lactobacillus_phage(62.5%)

terminase,portal,integrase,capsid,tail

attL 2243626:2243646|attR 2286096:2286116

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2243626:2243646	attL	NA	NA	NA	NA
WP_063722928.1\|2243866_2244988_-\|integrase	tyrosine-type recombinase/integrase	D6PSS4	Lactobacillus_phage	2.9e-46	32.1
WP_063722927.1\|2245148_2245943_-	hypothetical protein	U5U717	Lactobacillus_phage	1.6e-11	27.5
WP_063722926.1\|2245959_2246181_+	hypothetical protein	U5U783	Lactobacillus_phage	1.1e-05	41.5
WP_003642778.1\|2246365_2246542_-	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	2.6e-10	51.7
WP_063486624.1\|2246818_2247154_-	hypothetical protein	A0A1B0Y4P2	Lactobacillus_phage	4.1e-25	52.2
WP_087613285.1\|2247632_2248331_-	hypothetical protein	NA	NA	NA	NA
WP_157668938.1\|2248515_2249439_-	DUF5067 domain-containing protein	NA	NA	NA	NA
WP_064971992.1\|2249539_2249962_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_064971993.1\|2249976_2250480_-	helix-turn-helix transcriptional regulator	S6C481	Thermus_phage	3.8e-22	41.4
WP_060417532.1\|2250626_2250881_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_064971994.1\|2251037_2251319_-	hypothetical protein	NA	NA	NA	NA
WP_003642792.1\|2251397_2251568_+	hypothetical protein	NA	NA	NA	NA
WP_064971995.1\|2251579_2251885_+	DUF771 domain-containing protein	NA	NA	NA	NA
WP_064971996.1\|2251951_2252464_+	transcriptional regulator	D6PST4	Lactobacillus_phage	1.2e-28	44.7
WP_080475178.1\|2252834_2253221_+	hypothetical protein	NA	NA	NA	NA
WP_064971998.1\|2253217_2254117_+	recombinase RecT	E9LUM3	Lactobacillus_phage	9.3e-64	53.3
WP_172821809.1\|2254148_2254901_+	PD-(D/E)XK nuclease-like domain-containing protein	A0A0P0IZH9	Lactobacillus_phage	4.7e-69	49.8
WP_064971999.1\|2254981_2255890_+	DnaD domain protein	NA	NA	NA	NA
WP_064972000.1\|2255886_2256174_+	hypothetical protein	NA	NA	NA	NA
WP_064972001.1\|2256170_2256689_+	hypothetical protein	O03915	Lactobacillus_phage	4.3e-45	60.5
WP_033611989.1\|2256685_2257069_+	endodeoxyribonuclease	NA	NA	NA	NA
WP_064505709.1\|2257335_2257500_-	YjzC family protein	A0A0A7RTS6	Clostridium_phage	3.0e-13	66.0
WP_052048925.1\|2257624_2257849_+	helix-turn-helix transcriptional regulator	D2IZX1	Enterococcus_phage	1.4e-05	37.5
WP_076640085.1\|2257841_2258054_+	hypothetical protein	E9LUP4	Lactobacillus_phage	2.1e-11	86.0
WP_003642805.1\|2258181_2258643_+	transcriptional regulator	D6PSV8	Lactobacillus_phage	1.1e-39	57.0
WP_063964074.1\|2259364_2260210_+	hypothetical protein	NA	NA	NA	NA
WP_080469165.1\|2260256_2260424_+	hypothetical protein	E9LUP6	Lactobacillus_phage	7.3e-07	57.4
WP_063723236.1\|2260410_2260674_+	hypothetical protein	A0A1S5RCN3	Lactobacillus_phage	1.1e-28	68.6
WP_063486483.1\|2260713_2261223_+	helix-turn-helix domain-containing protein	A0A2H4IYT3	uncultured_Caudovirales_phage	4.5e-07	36.8
WP_064522746.1\|2261203_2262529_+\|terminase	PBSX family phage terminase large subunit	A0A1S5SA45	Streptococcus_phage	4.5e-139	55.7
WP_155123380.1\|2262531_2264127_+\|portal	phage portal protein	B5LPR1	Bacillus_virus	7.6e-85	37.5
WP_064972004.1\|2264119_2265205_+	hypothetical protein	A0A059T7W2	Listeria_phage	6.2e-38	31.4
WP_064972005.1\|2265268_2265871_+	hypothetical protein	NA	NA	NA	NA
WP_064972006.1\|2265884_2266832_+\|capsid	N4-gp56 family major capsid protein	A8ASJ6	Listeria_phage	3.9e-89	59.5
WP_064972007.1\|2266920_2267181_+	hypothetical protein	NA	NA	NA	NA
WP_064972008.1\|2267191_2267596_+	hypothetical protein	A5GYM1	Lactococcus_phage	5.7e-05	27.5
WP_064972009.1\|2267596_2267986_+	hypothetical protein	NA	NA	NA	NA
WP_046947889.1\|2267982_2268384_+	hypothetical protein	NA	NA	NA	NA
WP_063722337.1\|2268383_2268809_+	hypothetical protein	NA	NA	NA	NA
WP_064972010.1\|2268826_2269435_+	hypothetical protein	NA	NA	NA	NA
WP_064972011.1\|2269553_2270072_+	hypothetical protein	NA	NA	NA	NA
WP_064972012.1\|2270068_2270710_+	hypothetical protein	U3PFU8	Lactobacillus_phage	1.1e-07	28.1
WP_064972013.1\|2270725_2276356_+\|tail	phage tail tape measure protein	U5U708	Lactobacillus_phage	8.0e-113	59.0
WP_064972014.1\|2276356_2277175_+\|tail	phage tail family protein	NA	NA	NA	NA
2286096:2286116	attR	NA	NA	NA	NA

DBSCAN-SWA_7

2577860 : 2666465

Lactobacillus_phage(81.13%)

terminase,portal,tRNA,protease,head,integrase,holin,transposase,capsid,tail

attL 2570910:2570927|attR 2640865:2640882

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2570910:2570927	attL	NA	NA	NA	NA
WP_053338955.1\|2577860_2579024_-\|integrase	site-specific integrase	B4XYR4	Lactobacillus_phage	1.2e-55	36.5
WP_157951717.1\|2579417_2579879_+	hypothetical protein	NA	NA	NA	NA
WP_064972033.1\|2581061_2581937_-	hypothetical protein	NA	NA	NA	NA
WP_064972034.1\|2582066_2582741_-	LexA family transcriptional regulator	D7RWL5	Brochothrix_phage	2.7e-52	45.1
WP_063485655.1\|2582908_2583157_+	helix-turn-helix transcriptional regulator	A0A0P0IX93	Lactobacillus_phage	4.0e-17	61.4
WP_063487054.1\|2583172_2583880_+	Rha family transcriptional regulator	D2IYT0	Enterococcus_phage	2.8e-63	58.6
WP_064972035.1\|2583891_2584101_+	hypothetical protein	NA	NA	NA	NA
WP_015380501.1\|2584216_2584543_-	hypothetical protein	E9LUT2	Lactobacillus_phage	2.7e-53	98.1
WP_064972036.1\|2584600_2584861_+	hypothetical protein	NA	NA	NA	NA
WP_015380499.1\|2585002_2585251_+	hypothetical protein	E9LUT6	Lactobacillus_phage	1.9e-35	84.1
WP_015380498.1\|2585253_2585454_+	hypothetical protein	E9LUT7	Lactobacillus_phage	1.7e-26	89.4
WP_064972037.1\|2585465_2585690_+	hypothetical protein	E9LUT8	Lactobacillus_phage	8.3e-30	86.5
WP_016058361.1\|2585738_2585885_+	hypothetical protein	E9LUT9	Lactobacillus_phage	4.3e-19	100.0
WP_127064441.1\|2585887_2586418_+	host-nuclease inhibitor Gam family protein	E9LUU0	Lactobacillus_phage	3.6e-92	99.4
WP_016058363.1\|2586426_2587089_+	AAA family ATPase	E9LUU1	Lactobacillus_phage	4.2e-122	100.0
WP_064972038.1\|2587090_2587750_+	DUF669 domain-containing protein	O03912	Lactobacillus_phage	5.7e-95	80.4
WP_064972039.1\|2587796_2588489_+	hypothetical protein	E9LUU3	Lactobacillus_phage	4.9e-129	97.8
WP_155123382.1\|2588475_2588682_+	hypothetical protein	NA	NA	NA	NA
WP_064972041.1\|2588750_2589479_+	replisome organizer	E9LUM6	Lactobacillus_phage	1.1e-41	41.3
WP_064972042.1\|2589478_2590264_+	ATP-binding protein	E9LUN6	Lactobacillus_phage	1.1e-132	91.6
WP_064972043.1\|2590399_2590702_+	hypothetical protein	E9LUN7	Lactobacillus_phage	6.1e-44	91.0
WP_063487063.1\|2590704_2591016_+	hypothetical protein	A0A2P0ZLB4	Lactobacillus_phage	5.0e-49	91.3
WP_063487884.1\|2591019_2591214_+	hypothetical protein	A0A2P0ZLB7	Lactobacillus_phage	9.1e-17	72.4
WP_127064439.1\|2591206_2591365_+	hypothetical protein	A0A2P0ZLB5	Lactobacillus_phage	3.3e-17	88.5
WP_063487065.1\|2591540_2591870_+	hypothetical protein	NA	NA	NA	NA
WP_003644538.1\|2592154_2592580_+	transcriptional regulator	E9LUP5	Lactobacillus_phage	3.3e-59	77.3
WP_064972044.1\|2592902_2593814_+	DUF4868 domain-containing protein	A0A1Q1PW39	Staphylococcus_phage	5.4e-11	25.5
WP_172821806.1\|2594520_2594691_+	hypothetical protein	E9LUP6	Lactobacillus_phage	1.3e-22	94.6
WP_080475182.1\|2594701_2595172_+	HNH endonuclease	E9LUP7	Lactobacillus_phage	1.6e-83	93.6
WP_064972047.1\|2595177_2595441_+	hypothetical protein	NA	NA	NA	NA
WP_063487069.1\|2595458_2595710_+	hypothetical protein	NA	NA	NA	NA
WP_064972048.1\|2595898_2596357_+\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	1.2e-80	96.7
WP_064972049.1\|2596359_2598258_+\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	0.0e+00	96.8
WP_064972050.1\|2598247_2598442_+	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	3.3e-27	98.4
WP_064972051.1\|2598444_2599638_+\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	2.4e-224	98.7
WP_064972052.1\|2599615_2600371_+\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	1.8e-124	93.2
WP_064972053.1\|2600370_2601603_+\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	2.4e-203	88.9
WP_016058329.1\|2601675_2602014_+\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	7.0e-57	100.0
WP_016058330.1\|2601997_2602360_+\|head	phage head closure protein	E9LUQ5	Lactobacillus_phage	5.2e-66	100.0
WP_063722567.1\|2602349_2602790_+	hypothetical protein	E9LUQ6	Lactobacillus_phage	5.0e-79	99.3
WP_063722568.1\|2602786_2603170_+	hypothetical protein	E9LUQ7	Lactobacillus_phage	9.4e-66	98.4
WP_063722569.1\|2603170_2603809_+\|tail	phage tail protein	E9LUQ8	Lactobacillus_phage	1.1e-116	99.5
WP_016058334.1\|2604010_2604394_+	hypothetical protein	E9LUQ9	Lactobacillus_phage	3.9e-64	100.0
WP_016058335.1\|2604390_2604582_+	hypothetical protein	E9LUR0	Lactobacillus_phage	1.5e-27	100.0
WP_064972054.1\|2604594_2609736_+\|tail	phage tail protein	E9LUR1	Lactobacillus_phage	0.0e+00	84.4
WP_064972055.1\|2609807_2611577_+\|tail	phage tail family protein	E9LUR2	Lactobacillus_phage	0.0e+00	95.8
WP_064972056.1\|2611640_2614010_+\|tail	phage tail protein	E9LUR3	Lactobacillus_phage	0.0e+00	94.7
WP_064972057.1\|2614026_2615331_+	hypothetical protein	A0A2P0ZL34	Lactobacillus_phage	1.2e-22	76.8
WP_053339307.1\|2615416_2616592_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_044430958.1\|2618155_2618407_+	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	9.3e-30	95.8
WP_003641410.1\|2618410_2618572_+	hypothetical protein	A0A2P0ZLG1	Lactobacillus_phage	4.7e-19	96.2
WP_064972058.1\|2618555_2619440_+	hypothetical protein	E9LUR7	Lactobacillus_phage	1.8e-136	98.0
WP_064972059.1\|2619455_2620628_+	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	1.0e-211	94.4
WP_003644510.1\|2620627_2620891_+	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
WP_064972060.1\|2620902_2621439_+\|holin	holin	E9LUS0	Lactobacillus_phage	8.0e-39	95.7
WP_064972061.1\|2622672_2623884_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_003644507.1\|2624362_2626105_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_003645638.1\|2626123_2626915_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.5e-30	36.8
WP_076670309.1\|2626895_2628065_+	LCP family protein	NA	NA	NA	NA
WP_063722578.1\|2628216_2628789_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_063722579.1\|2629488_2630430_-	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	4.1e-78	48.7
WP_015640487.1\|2630876_2631269_-	hypothetical protein	NA	NA	NA	NA
WP_003645633.1\|2631432_2631825_+	hypothetical protein	NA	NA	NA	NA
WP_063722580.1\|2631860_2633030_+	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_003645631.1\|2633079_2633709_-	hypothetical protein	NA	NA	NA	NA
WP_089178220.1\|2634012_2634243_+	DNA alkylation repair protein	NA	NA	NA	NA
WP_003640747.1\|2634332_2634965_-	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
WP_003644501.1\|2635116_2635356_+	DUF896 domain-containing protein	NA	NA	NA	NA
WP_003640745.1\|2635453_2635690_+	YneF family protein	NA	NA	NA	NA
WP_003645630.1\|2635746_2636382_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_063722581.1\|2636493_2637252_+\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_053267827.1\|2637235_2637541_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_003640741.1\|2637625_2638624_+	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9
WP_003640740.1\|2638912_2639635_-	HAD family hydrolase	NA	NA	NA	NA
WP_003640739.1\|2639859_2640663_+	30S ribosomal protein S2	NA	NA	NA	NA
WP_003644498.1\|2640765_2641644_+	elongation factor Ts	NA	NA	NA	NA
2640865:2640882	attR	NA	NA	NA	NA
WP_003640737.1\|2641843_2642566_+	UMP kinase	NA	NA	NA	NA
WP_003640736.1\|2642567_2643131_+	ribosome recycling factor	NA	NA	NA	NA
WP_063722583.1\|2643250_2644030_+	isoprenyl transferase	R9W0U9	Flavobacterium_phage	9.0e-23	46.3
WP_063722584.1\|2644045_2644831_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_064972062.1\|2644868_2646146_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_063722585.1\|2646185_2647895_+\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_003640729.1\|2648388_2652702_+	DNA polymerase III subunit alpha	A0A1X9SH08	Bradyrhizobium_phage	1.0e-14	34.0
WP_003640728.1\|2652997_2653474_+	ribosome maturation factor RimP	NA	NA	NA	NA
WP_003640727.1\|2653494_2654712_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003640726.1\|2654756_2655056_+	YlxR family protein	NA	NA	NA	NA
WP_003640725.1\|2655045_2655351_+	ribosomal L7Ae/L30e/S12e/Gadd45 family protein	NA	NA	NA	NA
WP_003645962.1\|2655365_2657942_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.6e-21	23.3
WP_003640723.1\|2657964_2658318_+	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_063722586.1\|2660415_2661585_+	chorismate synthase	NA	NA	NA	NA
WP_003645964.1\|2661593_2662121_+	amino acid biosynthesis protein	NA	NA	NA	NA
WP_063722587.1\|2662134_2663433_+	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_015825650.1\|2663435_2664533_+	prephenate dehydrogenase	NA	NA	NA	NA
WP_003645967.1\|2664535_2665057_+	shikimate kinase	NA	NA	NA	NA
WP_080475183.1\|2665541_2666465_+\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA

DBSCAN-SWA_8

3156357 : 3164874

Lactobacillus_phage(85.71%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645220.1\|3156357_3157353_-	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	3.1e-52	38.8
WP_015380221.1\|3157979_3158117_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_011101401.1\|3158212_3158653_+	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	3.0e-76	98.6
WP_003643095.1\|3158723_3159284_-	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
WP_063723107.1\|3159371_3161810_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.5
WP_063723106.1\|3161812_3162427_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	2.4e-111	99.5
WP_003643099.1\|3162769_3163717_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_015825455.1\|3163902_3164874_+	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	1.8e-182	99.4

DBSCAN-SWA_9

3192309 : 3283830

Lactobacillus_phage(71.15%)

terminase,portal,tRNA,protease,integrase,holin,transposase,capsid,tail,lysis

attL 3219044:3219060|attR 3286381:3286397

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024003017.1\|3192309_3193998_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	1.5e-75	32.9
WP_011101382.1\|3194269_3194716_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003643130.1\|3195104_3195350_-	hypothetical protein	NA	NA	NA	NA
WP_003643131.1\|3195476_3196868_-	MATE family efflux transporter	NA	NA	NA	NA
WP_024003015.1\|3197143_3198919_-	SLC13 family permease	NA	NA	NA	NA
WP_003645241.1\|3199351_3201091_-	aryl-sulfate sulfotransferase	NA	NA	NA	NA
WP_063723098.1\|3201312_3202269_-	bifunctional oligoribonuclease/PAP phosphatase NrnA	NA	NA	NA	NA
WP_003645243.1\|3202258_3202882_-	adenylyl-sulfate kinase	A0A2K9L4R9	Tupanvirus	4.8e-27	40.6
WP_064972090.1\|3202884_3204060_-	sulfate adenylyltransferase	A0A2P1ELS9	Moumouvirus	2.9e-49	31.7
WP_064972091.1\|3204037_3205675_-	sulfotransferase family protein	NA	NA	NA	NA
WP_063723097.1\|3206563_3208870_+	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
WP_064972092.1\|3208883_3210740_+	bifunctional homocysteine S-methyltransferase/methylenetetrahydrofolate reductase	NA	NA	NA	NA
WP_003645248.1\|3210812_3211172_+	YisL family protein	NA	NA	NA	NA
WP_003643142.1\|3211271_3211793_-	GtrA family protein	NA	NA	NA	NA
WP_003643143.1\|3211898_3212912_+	hypothetical protein	NA	NA	NA	NA
WP_003645249.1\|3213076_3213502_+	hypothetical protein	NA	NA	NA	NA
WP_064972093.1\|3214065_3214959_-	SH3 domain-containing protein	A0A2P0ZLG2	Lactobacillus_phage	4.2e-117	86.1
WP_054396940.1\|3214958_3215243_-\|lysis	lysis protein	A0A2P0ZLE8	Lactobacillus_phage	3.1e-42	98.9
WP_047674473.1\|3215242_3215437_-	hypothetical protein	A0A2P0ZLG4	Lactobacillus_phage	3.4e-24	98.4
WP_061871516.1\|3215439_3215823_-	hypothetical protein	A0A2P0ZLF7	Lactobacillus_phage	1.3e-67	98.4
WP_064972094.1\|3215839_3216274_-	hypothetical protein	A0A2P0ZLE9	Lactobacillus_phage	1.0e-71	98.6
WP_064972150.1\|3216275_3216758_-	DUF1617 family protein	A0A2P0ZLE0	Lactobacillus_phage	1.3e-80	100.0
WP_064972095.1\|3216783_3220737_-	hypothetical protein	A0A2P0ZLE1	Lactobacillus_phage	0.0e+00	72.2
3219044:3219060	attL	NA	NA	NA	NA
WP_064972096.1\|3220756_3221578_-\|tail	phage tail protein	A0A2P0ZLE2	Lactobacillus_phage	2.0e-153	99.6
WP_064972097.1\|3221581_3226126_-\|tail	phage tail tape measure protein	A0A2P0ZLF1	Lactobacillus_phage	0.0e+00	97.2
WP_003643912.1\|3226144_3226366_-	hypothetical protein	A0A2P0ZLD9	Lactobacillus_phage	3.9e-32	98.6
WP_061871520.1\|3226389_3226704_-	hypothetical protein	A0A2P0ZLF3	Lactobacillus_phage	4.2e-48	90.4
WP_061871521.1\|3226775_3227048_-	Ig-like domain-containing protein	A0A2P0ZLD8	Lactobacillus_phage	7.2e-36	98.9
WP_054396956.1\|3227022_3227628_-\|tail	phage tail protein	A0A2P0ZLF5	Lactobacillus_phage	3.7e-109	99.5
WP_064972099.1\|3227642_3228065_-	hypothetical protein	A0A2P0ZLE4	Lactobacillus_phage	1.9e-72	98.6
WP_015380187.1\|3228061_3228469_-	HK97 gp10 family phage protein	A0A2P0ZLD7	Lactobacillus_phage	2.0e-66	94.1
WP_064972100.1\|3228465_3228855_-	hypothetical protein	A0A2P0ZLD1	Lactobacillus_phage	2.7e-68	97.7
WP_024002308.1\|3228835_3229141_-	hypothetical protein	A0A2P0ZLD5	Lactobacillus_phage	4.4e-50	100.0
WP_064972101.1\|3229279_3230458_-\|capsid	phage major capsid protein	A0A2P0ZLD6	Lactobacillus_phage	7.3e-218	99.0
WP_003643904.1\|3230478_3231231_-\|protease	Clp protease ClpP	A0A2P0ZLE3	Lactobacillus_phage	6.0e-133	98.8
WP_064972102.1\|3231217_3232360_-\|portal	phage portal protein	A0A2P0ZLC9	Lactobacillus_phage	8.1e-214	97.9
WP_064972103.1\|3232378_3234058_-\|terminase	terminase large subunit	A0A2P0ZLE5	Lactobacillus_phage	2.6e-229	69.5
WP_064972151.1\|3234054_3234342_-\|terminase	P27 family phage terminase small subunit	A0A2P0ZLC8	Lactobacillus_phage	4.9e-27	65.3
WP_064972104.1\|3234449_3234692_-	hypothetical protein	A0A2P0ZLD2	Lactobacillus_phage	2.1e-39	98.8
WP_064972106.1\|3234951_3235290_-	HNH endonuclease	A0A2P0ZLC6	Lactobacillus_phage	3.1e-60	94.6
WP_060811411.1\|3235273_3235474_-	hypothetical protein	A0A2P0ZLC2	Lactobacillus_phage	5.1e-15	86.4
WP_064972107.1\|3235811_3236348_-	hypothetical protein	NA	NA	NA	NA
WP_064972152.1\|3236546_3237206_-	hypothetical protein	NA	NA	NA	NA
WP_054396990.1\|3237280_3237694_-	hypothetical protein	A0A2P0ZLC0	Lactobacillus_phage	3.7e-68	94.9
WP_064972108.1\|3237704_3238013_-	hypothetical protein	A0A2P0ZLD0	Lactobacillus_phage	7.8e-47	91.1
WP_064972109.1\|3238229_3238595_-	hypothetical protein	A0A2I7RY34	Vibrio_phage	3.0e-13	38.3
WP_155123383.1\|3238607_3238946_-	hypothetical protein	NA	NA	NA	NA
WP_064972111.1\|3238929_3239127_-	hypothetical protein	NA	NA	NA	NA
WP_064972112.1\|3239145_3239478_-	VRR-NUC domain-containing protein	A0A2P0ZLB6	Lactobacillus_phage	1.5e-51	87.3
WP_064972113.1\|3239737_3241012_-	helicase	A0A2P0ZLC4	Lactobacillus_phage	4.8e-239	97.4
WP_064972114.1\|3241008_3241803_-	bifunctional DNA primase/polymerase	A0A2P0ZLB0	Lactobacillus_phage	8.3e-125	86.0
WP_064972115.1\|3241873_3242497_-	hypothetical protein	A0A2P0ZLB9	Lactobacillus_phage	3.2e-103	100.0
WP_064972116.1\|3242499_3243216_-	AAA family ATPase	A0A2P0ZLB2	Lactobacillus_phage	2.7e-114	99.5
WP_061871542.1\|3243193_3243415_-	helix-turn-helix transcriptional regulator	A0A0A7RUJ5	Clostridium_phage	5.7e-07	40.3
WP_080475195.1\|3243411_3244743_-	DEAD/DEAH box helicase family protein	A0A2P0ZLA5	Lactobacillus_phage	5.9e-240	93.7
WP_064972117.1\|3244822_3245302_-	siphovirus Gp157 family protein	A0A2P0ZLB3	Lactobacillus_phage	3.4e-81	96.9
WP_063486030.1\|3245405_3245723_-	hypothetical protein	A0A2P0ZLA7	Lactobacillus_phage	7.0e-59	100.0
WP_064972118.1\|3245992_3246370_+	helix-turn-helix transcriptional regulator	A0A0A7AQV8	Bacillus_phage	7.0e-05	38.5
WP_172821808.1\|3248207_3248348_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155123384.1\|3249536_3249674_+	hypothetical protein	NA	NA	NA	NA
WP_064972119.1\|3250225_3250618_+	helix-turn-helix transcriptional regulator	X2CXD8	Lactobacillus_phage	7.7e-07	34.7
WP_016058040.1\|3251651_3252113_+	GNAT family N-acetyltransferase	E9LUK4	Lactobacillus_phage	1.7e-82	100.0
WP_003646108.1\|3252271_3252610_+	helix-turn-helix transcriptional regulator	A0A2H4J5G9	uncultured_Caudovirales_phage	3.7e-05	38.2
WP_064972120.1\|3252806_3253238_+	YjdF family protein	NA	NA	NA	NA
WP_001748110.1\|3253374_3253719_-	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_064972121.1\|3254060_3254657_+\|integrase	site-specific integrase	E2ELN7	Clostridium_phage	6.7e-18	33.1
WP_060678111.1\|3254989_3255202_+	hypothetical protein	NA	NA	NA	NA
WP_013356275.1\|3261253_3262093_+	proline/glycine betaine ABC transporter permease	NA	NA	NA	NA
WP_013356274.1\|3262100_3263018_+	glycine/betaine ABC transporter	NA	NA	NA	NA
WP_016526705.1\|3263263_3264229_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	7.0e-09	26.8
WP_053339316.1\|3264383_3265313_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	1.9e-19	29.5
WP_016526703.1\|3265350_3265650_-	hypothetical protein	NA	NA	NA	NA
WP_013356270.1\|3265651_3266512_-	ParA family protein	F0PIG8	Enterococcus_phage	1.7e-43	40.2
WP_053339315.1\|3268459_3268741_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_033098918.1\|3268730_3269237_+	mRNA interferase PemK	NA	NA	NA	NA
WP_027822961.1\|3269306_3270014_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_111443564.1\|3270022_3270898_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.8e-19	28.5
WP_053339314.1\|3270920_3271211_-	hypothetical protein	NA	NA	NA	NA
WP_003555660.1\|3271233_3271461_-	hypothetical protein	NA	NA	NA	NA
WP_064972122.1\|3271712_3273773_+	MobA/MobL family protein	NA	NA	NA	NA
WP_021353390.1\|3275227_3275317_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_058906975.1\|3275664_3276891_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	2.3e-89	48.0
WP_053339310.1\|3277271_3278426_-	S-adenosyl-L-homocysteine hydrolase	NA	NA	NA	NA
WP_014940864.1\|3278415_3279078_-	HD domain-containing protein	A0A1D6Y7U0	Golden_Marseillevirus	2.8e-09	29.1
WP_053339309.1\|3279077_3280469_-	MFS transporter	NA	NA	NA	NA
WP_006293514.1\|3280756_3280861_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_053339308.1\|3281139_3282219_+	FRG domain-containing protein	Q9AZ51	Lactococcus_phage	9.0e-05	51.9
WP_053339307.1\|3282654_3283830_-\|transposase	IS256 family transposase	NA	NA	NA	NA
3286381:3286397	attR	NA	NA	NA	NA

DBSCAN-SWA_10

3291058 : 3301147

Enterococcus_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064972154.1\|3291058_3293206_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	6.1e-255	60.2
WP_010623241.1\|3293312_3294239_+	ribonucleotide-diphosphate reductase subunit beta	A0A2H4P8A9	Corynebacterium_phage	5.9e-37	32.1
WP_046811155.1\|3294253_3295204_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	1.2e-98	54.3
WP_112260612.1\|3295331_3296144_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_064972123.1\|3296257_3296890_+	recombinase family protein	A0A1B0VBM1	Salmonella_phage	2.4e-13	30.6
WP_013356283.1\|3296976_3297879_+	YitT family protein	M1Q1P6	Streptococcus_phage	6.3e-52	40.3
WP_112260613.1\|3297986_3298761_+\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_013356282.1\|3299132_3300287_+	cation:proton antiporter	NA	NA	NA	NA
WP_112260613.1\|3300371_3301147_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP016071

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection