CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP016170	Bordetella bronchialis strain AU3182, complete genome	4 crisprs	cas3,WYL,DinG,csa3,DEDDh	0	1	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP016170_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016170_1

840888-840956

Unclear

Consensus_repeat	Method
GTATCGACGCCCGGCGTATCGACG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP016170_1

>merge|NZ_CP016170|1|840888-840956|CRISPRCasFinder
GTATCGACGCCCGGCGTATCGACGCCGGACGTGTGGTCACCGGACGTATCGCCGCCCGGCGTATCGACG

>NZ_CP016170|1|1|840888-840956|CRISPRCasFinder
GTATCGACGCCCGGCGTATCGACG	CCGGACGTGTGGTCACCGGAC
GTATCGCCGCCCGGCGTATCGACG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016170.1\|WP_066344420.1\|839229_840084_+\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223257
NZ_CP016170.1\|WP_066344442.1\|847953_849621_+\|TRAP-transporter-large-permease-subunit	unknown	unknown	gnl\|CDD\|227010
NZ_CP016170.1\|WP_066344407.1\|836287_837256_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP016170.1\|WP_066344405.1\|834918_836229_+\|Rieske-2Fe-2S-domain-containing-protein	unknown	unknown	gnl\|CDD\|239561
NZ_CP016170.1\|WP_082993507.1\|841068_841803_-\|flavin-reductase-family-protein	unknown	unknown	gnl\|CDD\|224766
NZ_CP016170.1\|WP_066344413.1\|837283_838234_+\|oxidoreductase	unknown	unknown	gnl\|CDD\|99782
NZ_CP016170.1\|WP_066344394.1\|831629_832322_+\|urea-ABC-transporter-ATP-binding-subunit-UrtE	unknown	unknown	gnl\|CDD\|274567
NZ_CP016170.1\|WP_066344415.1\|838244_839141_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176131
NZ_CP016170.1\|WP_066344441.1\|847316_847952_+\|TRAP-transporter-small-permease-subunit	unknown	unknown	gnl\|CDD\|227011
NZ_CP016170.1\|WP_066344437.1\|845173_845956_+\|2-oxo-hepta-3-ene-1,7-dioic-acid-hydratase	unknown	unknown	gnl\|CDD\|131365
NZ_CP016170.1\|WP_066344426.1\|843040_843436_+\|RidA-family-protein	unknown	unknown	gnl\|CDD\|100004
NZ_CP016170.1\|WP_066357904.1\|840112_840856_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP016170.1\|WP_066344435.1\|844301_845180_+\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223257
NZ_CP016170.1\|WP_066344428.1\|843432_844305_+\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|238636
NZ_CP016170.1\|WP_066344399.1\|832366_833596_+\|acetamidase/formamidase-family-protein	unknown	unknown	gnl\|CDD\|376984
NZ_CP016170.1\|WP_066344401.1\|833629_833965_+\|zinc-ribbon-domain-containing-protein	unknown	unknown	gnl\|CDD\|197903
NZ_CP016170.1\|WP_066344423.1\|842048_843020_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
NZ_CP016170.1\|WP_066344439.1\|846205_847306_+\|TRAP-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270400
NZ_CP016170.1\|WP_066344445.1\|849747_850317_+\|M23-family-metallopeptidase	unknown	unknown	gnl\|CDD\|366703
NZ_CP016170.1\|WP_066344404.1\|834096_834885_+\|TIM-barrel-protein	unknown	unknown	gnl\|CDD\|226149

Protein	Function_ID	Function_description	E-value
NZ_CP016170.1\|WP_066344420.1\|839229_840084_+\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|223257	COG0179, MhpD, 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism].	2.67592e-88
NZ_CP016170.1\|WP_066344442.1\|847953_849621_+\|TRAP-transporter-large-permease-subunit	gnl\|CDD\|227010	COG4664, FcbT3, TRAP-type mannitol/chloroaromatic compound transport system, large permease component [Secondary metabolites biosynthesis, transport, and catabolism].	2.81645e-99
NZ_CP016170.1\|WP_066344407.1\|836287_837256_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	2.49918e-144
NZ_CP016170.1\|WP_066344405.1\|834918_836229_+\|Rieske-2Fe-2S-domain-containing-protein	gnl\|CDD\|239561	cd03479, Rieske_RO_Alpha_PhDO_like, Rieske non-heme iron oxygenase (RO) family, Phthalate 4,5-dioxygenase (PhDO)-like subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of PhDO and similar proteins including 3-chlorobenzoate 3,4-dioxygenase (CBDO), phenoxybenzoate dioxygenase (POB-dioxygenase) and 3-nitrobenzoate oxygenase (MnbA). ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth. The oxygenase alpha subunit contains an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from a reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. PhDO and CBDO are two-component RO systems, containing oxygenase and reductase components. PhDO catalyzes the dihydroxylation of phthalate to form the 4,5-dihydro-cis-dihydrodiol of phthalate (DHD). CBDO, together with CbaC dehydrogenase, converts the environmental pollutant 3CBA to protocatechuate (PCA) and 5-Cl-PCA, which are then metabolized by the chromosomal PCA meta (extradiol) ring fission pathway. POB-dioxygenase catalyzes the initial catabolic step in the angular dioxygenation of phenoxybenzoate, converting mono- and dichlorinated phenoxybenzoates to protocatechuate and chlorophenols. These phenoxybenzoates are metabolic products formed during the degradation of pyrethroid insecticides.	5.24949e-72
NZ_CP016170.1\|WP_082993507.1\|841068_841803_-\|flavin-reductase-family-protein	gnl\|CDD\|224766	COG1853, COG1853, Conserved protein/domain typically associated with flavoprotein oxygenases, DIM6/NTAB family [General function prediction only].	3.46554e-32
NZ_CP016170.1\|WP_066344413.1\|837283_838234_+\|oxidoreductase	gnl\|CDD\|99782	cd06185, PDR_like, Phthalate dioxygenase reductase (PDR) is an FMN-dependent reductase that mediates electron transfer from NADH to FMN to an iron sulfur cluster. PDR has an an N-terminal ferrredoxin reductase (FNR)-like NAD(H) binding domain and a C-terminal iron-sulfur [2Fe-2S] cluster domain. Although structurally homologous to FNR, PDR binds FMN rather than FAD in it's FNR-like domain. Electron transfer between pyrimidines and iron-sulfur clusters (Rieske center [2Fe-2S]) or heme groups is mediated by flavins in respiration, photosynthesis, and oxygenase systems. Type I dioxygenase systems, including the hydroxylate phthalate system, have 2 components, a monomeric reductase consisting of a flavin and a 2Fe-2S center and a multimeric oxygenase. In contrast to other Rieske dioxygenases the ferredoxin like domain is C-, not N-terminal.	9.16223e-96
NZ_CP016170.1\|WP_066344394.1\|831629_832322_+\|urea-ABC-transporter-ATP-binding-subunit-UrtE	gnl\|CDD\|274567	TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. [Transport and binding proteins, Amino acids, peptides and amines].	5.09428e-131
NZ_CP016170.1\|WP_066344415.1\|838244_839141_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176131	cd08440, PBP2_LTTR_like_4, TThe C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to a name a few. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	8.39351e-63
NZ_CP016170.1\|WP_066344441.1\|847316_847952_+\|TRAP-transporter-small-permease-subunit	gnl\|CDD\|227011	COG4665, FcbT2, TRAP-type mannitol/chloroaromatic compound transport system, small permease component [Secondary metabolites biosynthesis, transport, and catabolism].	2.31676e-78
NZ_CP016170.1\|WP_066344437.1\|845173_845956_+\|2-oxo-hepta-3-ene-1,7-dioic-acid-hydratase	gnl\|CDD\|131365	TIGR02312, 2-keto-4-pentenoate_hydratase, 2-oxo-hepta-3-ene-1,7-dioic acid hydratase. This model represents the enzyme which hydrates the double bond of 2-oxo-hepta-3-ene-1,7-dioic acid to form 4-hydroxy-2-oxo-heptane-1,7-dioic acid in the catabolism of 4-hydroxyphenylacetic acid. The gene for this enzyme is generally found adjacent to other genes of this pathway in an apparent operon.	3.59097e-133
NZ_CP016170.1\|WP_066344426.1\|843040_843436_+\|RidA-family-protein	gnl\|CDD\|100004	cd00448, YjgF_YER057c_UK114_family, YjgF, YER057c, and UK114 belong to a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.	3.6852e-24
NZ_CP016170.1\|WP_066357904.1\|840112_840856_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	6.44704e-45
NZ_CP016170.1\|WP_066344435.1\|844301_845180_+\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|223257	COG0179, MhpD, 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism].	4.80705e-88
NZ_CP016170.1\|WP_066344428.1\|843432_844305_+\|amidohydrolase-family-protein	gnl\|CDD\|238636	cd01311, PDC_hydrolase, 2-pyrone-4,6-dicarboxylic acid (PDC) hydrolase hydrolyzes PDC to yield 4-oxalomesaconic acid (OMA) or its tautomer, 4-carboxy-2-hydroxymuconic acid (CHM). This reaction is part of the protocatechuate (PCA) 4,5-cleavage pathway. PCA is one of the most important intermediate metabolites in the bacterial pathways for various phenolic compounds, including lignin, which is the most abundant aromatic material in nature.	7.51208e-57
NZ_CP016170.1\|WP_066344399.1\|832366_833596_+\|acetamidase/formamidase-family-protein	gnl\|CDD\|376984	pfam03069, FmdA_AmdA, Acetamidase/Formamidase family. This family includes amidohydrolases of formamide EC:3.5.1.49 and acetamide. Methylophilus methylotrophus FmdA forms a homotrimer suggesting all the members of this family also do.	0
NZ_CP016170.1\|WP_066344401.1\|833629_833965_+\|zinc-ribbon-domain-containing-protein	gnl\|CDD\|197903	smart00834, CxxC_CXXC_SSSS, Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.	6.03777e-11
NZ_CP016170.1\|WP_066344423.1\|842048_843020_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	2.11654e-134
NZ_CP016170.1\|WP_066344439.1\|846205_847306_+\|TRAP-transporter-substrate-binding-protein	gnl\|CDD\|270400	cd13682, PBP2_TRAP_alpha-ketoacid, Substrate-binding component of an alpha-keto acid binding Tripartite ATP-independent Periplasmic transporter and related proteins; contains the type 2 periplasmic-binding protein fold. This subgroup includes TRAP transporters that bind to ketoacids such as pyruvate and alpha-ketobutyrate, xylulose, and other unknown ligands. TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. They are comprised of a periplasmic substrate-binding protein (SBP; often called the P subunit) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process (the M subunit) and a smaller membrane of unknown function (the Q subunit). The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	0
NZ_CP016170.1\|WP_066344445.1\|849747_850317_+\|M23-family-metallopeptidase	gnl\|CDD\|366703	pfam01551, Peptidase_M23, Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.	4.45681e-29
NZ_CP016170.1\|WP_066344404.1\|834096_834885_+\|TIM-barrel-protein	gnl\|CDD\|226149	COG3622, Hfi, Hydroxypyruvate isomerase [Carbohydrate transport and metabolism].	2.57538e-96

>NZ_CP016170.1|WP_066357904.1|840112_840856_-|IclR-family-transcriptional-regulator
MALLRLVACGQERGTRLIDLVRMSGLNRPTVHRLLKALMQEGAIEQDAGTRRYLIGPEISLLGLARTRRFPLLTLAEPYLIELAHDVGDTVFLSIRHGHDSICIGRRTGHHPIQVLSIEVGVRRPLGVGVSGVALLASLPEQESAALIAANAARLAVLGEKPADIQARVAKARASGIAHAPAGLMPGTSAVAVPIPGPRGGALGAVTVTAMANRLTADRYTEVVERMRVAARAIARRYSEAAAGAKG
>NZ_CP016170.1|WP_066344420.1|839229_840084_+|fumarylacetoacetate-hydrolase-family-protein
MKLLSYIHEGRPGWGMLDRDGQVVDGQAWTGGRHASLKSLLAEGNDAWQGLRAPDPAHPRIALERLRLLPVIPDPGKILCVGLNYEEHRRETNRAPTGEPTLFLRVASSQIGHGDAIVVPRASDQVDYEGEIAIVIGRPGRHIAQDRAWSHIAGYAPYNDVSVRDWQQHTTQWTPGKNFDGTGAFGPWMTTRDEIADGAELGLETRLNGAVVQRATTAQLIFDIPRLVHYASRFTTLQPGDVIVTGTPGGVGFKRNPPVFLKAGDVVEVEVSGVGCLSNPVRGE
>NZ_CP016170.1|WP_066344415.1|838244_839141_-|LysR-family-transcriptional-regulator
MNVTIKQLRAFINVVNAGSFTEAAKRMYVTQSALSLLLRDLEAELGFRLLDRNSRRMQLSTMGAEFYPLAIKVVDDLDAAINNTLQLHERQRGSVVMACTLLYGQALMPQILAAFAQRYPAIKVRMLDLPNEQVLARVAADEADLGVAPQRPTPAGLVQERLFQDRIQLICPQDHPLARRKRVTWAQALAHPFISLPLDFTVRLQADLLAWSKSLTLNPSHSVSYLTTALGMVKWGHGLTALPSYSTPLLTAYGLAGVPVRDPVIHRQISLFTKRSRSLSPAAASLMDFMHEFMARAE
>NZ_CP016170.1|WP_066344413.1|837283_838234_+|oxidoreductase
MTMEARLKLRIRAIAQEAQAIHSYELVDDGGGPLPAFTAGAHLTLHLPVGLSRCYSLTNCPGERHRYVIAVNRDAHSRGGSRYLHEAARVGQVLAADPPRNLFELDEAAQASVLIAGGIGITPIRCMIRRLETLGRPWELHYCARHPGAAAYLEELQGDPRVHTYFDAVPSPRRLDIAATLAALPAGAHVYCCGPTPMLEAFRLHAAALPAERVHLEQFGPAAAPAVGEGYAVRLARSGRSVRVMPGRSILETLIEAGLQPPHACGQGVCGSCETAVLAGRPDHRDQVLSEAEKAAGASMMICCSGSLDPELVLDM
>NZ_CP016170.1|WP_066344407.1|836287_837256_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKTLMRGLCAGLALAFAACAGAAGYPDKPIRLIVPYAAGGSTDSTARLVAKGLAERLGQPVVVENRAGAGGMIGQDLVAKAPADGYTLLLSAAGPLTVTPHAYEKVPYDPVRAFTPIKLIAKAPLVLVANPKLGFKSVQDLIEAARKNPGKVTYASFGIGSAGHLAGELFKSLTGVDMVHVPYKGSAPGLVDVVGGQVNVMFDVLVSALPQVQAGKLDALAITLGERSQLMPNVPTMQEAGITGFEAGTWFGLLGPAGMPPEVVARLSQAADQVLAQAALRKELVAQGAEVAGGSTDDFRRFFLSEYDKWGRVARAAGIKAG
>NZ_CP016170.1|WP_066344405.1|834918_836229_+|Rieske-2Fe-2S-domain-containing-protein
MLTAADNDLLTLTGPDRPMGQYFRRYWQPVALSRELPEPDGPPIRVQIMGEQLLAFRDTRGRVGLVEPVCPHRGADLYYGRNEDCGLRCVFHGWKFGVDGKAMDLPNVAPDSNYHKTMAIKAYPTREFGEIVWAYLGPVPQDGTLPEVPRLEFGTLPASRRYVTKKRQECNWAQALEGALDTSHFSFLHMPAPNVPSNDNADAPADERRLAWIRRDPMPRFSILDHEVGFVVGGARRADGQDIYWRTAQFALPSHSTTPSTLPGENYFGYTFVPIDDHACWIYTYVWNPERDLTPAEIAQLKGGHGVVAEVDERFIPLRNLSNGYLLDRQEQKHKTYTGVRGVAEQDAMIQESQGRIADRTREHLTATDAAIVRLRRTLLAGARALAQGTEPRAPWCHEAYRLRSGSWVASEGRSFEDIMQERFGSITGRVEQADA
>NZ_CP016170.1|WP_066344404.1|834096_834885_+|TIM-barrel-protein
MLRFDPNLRWMYTELPMLDRYRAAARAGFRGVEVAFPYEYSARQIADLLGENGLRLVQVLTPCDWAAGERGIAALPGREDDFRRSVDVAVAYAVQVGKPMIHAMAGNVPAGTDRARCRETFLRNLEYAAPLLAGEGLTLILEPCCRARFADYFYSRIDEGVALIEALGQPNVKLCFDTFHVQMEEGNLTNTLRAAWPHIGHVQIGNAPGRHQPGPGEIHFPFFFSQLEQLGWDRWVGCEFEPTGPTDDCLEWGEPYGIRRPA
>NZ_CP016170.1|WP_066344401.1|833629_833965_+|zinc-ribbon-domain-containing-protein
MPLYDYSCAQCGDFAAMRPMARWRDPAPCPECGAAAHRIVAGAPALGALSSAVRRAHAMNERNASEPRSTRGGHGMNCGCCGGTARSGGKTRRTADGGKTFADSRPWMIGH
>NZ_CP016170.1|WP_066344399.1|832366_833596_+|acetamidase/formamidase-family-protein
MPETLIKVDLAQSPYENENIHNRWHPDIPIAAWVKPGDDFVLETYDWTGGAIKNDDSADDVRDVDLSTVHFLSGPVGVEGAEPGDLLVVDFLDIGAKPESLWGFNGFFSKKNGGGFLTEHFPQAQKSIWDFEGMFTRSRHVPGVRFAGLIHPGLIGCLPDQAMLDTWNKREQALIDTNPTRVPPLANPPAPRTAHLGRLQGAARDKAAAEGARTVPPREHGGNCDIKDLSRGSRVFFPVYVKGGGLSVGDLHFSQGDGEITFCGAIEMAGWIHMRVSLIKGGMAKYGIRNPIFKPSPVTPNYKDYLIFEGISVDEGGGQHYLDVHIAYRQACLNAIEYLKKFGYSGAQAYSILGTAPVQGHISGVVDIPNACATLWLPTEIFEFDIQPSASGPVKAVSGGVDMPLSPDL
>NZ_CP016170.1|WP_066344394.1|831629_832322_+|urea-ABC-transporter-ATP-binding-subunit-UrtE
MFTVSGLVSGYGQSRVIHGVDLGVAKGEIVAVMGRNGMGKTTLFKTMMGVLPAMQGKVGVDGVDISAMESFQRVRSGVAYVPQGRMIFPTLTVEENIRTGLPGRALRDPIPDDIYALFPVLHEMRRRRGGDLSGGQQQQLAIARALVTGPKVLLLDEPTEGIQPSIIKDIARTLLEIRKLKDLAIVVSEQVLSFTMQIADRLIVIDKGRFVHEDARDQVDERTISRYLSV
>NZ_CP016170.1|WP_082993507.1|841068_841803_-|flavin-reductase-family-protein
MHIAAPDLTPEQTYKLLSGIVVPRPIAWISSLGPGDRVNLAPFSCFTFLSNTPPMLGVNIGRKAGQRKDTARNILAHRHYVVNIGDETLLDAIHASAEEHPPEISEADLLGLEVLPSDVIATPRLAAAPISMECRFHSVTPYGDTGAEFFVGEVLVFHIRDGLARDGKIDTEQLRPVCRIGGPNYASLGPIVSKRTIRQTPKSVMTAEARAATAPADPPQAVAGTVATPGAGATRPAASDKARP
>NZ_CP016170.1|WP_066344423.1|842048_843020_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MIRTLLAGTCAAIALAGLASSAHAAWPERPVRIVVPYPPGGNVDVAARLISPGLQAALGQPFIVENKPGAGGMIAGEFVARADPDGYTLFMAANGPLLFSPLIFKRNAYKWDRDFAPISSISYTPLVLEVKPSLPVKSVGELIALAKKEPGKLTMASPGAGTTNHLVSELLQHVTGARWTTAQYKGNAPANTDLLGGQVDFQFDQISVASPFIKDGRLRALAVTAAKRVPSLPDVPTFAEAGIPGMEASTFTGLLAPKGTPPEVLDKLSRALAGILKQPDIVKRFDELGAEARGSTPEEFTRYLAAEDARWTPIIERAGITAN
>NZ_CP016170.1|WP_066344426.1|843040_843436_+|RidA-family-protein
MTRRSIYAEGFSHKNPIPAACRIGSMIYSGSIQGTDPASGAYGDTLERQCELMFDHVRRIVEAGGGSLADIIKMTVWMRDRGQRAALNAAWLRAFPDPANRPARHTMQAALDGDKLVECDFIAVVGLEDAA
>NZ_CP016170.1|WP_066344428.1|843432_844305_+|amidohydrolase-family-protein
MTRYQSFQPQPTAPRTRLPAGACDSQFHVFGPADRYPVRPGAAYEMPGATIEVALRLHRLLGIQRGVIVQATTYGADHQVVLDGLAVAGPGYRGCANAAVLAERDDAYIARLHDAGVRGARYTRQGLGISMEPAVFQRSIARLRELGWYAKFQPEPDGIMAQVAQFQDLDIPVLIDHMGRADPAAGADDPSRRTLEELLKRGNFWVMLSLTEKLSRQGEPWDDVVPLARALIQANPDRVIWGSDWPHPVSVKATPDEGRLVDQLARYAGDEATLRKILVDNPAELFGFDK
>NZ_CP016170.1|WP_066344435.1|844301_845180_+|fumarylacetoacetate-hydrolase-family-protein
MKLLSFEHRGRASFGLLRGEQDIVDLGGQGHADLRAALAAQALPALAERAAGLPATLRIDQVRLLPPIPAPEKIICVGVNYGNRNEEYKDGSAPPAYPSVFPRFPGSFVGHGQPLLRPPESAQLDYEGEIAIVIGRRGRRIAAADAWSHVAGLTCANEGTVRDWLRHGKFNVTQGKNFDASGSMGPWMVTADAFDPAAPLTVTTRVNGEQRQHDTTANLMFPFAELIRYISIWTTLEPGDVISTGTPVGAGVRFDPPRFLKPGDVVEVEVPGIGILSNPVADEQAHDKEPAC
>NZ_CP016170.1|WP_066344437.1|845173_845956_+|2-oxo-hepta-3-ene-1,7-dioic-acid-hydratase
MLNDQDRDRAAELLLAAERSGEPATQLAQTFPGMEIADAYAVQKRVIDRKMAQGARLRGHKIGLTSKAMQSTVGIDEPDYGHLLDTMFFQDGQTISTAGLIVPRVEVELAFVLGKPLRGPDVTLFDVLDATDYVVPALEIIDGRSKYPRTIVDNIADNAACAGIVLGGRPVRPMDIDLRWVGAILLKNGVIEESGVSAAVLGHPGLGIAWLANKLAQHDAGLQAGHVVLAGSFTRTVAVRAGDTLHADYGKLGGISVHFS
>NZ_CP016170.1|WP_066344439.1|846205_847306_+|TRAP-transporter-substrate-binding-protein
MQRRSFLKKATLGAAAGGATLASPVFAQESPTINWRLASSFPRSADAIYSGGENLAKYVGEATGGKFNIRAFPAGEIVPALQVLDGVQNGTVECGHSASYYYFGKDPALSFDAAVPFGLNTRQMNAWMRHGDGLKLLRELFKTYNIVNFPCGYTGTQMGGWFRNEIKSVDDLKGLKFRMSAFAGAVLSRLGVVPQQIAGGDIYPALEKGTIDGAEWIGPYDDEKLGFNKVAKYYYFPGWWEGTLQVSLYVNQEAYNKLPKHYQAVLEQASAAATNDMIAKYDAENPAALRRLIANGAQLRAFPKSVMDACYAESVKVYAEMSAKSPMFKKLYDSMVAFRDNEIPWFRVADGSFDGYMGTIGRNGGK
>NZ_CP016170.1|WP_066344441.1|847316_847952_+|TRAP-transporter-small-permease-subunit
MKSLLAISRLIDAINLRVGRAVTWVTLLVVLVSAGNAVVRKVLHTSSNAWLELQWYMFGAMFLLASGYTLLKNEHVRVDILSSRLSRRKQIWIEIFGVVFFLLPACVLILVLSWPVFTESWLTNEQSSNSGGLVRWPVKLLIPAGFALLVLAGVSHLIKCVGFLLGRCEDPTRREGARSAEEELAEEIAREAQAREAAAAAAVAQPRDGGR
>NZ_CP016170.1|WP_066344442.1|847953_849621_+|TRAP-transporter-large-permease-subunit
MEFFIANLAPIMFATLVVFLLLGFPVAFALAANGILYGLIGIELGLLTPALFQALPQRVFGIISNDTLLAVPFFTLMGLVLERSGMAEDLLETIGQLFGTIRGGLAFAVVFVGAMLAATTGVVSASVISMGLISLPIMLRYGYDRRLASGVIAASGTLSQIIPPSLVLIILADQLGRSIGDMYRAAMVPGFVLAGLYVVYVAIMCVIKPASAPALPEEARRFREANGTRGGRSLLVLMAISVAVAWALGQWMENDTAPADERIVLSLLLWGLTAFVIAIVNKVLRLGLLSALAERVTFVMIPPLFLIFLVLGTIFIGVATPTEGGAMGAVGAIAMAVARKRLTLNLLKQAMDTTTKLSCFVVFILVGSTVFGLTFRGVNGDLWVEHLLTGLPGGQWGFLIVVSVLTFVLAFFLDFFELAFIIVPLLGPVADKMGIDLIWFGVILAVNMQTSFMHPPFGFALFYLRSVAPKDPYRDKVTGRTIAPVTTGQIYWGSVPFIVIQLLMVAAVMLMPAMVMHYKGDQSQVDPASVKIDVQGGYGGSVYGGGQDDPGAAFK
>NZ_CP016170.1|WP_066344445.1|849747_850317_+|M23-family-metallopeptidase
MAASIRLLMFAVLAVAAWWAWPRLPDPWRAPWHMARLALQDPPASLPVPVRGVAPRQLADTWNAARSEGRRHQGVDIFAPRGTPVTSTTEGIVTRVGTNRLGGKVVWVLGPGRQMHYYAHLDGYADVRWGTHVMPGSVLGYVGNTGNAQGTPPHLHYGIYPAGGAINPYPLLAGPSARASAPPPPSDSD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP016170_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016170_2

1524364-1524455

Orphan

Consensus_repeat	Method
CAGCAGAACAACCAGAATCGGCAGCAGAACCAGCA	CRISPRCasFinder

1 spacers

DinG

The CRISPR arrays of NZ_CP016170_2

>merge|NZ_CP016170|2|1524364-1524455|CRISPRCasFinder
CAGCAGAACCAGAACGAGCAGAATCGCAACCAGCAGAACCAGCAGAACAACCAGAATCGGCAGCAGAACCAGCAAAACAACCAGAACCGGCA

>NZ_CP016170|2|2|1524364-1524455|CRISPRCasFinder
CAGCAGAACCAGAACGAGCAGAATCGCAACCAGCA	GAACCAGCAGAACAACCAGAAT
CGGCAGCAGAACCAGCAAAACAACCAGAACCGGCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016170.1\|WP_066346041.1\|1528761_1529316_-\|ferritin-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|377580
NZ_CP016170.1\|WP_066346051.1\|1533385_1534258_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293828
NZ_CP016170.1\|WP_066358317.1\|1523351_1524146_-\|Sir2-family-NAD-dependent-protein-deacetylase	unknown	unknown	gnl\|CDD\|238697
NZ_CP016170.1\|WP_082993541.1\|1526625_1527822_-\|chemotaxis-protein-CheB	unknown	unknown	gnl\|CDD\|319752
NZ_CP016170.1\|WP_066346057.1\|1536971_1537601_-\|cytochrome-C-oxidase-subunit-III	unknown	unknown	gnl\|CDD\|239216
NZ_CP016170.1\|WP_156770169.1\|1534621_1536907_-\|c-type-cytochrome	unknown	unknown	gnl\|CDD\|378238
NZ_CP016170.1\|WP_066346015.1\|1516828_1517365_+\|carboxymuconolactone-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|225039
NZ_CP016170.1\|WP_066346037.1\|1527796_1528687_-\|manganese-catalase-family-protein	unknown	unknown	gnl\|CDD\|226076
NZ_CP016170.1\|WP_066346054.1\|1534357_1534555_-\|DUF3606-domain-containing-protein	unknown	unknown	gnl\|CDD\|371985
NZ_CP016170.1\|WP_066346018.1\|1517490_1518456_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|227311
NZ_CP016170.1\|WP_066358332.1\|1530533_1532303_+\|GMC-family-oxidoreductase	unknown	unknown	gnl\|CDD\|225186
NZ_CP016170.1\|WP_082988026.1\|1518504_1518687_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380215
NZ_CP016170.1\|WP_066346000.1\|1511685_1512984_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|372585
NZ_CP016170.1\|WP_066346044.1\|1529740_1530532_+\|gluconate-2-dehydrogenase-subunit-3-family-protein	unknown	unknown	gnl\|CDD\|379295
NZ_CP016170.1\|WP_066346009.1\|1514083_1515541_-\|cardiolipin-synthase	unknown	unknown	gnl\|CDD\|234967
NZ_CP016170.1\|WP_156770168.1\|1519049_1521005_+\|VRR-NUC-domain-containing-protein	unknown	unknown	gnl\|CDD\|370112
NZ_CP016170.1\|WP_066346006.1\|1513486_1514065_+\|ANTAR-domain-containing-protein	unknown	unknown	gnl\|CDD\|226230
NZ_CP016170.1\|WP_066346031.1\|1524603_1526586_+\|S9-family-peptidase	unknown	unknown	gnl\|CDD\|224423
NZ_CP016170.1\|WP_066346025.1\|1521001_1523305_+\|ATP-dependent-DNA-helicase	DinG	COG1199_DinG_CAS-IV-A	gnl\|CDD\|224120
NZ_CP016170.1\|WP_066345997.1\|1510850_1511714_-\|nitrate-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|130251

Protein	Function_ID	Function_description	E-value
NZ_CP016170.1\|WP_066346041.1\|1528761_1529316_-\|ferritin-like-domain-containing-protein	gnl\|CDD\|377580	pfam05974, DUF892, Domain of unknown function (DUF892). This family consists of several hypothetical bacterial proteins of unknown function.	4.6677e-47
NZ_CP016170.1\|WP_066346051.1\|1533385_1534258_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293828	cd07742, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo hydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	6.57978e-120
NZ_CP016170.1\|WP_066358317.1\|1523351_1524146_-\|Sir2-family-NAD-dependent-protein-deacetylase	gnl\|CDD\|238697	cd01406, SIR2-like, Sir2-like: Prokaryotic group of uncharacterized Sir2-like proteins which lack certain key catalytic residues and conserved zinc binding cysteines; and are members of the SIR2 superfamily of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation.	5.01791e-41
NZ_CP016170.1\|WP_082993541.1\|1526625_1527822_-\|chemotaxis-protein-CheB	gnl\|CDD\|319752	cd16433, CheB, Chemotaxis response regulator protein-glutamate methylesterase, CheB. This family contains the methylesterase CheB (EC 3.1.1.61; also known as CheB methylesterase, chemotaxis-specific methylesterase, methyl-accepting chemotaxis protein methyl-esterase, or protein methyl-esterase) domain, a phosphorylation-activated response regulator involved in reversible modification of bacterial chemotaxis receptors. Signaling output of the chemotaxis receptors is modulated by CheB and methyltransferase CheR by controlling the level of receptor methylation. cheR and cheB have a strong preference to occur in the same operon, and a subgroup contains multidomain proteins with CheB-CheR fusions. Reversible methylation of transmembrane chemoreceptors plays an important role in ligand-dependent signaling and cellular adaptation in bacterial chemotaxis. Phosphorylated CheB catalyzes deamidation of specific glutamine residues in the cytoplasmic region of the chemoreceptors and demethylation of specific methyl glutamate residues introduced into the chemoreceptors by CheR.	2.58968e-92
NZ_CP016170.1\|WP_066346057.1\|1536971_1537601_-\|cytochrome-C-oxidase-subunit-III	gnl\|CDD\|239216	cd02865, Heme_Cu_Oxidase_III_2, Heme-copper oxidase subunit III subfamily. Heme-copper oxidases are transmembrane protein complexes in the respiratory chains of prokaryotes and mitochondria which couple the reduction of molecular oxygen to water to, proton pumping across the membrane. The heme-copper oxidase superfamily is diverse in terms of electron donors, subunit composition, and heme types. This superfamily includes cytochrome c and ubiquinol oxidases. Bacterial oxidases typically contain 3 or 4 subunits in contrast to the 13 subunit bovine cytochrome c oxidase (CcO). Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Subunits I, II and III of ubiquinol oxidase are homologous to the corresponding subunits in CcO. Although not required for catalytic activity, subunit III is believed to play a role in assembly of the multimer complex. Rhodobacter CcO subunit III stabilizes the integrity of the binuclear center in subunit I. It has been proposed that Archaea acquired heme-copper oxidases through gene transfer from Gram-positive bacteria.	2.14282e-41
NZ_CP016170.1\|WP_156770169.1\|1534621_1536907_-\|c-type-cytochrome	gnl\|CDD\|378238	pfam09678, Caa3_CtaG, Cytochrome c oxidase caa3 assembly factor (Caa3_CtaG). Members of this family are the CtaG protein required for assembly of active cytochrome c oxidase of the caa3 type, as found in Bacillus subtilis.	3.45607e-65
NZ_CP016170.1\|WP_066346015.1\|1516828_1517365_+\|carboxymuconolactone-decarboxylase-family-protein	gnl\|CDD\|225039	COG2128, COG2128, Uncharacterized conserved protein [Function unknown].	1.6426e-14
NZ_CP016170.1\|WP_066346037.1\|1527796_1528687_-\|manganese-catalase-family-protein	gnl\|CDD\|226076	COG3546, COG3546, Mn-containing catalase [Inorganic ion transport and metabolism].	1.0556e-104
NZ_CP016170.1\|WP_066346054.1\|1534357_1534555_-\|DUF3606-domain-containing-protein	gnl\|CDD\|371985	pfam12244, DUF3606, Protein of unknown function (DUF3606). This family of proteins is found in bacteria. Proteins in this family are typically between 58 and 85 amino acids in length. There is a single completely conserved residue G that may be functionally important.	6.90999e-19
NZ_CP016170.1\|WP_066346018.1\|1517490_1518456_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|227311	COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].	1.01474e-82
NZ_CP016170.1\|WP_066358332.1\|1530533_1532303_+\|GMC-family-oxidoreductase	gnl\|CDD\|225186	COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism].	4.39649e-69
NZ_CP016170.1\|WP_082988026.1\|1518504_1518687_-\|hypothetical-protein	gnl\|CDD\|380215	NF033216, lipo_YgdI_YgdR, YgdI/YgdR family lipoprotein. Members of this family are exclusively lipoproteins of small size, including YgdI and YgdR from E. coli K-12.	0.000208862
NZ_CP016170.1\|WP_066346000.1\|1511685_1512984_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|372585	pfam13379, NMT1_2, NMT1-like family. This family is closely related to the pfam09084 family.	7.63365e-126
NZ_CP016170.1\|WP_066346044.1\|1529740_1530532_+\|gluconate-2-dehydrogenase-subunit-3-family-protein	gnl\|CDD\|379295	pfam13618, Gluconate_2-dh3, Gluconate 2-dehydrogenase subunit 3. This family corresponds to subunit 3 of the Gluconate 2-dehydrogenase enzyme that catalyzes the conversion of gluconate to 2-dehydro-D-gluconate EC:1.1.99.3.	1.8045e-28
NZ_CP016170.1\|WP_066346009.1\|1514083_1515541_-\|cardiolipin-synthase	gnl\|CDD\|234967	PRK01642, cls, cardiolipin synthetase; Reviewed.	1.66481e-102
NZ_CP016170.1\|WP_156770168.1\|1519049_1521005_+\|VRR-NUC-domain-containing-protein	gnl\|CDD\|370112	pfam08774, VRR_NUC, VRR-NUC domain.	1.72464e-31
NZ_CP016170.1\|WP_066346006.1\|1513486_1514065_+\|ANTAR-domain-containing-protein	gnl\|CDD\|226230	COG3707, AmiR, Response regulator with putative antiterminator output domain [Signal transduction mechanisms].	1.31711e-42
NZ_CP016170.1\|WP_066346031.1\|1524603_1526586_+\|S9-family-peptidase	gnl\|CDD\|224423	COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism].	1.65054e-83
NZ_CP016170.1\|WP_066346025.1\|1521001_1523305_+\|ATP-dependent-DNA-helicase	gnl\|CDD\|224120	COG1199, DinG, Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair].	6.22702e-63
NZ_CP016170.1\|WP_066345997.1\|1510850_1511714_-\|nitrate-ABC-transporter-permease	gnl\|CDD\|130251	TIGR01183, Nitrate_transport_permease_protein_NrtB, nitrate ABC transporter, permease protein. This model describes the nitrate transport permease in bacteria. This is gene product of ntrB. The nitrate transport permease is the integral membrane component of the nitrate transport system and belongs to the ATP-binding cassette (ABC) superfamily. At least in photosynthetic bacteria nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA, ntrB, ntrC, ntrD, narB. Functionally ntrC and ntrD resemble the ATP binding components of the binding protein-dependent transport systems. Mutational studies have shown that ntrB and ntrC are mandatory for nitrate accumulation. Nitrate reductase is encoded by narB. [Transport and binding proteins, Anions].	2.6822e-72

>NZ_CP016170.1|WP_066358317.1|1523351_1524146_-|Sir2-family-NAD-dependent-protein-deacetylase
MAELRQAYADGRLILFAGAGVSAGLGLPTAPEFAEWIARQLEQDPKAFCEYGDVQTLAEYYRLRLGAEQLHEWLLKEWNQRDVDVGASEIHRLIVQGRFHAIYTTNFDHWLEAAHEHHGRPYLKVTGVKDLAALAETDVRPIIKFHGDLDDPASLVLGESGYFERLGFDTPLDLRLRADLLVRPVLFIGYSISDINIRMLFWKLARLWESPRDVCHRPPSYLFWHQDNPVARAVLAQWGIRVVSSQEADPGQALLHFMRDLASS
>NZ_CP016170.1|WP_066346025.1|1521001_1523305_+|ATP-dependent-DNA-helicase
MTPPPAAHDYVVAVRTLCEFTARRGDLDLRFTPSPSAQEGVAGHSAVTARRGSDYETEIALSGSHGLLRVRGRADGYDARRNRLEEIKTHRGRVERIPENHRALHWAQAKVYGHLLCQARKLSEVDVALVYFDIGSQQETALVETCGADALRAFFIDHCERFLHWARQETAHRRARESAMAALRFPHGEFRAGQRELATATFRAARDGHCVMAQAPTGIGKTMATVFPMLKACAGTLDKVFFLCAKTAGRQLALDALDRVRRDAPALPLRTLELVAREQACEHPGKACHGDSCPLARGFHDRLPQARETALAAYRMNRAAVSQAALAHGICPYFLGQELVRWSDVVVGDYNYYFDTSAMLYALTTANQWKVGLLVDEAHNMIERARRMYSVHLGLDELAAARRVAPAPLRKPLDALRRGWRELLKLQEEPYQVYERIPQSLISRMQQAVAALADHLAEQGGEAPENLLRFYFGLLAFLRLADAFGEHSLFDVTRDTGQGKAPAQGSLGIRNVVPAPFLAPRLAGAHGAVLFSATLNPMDFYQDTLGLPRDCRRLDVAGPFRAEQLSVHLVGGVSTRYRDRDASLPAIVEIMASAYRRQPGNYLCFASSFEYADRLAGHIQARHPDLPVWRQAAGMDADGRQAFLARFTPDGQGMGFAVLGGAFGEGVDLPGDRLIGAFIVTLGLPQVNPVNEHMMRRMQARFGNGYDYTYLYPGLQKVVQAAGRVIRTENDRGSVYLIDDRFCRAKVRALLPSWWRPRLLPRPTRES
>NZ_CP016170.1|WP_156770168.1|1519049_1521005_+|VRR-NUC-domain-containing-protein
MSATSLAQRPPSDPVLPPSTPAVPLSTPHVAVAAVPAALPRLPGPPADRRFYYLHNFQFALDWILARYDDLLDIAERDFIARFPLLPLAARALLVRLLMRKGPVFRMDGLVYTEIGCVRTAARPLLDLGWLDPDPVLTLDQVFHLLKRAELPGFFHAIDARIPARATKTSWMDGLRPLWPRAHRWSEWKRGGGLPSREGAWRGADGSDQEAATRTADLDDQAYEQAPASGYAAEKAREHAPAVFHSEDDTCDVVAVGIAGMVERFRLMFFGNLRQAWSEFVLADLGIFRYENVAFPLEARAFQAREDVDTYLRLHRQRESFESGEPWENVWTAVHAEAPANPWLARRRDKLLFALGRHCESRQAWPEAQRIYRSCGYPGTRHRLARVLEHSGDHAGAMALAEQALLSPENEAETQLMQRLHARASRRLQAVRERTGPAWTSPPRTDLLLARPTPFLSVEHATREALSRPDAPVFYVENTLVTGLFGLLCWPAVFLPVAGAFFHPYQRGPADLHGPDFVESRRAAFQECLARLDDGTHRAAIMDVFHAKAGIQSPFVSWHALDADLLRLALDCVPAAHMKRWFQRVLADIGNHCTGWPDLIQFWPGERRYALIEVKGPGDRLQDNQRRTLSYLLAHGIPAGVCHVAWRGADA
>NZ_CP016170.1|WP_082988026.1|1518504_1518687_-|hypothetical-protein
MNFPKRVISLAAACVLGAMLAGCANDGRFDHPGPPHPGAVNPWASDRGWGPGPNYPATGR
>NZ_CP016170.1|WP_066346018.1|1517490_1518456_+|helix-turn-helix-domain-containing-protein
MASVAVVVFDGVQSLDVSGPLDVFAEANRLLPPEAAYELQTISIDGPAVTCTNSMSLTATAIWTRPDFKADILLVAGGRGLSTRQFDEAVYAWLRGACARARRYGSICNGALIFAKAGMLKGRTVTTHWDSVEALISTCPGCFVEPDRIYVQDGPLYTSAGVSAGIDLALHMLRQDQGAEIALSVAKRLVVVMQRTGGQSQFSPYLNAPADSASPVADAQRYVLANLRRPLTVSELAAVARMSVRSFSRAFAKEAGLTPAEFVQRARVDAARCLLENGDAPIKTIAYECGFGDAHRMRNAFLRSVGVSPQHYRLSFNQQGR
>NZ_CP016170.1|WP_066346015.1|1516828_1517365_+|carboxymuconolactone-decarboxylase-family-protein
MARLHTIALSEASGRAAELFATVKSAAGKVPNSYLGIGGNSPVALEAVLGLEAALKKSSLSPMDIEIVKLVVSRATGCDYCLAAHTLLGKKLGLSREAILAVRDARPSGDPRNDALATFTHHVITSRGIVAAEVLAAVKAAGVTDSQIVDAMLAIASITLTNLFNRVNDTVLDFPAAD
>NZ_CP016170.1|WP_066346009.1|1514083_1515541_-|cardiolipin-synthase
MRELHQILEAYWPHIVFTVSLVAGAGAAVHAAMTKNDVRAAIGWVGITLFSPLLGAAAYFVAGVNRIRITRVSQLRDDAMVAYAREPAAAEPDVVPLSAPQFASLKTLADKVSHFQLLGGNSVQLLDGGDEAYPAMLQAIRQARYTVALQSYIFDNDPIGREMAQALIEARARGVQVRVLIDAVGSHYSRPPIIGTLKKGGVRTARFMTNPLGVLRMPYANLRSHRKILVVDGRVGFSGGMNIRAAFVSALARENTNRDTHFRFEGPVVTQLLSVFAHDWDFTTGESLAGSLWFNHAASAMAGNVAVRCVPSGPDRSLGSTHNMLLGALAVAQKHVRIQSPYFLPDQTLIGALATAARRGVRVDIVIPGKNNLRLVDYAMTAQLDQVIRWGCRVWRTTGMFDHSKLMTVDDAWSYAGSSNLDPRSLRLNFELDTEIYDRATAQAIGRRIDATIASAVPQTLDLLRGAPFLKRLRNKVIWLATPYL
>NZ_CP016170.1|WP_066346006.1|1513486_1514065_+|ANTAR-domain-containing-protein
MLRVMLIRDGEGRVAELRNTLEQGGVQIVAEVLPAADLSALIARHAPDVVLIDTDAPSRDTLEGVCVASAHGDRPVVMFTESNDRQTMRAALQAGVAAYVVGEVPASRIRSLLDVAIERYAVDRARREELTEARQRLAERQWVEKAKGLLMSLRGVSEEEAYRMLREHAMKSQRRIGEVARAMVEAAGWLKS
>NZ_CP016170.1|WP_066346000.1|1511685_1512984_-|ABC-transporter-substrate-binding-protein
MKLKTFPQHPTHAVAAAPADLQRRRVMRWATRTLAGASILGMVDPRVRAGAWAAGTDAPEKTEVKIGFIPLTDCSSVVMASVLGLDQKHGVKIVLSKEASWAGVRDKLINGELDAAHVLYGLVYGVHLGVGGPKKDMAVLMGLNQNGQAISLSQQLKDAGVTDGASLARVMAEKKREYTFAQTFPTGTHAMWLYYWLAASGINPMRDAKVITVPPPQMVANMRIGNMDGFCVGEPWNARAILDKVGFTAVTTQQIWQDHPEKVLGTSAEFVSRYPNTARAVTAAVLEASKWIDASPENRRKTAETVAAKSYVNTDVSVIVDRMLGRYDNGLGKTWDDAHPMRFYGDGAVNFPYLSDGMWFLTQHKRWGLLKDHPDYLAVARQINRIDVYKQAAAAVGAPLPAREMRASTLIDGVAWDGSNPAAYADGFKIKA
>NZ_CP016170.1|WP_066345997.1|1510850_1511714_-|nitrate-ABC-transporter-permease
MRTASRSKPEDTAMDRSLPLSGARPSWPWRDYVDGALRAVVGPAAGFALFVLVWQTIALLVPAIPTPAKTWDAAVVLFAHPFYDNGPNDRGIGWNVLASLLRVAGGFGLAALVGIPLGFAIGRFKALNALASPIISLLRPVSPLAWLPLGLLLFKAANPAAIWTIFICSIWPMILNTAAGVQRVPQDYLNVARVLDLSEWKVLTRVLLPAALPHVLTGVRLSIGTAWLVIVAAEMLTGGTGIGFWLWDEWNNLKVEHIVIAIFVIGIVGLTLDVLLMQLAKRFTYEE
>NZ_CP016170.1|WP_066346031.1|1524603_1526586_+|S9-family-peptidase
MQKAFEVHDICLYRTITDLDCVRSTEIAACSVEAADEENDGTRTQIWLVPLDGGDPRQLTFGQSDSSPRWSPDGSRLAFLSNRGHGQQVYLIDPHGGEAMQLSRTASGVSSLEWAPDGRSLVVCCTLTVDPEIRGDHGKEQDTARGPDAPRVCWRLPYKLDGVGYTLDSEIHAYLLDAQTGEHKPLTEGAYQVNSIRFSPDSRRIAYTRPREGRLAHRTDMWLMNADGSGQRQATSDLASVSYPKWSPDGRYIALTGSLQDGDAQMRLWIYDVERGCVEALGPDWIEVVSGQSVHWSLDGTSLVALLARNGRQEVVSVSVPDGRVATILGCDRHIARVACTARHLACVSQDAACPGEIWRADRDGLKETRVSDFNAWWSERLPPRVEMRRFIVPDGDRGTEEIDGWLLRPVDAKGPTPLLVDAHGGPASYALLDFNMHAYWYVLISRGWSVLALKPVGSSSYGRPFSSRLRENWGRYDLDQHLAAVETLRKEGIADERLAIAGKSYGGFLSAWAICNSTAFRAAVVCAPVTSLENHFGSSDSGYYADTYSMYGDAAVKRDAMRELSPMDYVENIRTPTLILQGEADDRCPKCQAEELFVGIMASTWTPAEMVLYPEATHHFLESGKPSRRMDAVTRLVGWVEKWIDVDVQPRKREEAPRS
>NZ_CP016170.1|WP_082993541.1|1526625_1527822_-|chemotaxis-protein-CheB
MRNPEPRPEQGSPLRRGSGMLEPAAAFFYVRVERRLGSGRPAQQLLPILIRARDRVMHNDYDGVPAPKDDAMSSYLTDRCIAIGASWGGVTAILRLVAELPADIPVPVFIVQHIGAHASQLDALIDRQGPNPAKFPAHGERIQAGTIYVAPPDRHMLVDKDTIMLDPGPKENHARPSIDPLFRSVALAYRERAAGVILTGMLDDGTAGLKAIKDCGGIAVVQDPADAEQADMPRSAIANVEVDHIVPLAGMGALLGTLAQSRPGGQTVNVPDHVRREHAMTLGQSIIENLTTIAHPSALTCPDCGGALFELNDTRPMRYRCHMGHAFTLESLANVQADTAEVFLWAALRSLTEKSLIIRRMAEALPHGDTAQAEQALREADRLSAVCEQLRGLVQKST
>NZ_CP016170.1|WP_066346037.1|1527796_1528687_-|manganese-catalase-family-protein
MFAHNKRLQYTVRVQSSNPGLANLLLEQFGGPQGELAAAMRYFTQYVAEEDPGRKDMLIDIATEELSHLEVIGTLVAMLNKGAKGQLAEAVDTEAELYRAVSGPGNDSHVTQVLYGGGPALINSGGQLWNAGYIDSIGDPSCDLRSNIAAEARAKIIYERLINVTDDPGVKDALTFLMTREVSHQRSFEKALYSMQPNFPPGKLPPDPRFANTYFNMSEGEGDTRGPWNSDENFEFVASASEAGPQDGDGMATVQLDADETTAVQGLMARTASDPQSNPRTGAELGAGNAEPGTTT
>NZ_CP016170.1|WP_066346041.1|1528761_1529316_-|ferritin-like-domain-containing-protein
MESTASTASTAATIDPDVLESHFMDWLRDAHAMEQQAETMLTAMAKRIESYPDLKLRIEKHIEETRNQAQLIAQCIERRGGDTSALKDLAGKAMAGMQGAAGMFASDEIVKGGMMSYAFEHFEIASYRNLIEAARMVGDRETMAICERILPEEQAMADWLAHNLAGVSRRFLELAQTPGAKAKV
>NZ_CP016170.1|WP_066346044.1|1529740_1530532_+|gluconate-2-dehydrogenase-subunit-3-family-protein
MIPSRRNFLKRAGLAAATVSAAPAVATAQTADDKAAAYIFLTPEEAAFVQAAVARLIPQDEAGPGALEAGVPNYIDKQLGGAWGAGERLYRGGPWKQGEPTQGYQLPFTPAELFRNACRALREELGKSGTPFDKRAPAEQDAFLRELQQSKRDLNGVPANVFFESLWGLTVEGFLSDPVYGGNKDMVSWKMIGFPGAHATYYHLVDQHGIAFNRAPMSLAEDNRGVIHIHPEVPASVGNAPTGNGTTPETMPGHAAGQSHGGR
>NZ_CP016170.1|WP_066358332.1|1530533_1532303_+|GMC-family-oxidoreductase
MATKLPETDAVLIGVGLVGTMLGRELTRAGLHVVGLERGEPRFTVPDFQGPYMHDELRYSVRKALMQDNTKEAVTFRNNSRQEALPIRRWESFLPGTGLGGAAVHWNGQTYRFQDTDFRMRSLTRERYGDKFMAEDLLVQDWGVDAATMEPYFDRFEYLLGVSGKAGNLKSGKVEGGNPFEDPRARDYPTPPMKEPYGSAMFRKAAAGLGLHPYPQPSANLSQPYTNPEGMTLNTCMFCGFCERYGCEHYAKSSPQTILLPVLLKDKNFELRTQCQVLRINVDSDGKRATGVTYVDAAGREFEQPANLVILGGFALNNVRMLLLSKIGQPYDPESGKGVVGRGYAYQTMSAVQVFYDASVNINPFMRSGACGTVVSDFVSDNFDHGPHGFVGGAYIGEIMTNGRPIEFHPTPVGTPPWGSEWKKAVIRHYNHTSVLNVHGSSVSCRANYLDLDPTYRDAWGLPLLRMTFDFHENDVKMSSFLTDRALEIGRAMGGKQVHGASRKGPYTVTQYQTTHNTGGTVMGDDRSTSVVNRYLQSWDLHNLFVIGASNFPQNASYNPTGTVGALAYWAADAIVSRYLKSPAPLVQA
>NZ_CP016170.1|WP_066346051.1|1533385_1534258_-|MBL-fold-metallo-hydrolase
MRIHHLNCISSCPLGGHLMDGRSDCLLCRGTLCCHCILIETPADGLVLIDTGFGLRDVRAPRTRLSAFFLALLKPDFKESMTAVRQIERLGYQARDVRHIVLTHLDFDHAGGLDDFPDASVHLSRPEREAAARQSTWLDRQRYRPQQWSSRRRWKEYAPTGDDWFGFQGTRPIEALHGEVALVPLHGHTLGHAGVAVRRGDGWLLQAGDAYFYHQELDHDRPRCTPGLRLYQWMMEKDRGARLHNQARLRELRHRHGGQIAVCCSHDPHEFDALRAGADAAGPLAQPAAG
>NZ_CP016170.1|WP_066346054.1|1534357_1534555_-|DUF3606-domain-containing-protein
MSDNLNDRGPRDRSRIALDEEWELRYWSKEFGCTPDELREAVKAAGSNAVDKVRAQLKAPARTAG
>NZ_CP016170.1|WP_156770169.1|1534621_1536907_-|c-type-cytochrome
MSPACLAVLAACFPLGAHAHVASADAAGLPDLQPVLEPWVVGTLLLSLFLYVAGYLRLRRHAAAGPDDEADAGVGASGNGASAPGASAPGASSDGASGDGARTRQRQLLAFLAGWATLCIALVSPLDALGPVLFSAHMVQHEMLMIVAAPLLVVSRPLAVWLWAFPRRWRRPIARAWRWRPLLRAWTLLTGALAAWMLHAAALWLWHVPRFFQAALADPTVHAWQHASFLASALLFWWPIFGASRRTAPGGYAMVSLFTTMVHTGALGALLTLAPGLWYPAYAEPAAALGVDALRDQQLGGLVMWVPGGLAYLIGGLYVGWRWLARPALSVSVMVLLAVPASMLPTRPAHAAGDDASSADAMLTARGRYVASAGDCFGCHTNPKGGAPYAGGRELWSPFGTIVSTNITPDPRHGIGGYTYEEFARALRRGVARGGKPLYPAMPYASFARMTEDDLRALYAYMMHDVPAVDQSPPPTDLPFPFNQRWMLRGWQALFVPDEVYQPRPGRDAQWNRGAYLVQTLGHCGACHTPRGPAFQERGDDETSRHFLTGGVNDHWFAPNLNSGMGSGLGRMSVDELATFMKTGHANGNMAYGSMVETVETSLQHLTDEDLRAIAVYLKSLPPNADSGRYREDRAAAAEATPEQGNRTLDVESVGAAVYKNFCAQCHQANGMGIPGVYPRLAGNPSVLAQDKTSLMRIVMEGGRSAQTAHGPAPQHMPPFDTVLTEAQIAQVITYIRSSWGNDAPPASGAEVAQLRQALKK
>NZ_CP016170.1|WP_066346057.1|1536971_1537601_-|cytochrome-C-oxidase-subunit-III
MTHRHGEEVAVAAGTVIDVSGLPTYGFGHRSLMWWGTMGLMLIEGTVFAIGVMSYFYLRGLAPQWPIAADPPALAWGTANTVLLLASLWPNHLAKRAAERQQRARAALWVVVCVVLAAVFLALRALEFTALNVSWNENAYGALVWFLLGLHTTHLITDTVDTAVLAALLFTQRFDGRRYVDVSENAMYWYFVVFSWVPIYAVIYLAPRF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP016170_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016170_3

3127550-3127679

Orphan

Consensus_repeat	Method
ACGAACTGGCTTCCGCAGCTCGCGAATGCTGCCGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP016170_3

>merge|NZ_CP016170|3|3127550-3127679|CRISPRCasFinder
ACGAACTGGCTTCCGCAGCTCGCGAATGCTGCCGGCAGCGGTGGTGTCTGCATCGATGGGCATGCAATGGCGCGCTTCATGCGACGGGAATCTCACGAACCGGCTTCCGCAGCTCGCGAATGCTGCCGGC

>NZ_CP016170|3|3|3127550-3127679|CRISPRCasFinder
ACGAACTGGCTTCCGCAGCTCGCGAATGCTGCCGGC	AGCGGTGGTGTCTGCATCGATGGGCATGCAATGGCGCGCTTCATGCGACGGGAATCTC
ACGAACCGGCTTCCGCAGCTCGCGAATGCTGCCGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016170.1\|WP_066350015.1\|3126083_3127043_+\|glyoxylate/hydroxypyruvate-reductase-A	unknown	unknown	gnl\|CDD\|240641
NZ_CP016170.1\|WP_066350010.1\|3124917_3125538_+\|glutathione-S-transferase-family-protein	unknown	unknown	gnl\|CDD\|198314
NZ_CP016170.1\|WP_066349992.1\|3117844_3119197_-\|DUF3300-domain-containing-protein	unknown	unknown	gnl\|CDD\|378701
NZ_CP016170.1\|WP_066350041.1\|3131418_3131832_+\|RidA-family-protein	unknown	unknown	gnl\|CDD\|223329
NZ_CP016170.1\|WP_066359050.1\|3122623_3123745_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226361
NZ_CP016170.1\|WP_082993874.1\|3120446_3121058_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP016170.1\|WP_156770395.1\|3123913_3124891_+\|zinc-binding-dehydrogenase	unknown	unknown	gnl\|CDD\|176180
NZ_CP016170.1\|WP_066350054.1\|3136693_3137587_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176113
NZ_CP016170.1\|WP_066350052.1\|3135331_3136642_+\|type-II-toxin-antitoxin-system-HipA-family-toxin	unknown	unknown	gnl\|CDD\|377920
NZ_CP016170.1\|WP_066350044.1\|3133639_3134818_+\|acetylornithine-deacetylase	unknown	unknown	gnl\|CDD\|236039
NZ_CP016170.1\|WP_066350029.1\|3130068_3131094_-\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|270307
NZ_CP016170.1\|WP_066349997.1\|3121072_3122323_-\|SidA/IucD/PvdA-family-monooxygenase	unknown	unknown	gnl\|CDD\|274942
NZ_CP016170.1\|WP_066349993.1\|3119420_3120413_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP016170.1\|WP_066350027.1\|3129115_3129970_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224097
NZ_CP016170.1\|WP_066350043.1\|3132618_3133596_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176104
NZ_CP016170.1\|WP_066350017.1\|3128292_3129114_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224098
NZ_CP016170.1\|WP_066350042.1\|3131853_3132525_+\|DUF1028-domain-containing-protein	unknown	unknown	gnl\|CDD\|377639
NZ_CP016170.1\|WP_066350013.1\|3125592_3126072_+\|3-dehydroquinate-dehydratase	unknown	unknown	gnl\|CDD\|238262
NZ_CP016170.1\|WP_066349991.1\|3116906_3117833_-\|DUF2950-domain-containing-protein	unknown	unknown	gnl\|CDD\|371539
NZ_CP016170.1\|WP_066350050.1\|3134979_3135324_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045

Protein	Function_ID	Function_description	E-value
NZ_CP016170.1\|WP_066350015.1\|3126083_3127043_+\|glyoxylate/hydroxypyruvate-reductase-A	gnl\|CDD\|240641	cd12164, GDH_like_2, Putative glycerate dehydrogenase and related proteins of the D-specific 2-hydroxy dehydrogenase family. This group contains a variety of proteins variously identified as glycerate dehydrogenase (GDH, also known as hydroxypyruvate reductase) and other enzymes of the 2-hydroxyacid dehydrogenase family. GDH catalyzes the reversible reaction of (R)-glycerate + NAD+ to hydroxypyruvate + NADH + H+. 2-hydroxyacid dehydrogenases catalyze the conversion of a wide variety of D-2-hydroxy acids to their corresponding keto acids. The general mechanism is (R)-lactate + acceptor to pyruvate + reduced acceptor. Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily include groups such as formate dehydrogenase, glycerate dehydrogenase, L-alanine dehydrogenase, and S-adenosylhomocysteine hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann-fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. While many members of this family are dimeric, alanine DH is hexameric and phosphoglycerate DH is tetrameric.	3.13451e-141
NZ_CP016170.1\|WP_066350010.1\|3124917_3125538_+\|glutathione-S-transferase-family-protein	gnl\|CDD\|198314	cd03205, GST_C_6, C-terminal, alpha helical domain of an unknown subfamily 6 of Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs, including Pseudomonas fluorescens GST with a known three-dimensional structure. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. Though the three-dimensional structure of Pseudomonas fluorescens GST has been determined, there is no information on its functional characterization.	1.43431e-39
NZ_CP016170.1\|WP_066349992.1\|3117844_3119197_-\|DUF3300-domain-containing-protein	gnl\|CDD\|378701	pfam11737, DUF3300, Protein of unknown function (DUF3300). This hypothetical bacterial gene product has a long hydrophobic segment and is thus likely to be a membrane protein.	8.37584e-121
NZ_CP016170.1\|WP_066350041.1\|3131418_3131832_+\|RidA-family-protein	gnl\|CDD\|223329	COG0251, TdcF, Putative translation initiation inhibitor, yjgF family [Translation, ribosomal structure and biogenesis].	2.78442e-28
NZ_CP016170.1\|WP_066359050.1\|3122623_3123745_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	5.27994e-153
NZ_CP016170.1\|WP_082993874.1\|3120446_3121058_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	6.4463e-18
NZ_CP016170.1\|WP_156770395.1\|3123913_3124891_+\|zinc-binding-dehydrogenase	gnl\|CDD\|176180	cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase. PIG3 p53-inducible quinone oxidoreductase, a medium chain dehydrogenase/reductase family member, acts in the apoptotic pathway. PIG3 reduces ortho-quinones, but its apoptotic activity has been attributed to oxidative stress generation, since overexpression of PIG3 accumulates reactive oxygen species. PIG3 resembles the MDR family member quinone reductases, which catalyze the reduction of quinone to hydroxyquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	5.64569e-158
NZ_CP016170.1\|WP_066350054.1\|3136693_3137587_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176113	cd08421, PBP2_LTTR_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to a name a few. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.10099e-54
NZ_CP016170.1\|WP_066350052.1\|3135331_3136642_+\|type-II-toxin-antitoxin-system-HipA-family-toxin	gnl\|CDD\|377920	pfam07804, HipA_C, HipA-like C-terminal domain. The members of this family are similar to a region close to the C-terminus of the HipA protein expressed by various bacterial species. This protein is known to be involved in high-frequency persistence to the lethal effects of inhibition of either DNA or peptidoglycan synthesis. When expressed alone, it is toxic to bacterial cells, but it is usually tightly associated with HipB, and the HipA-HipB complex may be involved in autoregulation of the hip operon. The hip proteins may be involved in cell division control and may interact with cell division genes or their products.	1.63137e-45
NZ_CP016170.1\|WP_066350044.1\|3133639_3134818_+\|acetylornithine-deacetylase	gnl\|CDD\|236039	PRK07522, PRK07522, acetylornithine deacetylase; Provisional.	0
NZ_CP016170.1\|WP_066350029.1\|3130068_3131094_-\|extracellular-solute-binding-protein	gnl\|CDD\|270307	cd13589, PBP2_polyamine_RpCGA009, The periplasmic-binding component of an uncharacterized ABC transport system from Rhodopseudomonas palustris CGA009 and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic binding domain that serves as the primary high-affinity receptor of an uncharacterized ABC-type polyamine transporter from Rhodopseudomonas palustris Cga009 and related proteins from other bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	6.59608e-75
NZ_CP016170.1\|WP_066349997.1\|3121072_3122323_-\|SidA/IucD/PvdA-family-monooxygenase	gnl\|CDD\|274942	TIGR04046, predicted_flavoprotein_involved_in_K+_transport, flavin-dependent oxidoreductase, MSMEG_0569 family. Members of this protein family belong to a conserved seven-gene biosynthetic cluster found sparsely in Cyanobacteria, Proteobacteria, and Actinobacteria. Distant homologies to characterized proteins suggest that members are enzymes dependent on a flavinoid cofactor.	1.27586e-115
NZ_CP016170.1\|WP_066349993.1\|3119420_3120413_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	6.25645e-136
NZ_CP016170.1\|WP_066350027.1\|3129115_3129970_-\|ABC-transporter-permease	gnl\|CDD\|224097	COG1176, PotB, ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism].	5.26885e-58
NZ_CP016170.1\|WP_066350043.1\|3132618_3133596_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176104	cd08412, PBP2_PAO1_like, The C-terminal substrate-binding domain of putative LysR-type transcriptional regulator PAO1-like, a member of the type 2 periplasmic binding fold protein superfamily. This family includes the C-terminal substrate domain of a putative LysR-type transcriptional regulator from the plant pathogen Pseudomonas aeruginosa PAO1and its closely related homologs. The LysR-type transcriptional regulators (LTTRs) are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of N2 fixing bacteria, and synthesis of virulence factors, to a name a few. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	4.28946e-87
NZ_CP016170.1\|WP_066350017.1\|3128292_3129114_-\|ABC-transporter-permease	gnl\|CDD\|224098	COG1177, PotC, ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism].	5.73884e-62
NZ_CP016170.1\|WP_066350042.1\|3131853_3132525_+\|DUF1028-domain-containing-protein	gnl\|CDD\|377639	pfam06267, DUF1028, Family of unknown function (DUF1028). Family of bacterial and archaeal proteins with unknown function. Some members are associated with a C-terminal peptidoglycan binding domain. So perhaps this could be an enzyme involved in peptidoglycan metabolism.	1.75626e-79
NZ_CP016170.1\|WP_066350013.1\|3125592_3126072_+\|3-dehydroquinate-dehydratase	gnl\|CDD\|238262	cd00466, DHQase_II, Dehydroquinase (DHQase), type II. Dehydroquinase (or 3-dehydroquinate dehydratase) catalyzes the reversible dehydration of 3-dehydroquinate to form 3-dehydroshikimate. This reaction is part of two metabolic pathways: the biosynthetic shikimate pathway and the catabolic quinate pathway. There are two types of DHQases, which are distinct from each other in amino acid sequence and three-dimensional structure. Type I enzymes usually catalyze the biosynthetic reaction using a syn elimination mechanism. In contrast, type II enzymes, found in the quinate pathway of fungi and in the shikimate pathway of many bacteria, are dodecameric enzymes that employ an anti elimination reaction mechanism.	1.03312e-75
NZ_CP016170.1\|WP_066349991.1\|3116906_3117833_-\|DUF2950-domain-containing-protein	gnl\|CDD\|371539	pfam11453, DUF2950, Protein of unknown function (DUF2950). This is a bacterial family of uncharacterized proteins.	3.89086e-143
NZ_CP016170.1\|WP_066350050.1\|3134979_3135324_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	8.21306e-07

>NZ_CP016170.1|WP_066350015.1|3126083_3127043_+|glyoxylate/hydroxypyruvate-reductase-A
MPVSSNGQSLGSLVFYSEFDDFNVWKAALQAQLPGLRILHAGEATDPAGIHYALAWKAPEGFFDNMSRLRLIINLGAGVDSLVGRTDLPAGVPITRISDPDMGRMMASYVLFATLRYARDIPWFERAQRRAQWAYRHPRSPEDIRVGVLGLGELGAYAARELRRQGLTVLGWSRSRREIDGIQCYSGMESLNTVLSQVEILVVMLPLTAETRGLLDRQRLLALPRGAALINVARGALVDQVAMTELLQSGHLGGATLDVFDREPLPADDPLWKMDNVLITPHLASVAIPASAARQVAENILRVASGEQPVNRVDPSRGY
>NZ_CP016170.1|WP_066350013.1|3125592_3126072_+|3-dehydroquinate-dehydratase
MNTPTAPATAANTAKVWFLNGPNANLYGLDANKTYGSESFPVLRQRCEAKAARLGIALNFVQSNHEGQLIDWIQEARGASQGIIINAAGLTYTSIPLLDALLSFPGRIIEVHMSNIWKREPFRHHSYISKAADGVIAGLGGDGYELAIEAMSRLIGKTA
>NZ_CP016170.1|WP_066350010.1|3124917_3125538_+|glutathione-S-transferase-family-protein
MPRLLYAPTSPYVRKVMVCAHLCGMADRIVLLDSAAHPIRRDPRIAAHNPLAKVPTLILDDGQSLYDSRVICEYIASLAANQDLFPPAGPGRWRALTGQALGDGLLDAALLARYETTARPAESQWPEWRAAQLVKVAASLDEIEAHAPAAAASGPSIGEVTIGCALGYLDFRFPELDWRASHPGAASWFQVFNAQPAMQATLPRDA
>NZ_CP016170.1|WP_156770395.1|3123913_3124891_+|zinc-binding-dehydrogenase
MQAIVATRPGDAGVLALAERPVPAPGPGEVLLRVHAAGVNRPDIMQRQGLSKPAEGVTDVLGLEACGTVVAAGPGVPAALEGRRLMSLLPGGGYAPWCVARVDHALPVPDDLDDAAAGALPEGLFTVWHNLFELGRLRMGETVLIHGAAGGIGTLAVRMAHAAGARVIATAGRADRLPALREMGAAHALSYRETDFVAACHDLTQGRGVDVVLDMVGGDYVRRNLQALGFGGRHISLSFLQGSSVNIELLTLMQKQLSLHSSTLRPQTAAEKTRMASEIARHILPLVADGRIRPTIHATLPLAEAARSHRLLEDGEVFGKLVLLP
>NZ_CP016170.1|WP_066359050.1|3122623_3123745_+|ABC-transporter-ATP-binding-protein
MQNSPSSLEPSCAVSLEGVVKKYREQTVLQDISLKIRRGEFLTLLGPSGCGKTTLLNLIAGFAEADNGEIFIDDQLVTDLPPYQREIGIVFQNYALFPHMTVERNIGYGLRMRRVPPAEIARRVAEAMAMVKLDGLGQRKPRELSGGQQQRVALARALVIRPKVLLLDEPFSALDKSLRGAMQVEIRDIQRRLGVTTVFVTHDQGEALSMSDRIAVMSAGAIRQIASPGELYRNPQDPFVASFLGDVNILPAHYHGSDPDGIQLRLGAGLIRVPRERLVGGSHEGRRLDVYVRPEQIALENLHGGSVLSGTVVNHVFQGDHIDSYIDVDIPVAGRQRVMVRSAGLDAMQQWPVGAVTGLVLPDQGISVFNAPA
>NZ_CP016170.1|WP_066349997.1|3121072_3122323_-|SidA/IucD/PvdA-family-monooxygenase
MSVEKTNTLVIGAGQAGIAMSEHLGRMGIPHLVLERKRIAERWRSERWDSLVANGPAWHDRFPGLKFDDVGADVFPPKERMARYFEDYARMIQAPVRTGVEVLEVARNEKRPGFTVKTTQGAIEALHVVAATGAFQIPSYPAIVPADAGIQQVHSSAYKNPGQLADGAVLVVGAGASGSQIAEELRNAGRKVYLSVGEHYRPPRSYRQRDYCWWLGALGMWDEVKKKPKREHVAFAVSGYEGGKTMDFRRLAHTGITLVGITQAYENGSLTFQEGLAENVAQGDADYFEVLREADAYIEQNGLDLPPEPEAWKLLDDPECLTHPILRLDLAEAGIRSIVWATGFKVDYSWMKIDTFDEKGYPVHKRGISAEKGIYFLGLPNQTNRSSSFIWGVWHDAKYIADHIGIHMDYLAYEKA
>NZ_CP016170.1|WP_082993874.1|3120446_3121058_+|class-I-SAM-dependent-methyltransferase
MNDFETLYRQSADPWQVRSSWYEQRKRAVLMASLPQPRYARILELGCGNGEMTRRLAARCDAMVAVDGAATAIALCQQALRQDGLRNVRTRVARLPDEWPVDEGATFDLIVVSELAYYIAGTDLPVFLARCRAMLAPGGEWAMCHYTRDLDGRPQPTPALHARIDALEGLCRVVHHQDERYLLDIWRRGRERPGARPEGLKPD
>NZ_CP016170.1|WP_066349993.1|3119420_3120413_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MNAYAKRALAAVGLAGALLIQAAPSLAQQAGDWPGKPVTIVIPYAPGGFADTRMRLIAAKLEPRLKQTVIVENRAGAGGVVGTNFIARAKPDGYTIGAGNLAPLSVNPTLMQSIPYDPAKDLAPVILIENSPLVLSVSNAVKASSLRELIALAKAEPGKLTFGSSGVGGAHHLSGEMFAEQAHIDITHVPYKGGNLASTDLMGGHITMMFEMGYAALPAIQGNKVRPIAVTAARRLAVLPDVPTMAEAGLPGYESYNWQGIVAPADTPRPIIDRLNKELNEILKDPEVAKAIADSGSQSAGGTPEEFAAFIESETAKWAQVIKEARIAPQ
>NZ_CP016170.1|WP_066349992.1|3117844_3119197_-|DUF3300-domain-containing-protein
MASWYGRGARILLLWLASLLALPAWPAADDTPALKPEEIEALVAPIALYPDPLLSQVLMASTYPLEVVHAARWSKANPAMRGDAAVKAVGDMSWDASVKSLVAFPQILEPMSDKLDWTQKLGDAFLAQPSDVFAAVQRLRGRAQAAGNLQSNAQQTVTVEPPAQGGQAPVVRIQPANPEVVYVPAYNPTVAYGTWSYPAYPPTYWPPSPAYYPGTALVTGFAWGVGLAAAGALFSDCDWGGGDVDIDYNKVKNVERNFDRTQVQGQGGRWQHDPSHRQGVAYRDGATRQQYARAVPGADKRADYRGREPAGAAGQGPAGTAGPRASADRPSGAPSAGRAAAADRASSAGRPSTADRAASTNRPSAANRAASTDRPVASNRGMSAASAGGNTGRTAGNTGRGASTAGRDSAFAGVGGGGAAAQRSYDRGRSSLQGSGFSRSAGGGGRGGRR
>NZ_CP016170.1|WP_066349991.1|3116906_3117833_-|DUF2950-domain-containing-protein
MDFHRFYRRVAPGCPWIRLLAVSWLALAAATAQAAKGFGSPEAAMDAFGDAVLRNDEPALREMFGKDFRDVIPSVDAKVRQTFDAEWNRSHTVARTGDARADIVVGDSGWTLPIPLVRNGQGWHFDMNAGAEEMRARRIGRNELAAIQTMLAIYDAQREYAQTDHDGQGMLTYAARIVSSPGKRDGLYWPTAPGEAPSPLGAAFADAGGRNAAGAGYHGYRYKLLDAQGAHAPGGAYSYIARGKLFGGFAVIAWPVLYGDTGIKSFMVSHAGQVYERDLGPDSAARAEQVRSFDPGPGWSKVSADDSD
>NZ_CP016170.1|WP_066350017.1|3128292_3129114_-|ABC-transporter-permease
MTIRNSVPLWMRLGAPLLVALILAFILLPVVVVTLASFNDKALLTFPPQSWSWRWFERAFTYPDFQDGFRASLVVTLWASLLALAIGTALAIAVKRFDFPGKHALQAVLLSPLVIPHFTLGLGLLILVAQLNLDRGYAIVILCHVMLVLPFVLRSVYVSMENLDARLEQSAASLGASPLRVLFTITVPLLAPGLFGGWLFAAIMSFSEFTASLFVTTQSTQTLPVSMYNYVREFADPTLAALSVVYIAVTACLLAFANYFLGLGRILNIDESR
>NZ_CP016170.1|WP_066350027.1|3129115_3129970_-|ABC-transporter-permease
MNNRSGLRGWLVSPAGIIALFICAALITVFQFSLRAFIPGSMEVGGLTLANFSGLGKPIYRDAFANTLLLSVETTVFSLLVAYPLAYALVRVRHRLLKSFILIVSITPLFLGEIVRTYSWIIVLGNNGFINTMLRKAGLIDMPLNLMFSHLGVLVALVHVTIPVVVLMLATAISHIDRDYAKAAQSLGAGPVRTFLTVTLPLSMPGILASVTTSFAWTFSAFATPQMIGGGRVPTVSTLVYQLGFSSMNFPLAASLSVAGLALTVVSLMLLGRMTRRLKAIQVH
>NZ_CP016170.1|WP_066350029.1|3130068_3131094_-|extracellular-solute-binding-protein
MIRKLLSVGILASTLAASAAWAQDALVVSTWGGSFRDLIDENIGKEFTRQTGVPVKYITGGTIDRLNKAKLATKPESDITFTTSHIGWLYVNSNLYEKLDTSKLKNYSHLVDRARISPYHIGSWAYVYTIGYRPDLVPSDIKFDSWNDLWNPALKGKLSAPDFDPSHIITIAAMLSGGDATTWQKGEDKLKALKPNFKAFYTNDANSQQLIATGETPVQVLLSMNAYYMIGQGVPIKVAMPKEGAVLGVDTMAIMKGSSKVDLAYKFMDIALSPEVQAKIVAYKKASPVVDNAKVSPEDAALPGVFTTKEQWAKQAIVIDDKLRAEKTAEWRKWFTENIMN
>NZ_CP016170.1|WP_066350041.1|3131418_3131832_+|RidA-family-protein
MKHTRIRTFNTKATYPEQNLDNDLCQAVVARGSTVFLRGQIGQNLDTSESVCIGDAAGQAEQAMSNIAMLLKEAGGELEHICKITIYIIDPRYREAVYRVVGRWLKGVFPVSTGIVVSALARPEWLVEIDATAVIPD
>NZ_CP016170.1|WP_066350042.1|3131853_3132525_+|DUF1028-domain-containing-protein
MTFSIIARCPASGQFGAAVSSSSPAVASRCIRARAGVGAAVSQNITDPALGPAALDLMESGRTPHEALDALQQRPYIAYRQLMAIDAAHPPAIYTGGSCLGKISSHAGEHAACAGNMLASLEVPRIMLEAFERAQGSLAERLLQAMLAGQAAGGEEGPVHSAGVLVVSDLAWPIVDLRLDWVEDGPIEALYQAWKVYEPQVQDYITRARDPRAAPSFGVPGDP
>NZ_CP016170.1|WP_066350043.1|3132618_3133596_+|LysR-family-transcriptional-regulator
MLNRISLRQMEYFVATAKHGSIAAASAQIHISPPSISAAIAHIETELSVQLFVRHPSKGLALTILGAQVMQECEELLERASRLYEIASVSGDTIQGVLRVGCFQPLAAMIAPEVIYGFSRAFDKVELHMVEGDQQELIGKLHTLEIDLALTYDLQLGEEMNFEILAHLPPHVLVSELHPLAQQIAVTLDELAAQPMVLLDLPMSREYFMSLFAKAGLEPNVVARSRSEDVVRSMVANGIGYALFNVRPKSTQSLDGKRLVRLRLAGEHRPMLLGLATYKPLKPSRLAQAFMQRCRAYISDQYIPGMSAASFFDPYIPGEGEAPGR
>NZ_CP016170.1|WP_066350044.1|3133639_3134818_+|acetylornithine-deacetylase
MSRPTPSASLDLLRELIAFPSVTLTPNADLMDRVREVLGKAGIASTLVADPQDPSRCNLFATVGPADVPGVMLSGHTDVVPVKGQPWTSPPFEATERDGRIYGRGSADMKGFVACAVMAMIRAAGRPLRRPLQLALSFDEEIGCVGVRHLIRALADMRPAPALVIVGEPTLMKIGTGHKGKAAYRAICCGQAGHSGLAPRFVNAIHTAADLVAALRDVQRDLAERGPREDGYAIPYSTIHAGTIRGGTALNIVPQECEVNFEIRNVAQDEPAEILDRVLQAARARMQAAQALPEAGAPEIEVVNAYPGLSMDEDSAAVRLLASLLPPETPRTKVAFGTEGGLFRQQWTGTPVLVCGPGSIEVAHKADEYVEISQIQACDSMLERLADYLCAG
>NZ_CP016170.1|WP_066350050.1|3134979_3135324_+|helix-turn-helix-transcriptional-regulator
MKKKIAPTFDAAEALARLGQNLRTARLRRAETETALAERIGVSRSTIVRLEKGDGGISAALLVEALLQFGFGDQVFALADPEQDRVGQRLDEIRRPQRGSRRAPAAHRHDPAKL
>NZ_CP016170.1|WP_066350052.1|3135331_3136642_+|type-II-toxin-antitoxin-system-HipA-family-toxin
MKKRKDKTVESELFVYVDIQGEAVLCGILTLDDDGEDRFFAQFTYVASYVGDPRAFPLDPLNLPLIDARTTFSSTSRYETLGAIFDAAPDAWGRNVMRMDNAGARVTEDEVLLKGRGMGVGALFFSARLLTPNMRKVYRLPEIDEVDTLADLMADIDQGIKPKGLYRDLLGSSWDIGGARPKTIVRDAAGEMWIAKFPRRGESYDRQRVEYANLRMARDIGLTVPEIRLVETGLGAVLLTHRFDRELLPARDAHGPIVARRHFASGVALVSPSPQIGKRELDGPRGKATYSYARLADVVRRVSSNPVQDLKELYARMILNVAVHNTDDHLKNIGFLKDRDRHTYRLSPLFDVVTQEGSARHYLHVGAAGRESSFENCLSEYRRFGLRTEAAARSILDSVRAVVAQRRRYYEAAGMAPEDIERVEASLSAWRAGRGG
>NZ_CP016170.1|WP_066350054.1|3136693_3137587_+|LysR-family-transcriptional-regulator
MSGLDIPALKIFVAAVEEKSLSRAAERQSLVTSAASKRVAEMERHLNRVLLHRHGRGVEPTPAGMLLYHRAKAILRSLQLAEAAVEGYAVDGMAKIRLASVPSPILVMLPPQIGRYLRANPRISVDLLECYSNEIPRMVAEDRADIGIYHGRHPAPGVVSHPYIRDRVGLVVPLGHPLAERKAVHLEDAVDYDLVGYFPRHSFDQFLAYVDQSVSRPPNVRLQVSNFEARCRMVQEGLGLAVLPESIASKYLVDMGLAWLRLEDDWAERQFYICVRHVRDRDKAVDELVEVLREPAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP016170_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016170_4

5249591-5249701

Orphan

Consensus_repeat	Method
TCCCCCTTAAGGGGGCGACGCCTGCGGACCGGCGGAGCCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP016170_4

>merge|NZ_CP016170|4|5249591-5249701|CRISPRCasFinder
TCCCCCTTAAGGGGGCGACGCCTGCGGACCGGCGGAGCCGAGGGTGGGGCCCACCCCCAAGCGCTGCGCGCTCCCCCTCAAGGGGGCGACGCCTGCGGACCGGCGGAGCCG

>NZ_CP016170|4|4|5249591-5249701|CRISPRCasFinder
TCCCCCTTAAGGGGGCGACGCCTGCGGACCGGCGGAGCCG	AGGGTGGGGCCCACCCCCAAGCGCTGCGCGC
TCCCCCTCAAGGGGGCGACGCCTGCGGACCGGCGGAGCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016170.1\|WP_066356117.1\|5254698_5255469_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187602
NZ_CP016170.1\|WP_066356101.1\|5250517_5251774_+\|flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|236046
NZ_CP016170.1\|WP_066356107.1\|5251832_5252798_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP016170.1\|WP_066356127.1\|5256562_5257468_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|366166
NZ_CP016170.1\|WP_066356129.1\|5259185_5260397_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379114
NZ_CP016170.1\|WP_066356088.1\|5247410_5248331_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274127
NZ_CP016170.1\|WP_066356109.1\|5252864_5253503_+\|maleylacetoacetate-isomerase	unknown	unknown	gnl\|CDD\|273527
NZ_CP016170.1\|WP_066356083.1\|5246627_5247254_-\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_CP016170.1\|WP_066356092.1\|5248498_5249548_+\|gentisate-1,2-dioxygenase	unknown	unknown	gnl\|CDD\|131325
NZ_CP016170.1\|WP_066356070.1\|5240086_5240983_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176113
NZ_CP016170.1\|WP_066356094.1\|5249815_5250514_+\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223257
NZ_CP016170.1\|WP_066356069.1\|5238397_5239948_+\|glycerol-kinase-GlpK	unknown	unknown	gnl\|CDD\|198361
NZ_CP016170.1\|WP_066356114.1\|5253638_5254646_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP016170.1\|WP_066356079.1\|5245603_5246596_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
NZ_CP016170.1\|WP_156770430.1\|5242661_5244107_+\|LuxR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225116
NZ_CP016170.1\|WP_066356071.1\|5240979_5241306_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016170.1\|WP_066356078.1\|5244237_5245431_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110
NZ_CP016170.1\|WP_066356128.1\|5257843_5258470_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227803
NZ_CP016170.1\|WP_066356124.1\|5255498_5256473_-\|zinc-binding-dehydrogenase	unknown	unknown	gnl\|CDD\|176205
NZ_CP016170.1\|WP_066359620.1\|5241580_5242360_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|378924

Protein	Function_ID	Function_description	E-value
NZ_CP016170.1\|WP_066356117.1\|5254698_5255469_-\|SDR-family-oxidoreductase	gnl\|CDD\|187602	cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR. This subgroup resembles the SDR family, but does not have a perfect match to the NAD-binding motif or the catalytic tetrad characteristic of the SDRs. It includes the SDRs, Q9HYA2 from Pseudomonas aeruginosa PAO1 and APE0912 from Aeropyrum pernix K1. BKR catalyzes the NADPH-dependent reduction of ACP in the first reductive step of de novo fatty acid synthesis (FAS). FAS consists of four elongation steps, which are repeated to extend the fatty acid chain through the addition of two-carbo units from malonyl acyl-carrier protein (ACP): condensation, reduction, dehydration, and a final reduction. Type II FAS, typical of plants and many bacteria, maintains these activities on discrete polypeptides, while type I FAS utilizes one or two multifunctional polypeptides. BKR resembles enoyl reductase, which catalyzes the second reduction step in FAS. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	5.72044e-76
NZ_CP016170.1\|WP_066356101.1\|5250517_5251774_+\|flavin-dependent-oxidoreductase	gnl\|CDD\|236046	PRK07538, PRK07538, hypothetical protein; Provisional.	0
NZ_CP016170.1\|WP_066356107.1\|5251832_5252798_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	1.24185e-136
NZ_CP016170.1\|WP_066356127.1\|5256562_5257468_-\|alpha/beta-hydrolase	gnl\|CDD\|366166	pfam00561, Abhydrolase_1, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	6.92394e-35
NZ_CP016170.1\|WP_066356129.1\|5259185_5260397_-\|AAA-family-ATPase	gnl\|CDD\|379114	pfam13304, AAA_21, AAA domain, putative AbiEii toxin, Type IV TA system. Several members are annotated as being of the abortive phage resistance system, in which case the family would be acting as the toxin for a type IV toxin-antitoxin resistance system.	3.13732e-26
NZ_CP016170.1\|WP_066356088.1\|5247410_5248331_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|274127	TIGR02424, TF_pcaQ, pca operon transcription factor PcaQ. Members of this family are LysR-family transcription factors associated with operons for catabolism of protocatechuate. Members occur only in Proteobacteria. [Energy metabolism, Other, Regulatory functions, DNA interactions].	5.43312e-45
NZ_CP016170.1\|WP_066356109.1\|5252864_5253503_+\|maleylacetoacetate-isomerase	gnl\|CDD\|273527	TIGR01262, Maleylacetoacetate_isomerase, maleylacetoacetate isomerase. Maleylacetoacetate isomerase is an enzyme of tyrosine and phenylalanine catabolism. It requires glutathione and belongs by homology to the zeta family of glutathione S-transferases. The enzyme (EC 5.2.1.2) is described as active also on maleylpyruvate, and the example from a Ralstonia sp. catabolic plasmid is described as a maleylpyruvate isomerase involved in gentisate catabolism. [Energy metabolism, Amino acids and amines].	8.78018e-99
NZ_CP016170.1\|WP_066356083.1\|5246627_5247254_-\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	2.97196e-37
NZ_CP016170.1\|WP_066356092.1\|5248498_5249548_+\|gentisate-1,2-dioxygenase	gnl\|CDD\|131325	TIGR02272, gentisate_12-dioxygenase, gentisate 1,2-dioxygenase. This family consists of gentisate 1,2-dioxygenases. This ring-opening enzyme acts in salicylate degradation that goes via gentisate rather than via catechol. It converts gentisate to maleylpyruvate. Some putative gentisate 1,2-dioxygenases are excluded by a relatively high trusted cutoff score because they are too closely related to known examples of 1-hydroxy-2-naphthoate dioxygenase. Therefore some homologs may be bona fide gentisate 1,2-dioxygenases even if they score below the given cutoffs.	0
NZ_CP016170.1\|WP_066356070.1\|5240086_5240983_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176113	cd08421, PBP2_LTTR_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to a name a few. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	5.45026e-84
NZ_CP016170.1\|WP_066356094.1\|5249815_5250514_+\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|223257	COG0179, MhpD, 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism].	1.07292e-91
NZ_CP016170.1\|WP_066356069.1\|5238397_5239948_+\|glycerol-kinase-GlpK	gnl\|CDD\|198361	cd07786, FGGY_EcGK_like, Escherichia coli glycerol kinase-like proteins; belongs to the FGGY family of carbohydrate kinases. This subgroup is composed of mostly bacterial and archaeal glycerol kinases (GK), including the well characterized proteins from Escherichia coli (EcGK), Thermococcus kodakaraensis (TkGK), and Enterococcus casseliflavus (EnGK). GKs contain two large domains separated by a deep cleft that forms the active site. This model includes both the N-terminal domain, which adopts a ribonuclease H-like fold, and the structurally related C-terminal domain. The high affinity ATP binding site of EcGK is created only by a substrate-induced conformational change, which is initiated by protein-protein interactions through complex formation with enzyme IIAGlc (also known as IIIGlc), the glucose-specific phosphocarrier protein of the phosphotransferase system (PTS). EcGK exists in a dimer-tetramer equilibrium. IIAGlc binds to both EcGK dimer and tetramer, and inhibits the uptake and subsequent metabolism of glycerol and maltose. Another well-known allosteric regulator of EcGK is fructose 1,6-bisphosphate (FBP), which binds to the EcGK tetramer and plays an essential role in the stabilization of the inactive tetrameric form. EcGK requires Mg2+ for its enzymatic activity. Members in this subgroup belong to the FGGY family of carbohydrate kinases.	0
NZ_CP016170.1\|WP_066356114.1\|5253638_5254646_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	1.82781e-142
NZ_CP016170.1\|WP_156770430.1\|5242661_5244107_+\|LuxR-family-transcriptional-regulator	gnl\|CDD\|225116	COG2206, COG2206, c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms].	1.68679e-25
NZ_CP016170.1\|WP_066356079.1\|5245603_5246596_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	2.68891e-136
NZ_CP016170.1\|WP_066356078.1\|5244237_5245431_+\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	1.72335e-145
NZ_CP016170.1\|WP_066356128.1\|5257843_5258470_+\|hypothetical-protein	gnl\|CDD\|227803	COG5516, COG5516, Conserved protein containing a Zn-ribbon-like motif, possibly RNA-binding [General function prediction only].	9.24067e-23
NZ_CP016170.1\|WP_066356124.1\|5255498_5256473_-\|zinc-binding-dehydrogenase	gnl\|CDD\|176205	cd08243, quinone_oxidoreductase_like_1, Quinone oxidoreductase (QOR). NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.	1.58667e-162
NZ_CP016170.1\|WP_066359620.1\|5241580_5242360_-\|alpha/beta-hydrolase	gnl\|CDD\|378924	pfam12697, Abhydrolase_6, Alpha/beta hydrolase family. This family contains alpha/beta hydrolase enzymes of diverse specificity.	7.01974e-16

>NZ_CP016170.1|WP_066356092.1|5248498_5249548_+|gentisate-1,2-dioxygenase
MAEGITPRADRAAYYERIARKNMAPLWESLHNLVPRTPQPRCVPAMWRYNEVRADVMEAGTLISAEEAVRRVLILENPGLPGQASITQTLYAGLQLILPGEIAPSHRHTQSALRFIVEGSGAYTAVNGERTTMHPGDFIITPSWTFHDHGNIEAAEGGEPVVWLDGLDIPLLRMLDAGFAENYPASTQPVTRPEGDSFARFGHNMAPVRHVPANGNSPIFNYPYERSREALDQLYRHGELDAWDGVKLRYVNPATGGYPMPTMATFMQLLPAGFQGKTYRSTDSTVYSVVEGRGTARVGDQEFHFGPRDVFVAPSWQPVQLAAMEDAILFSYSDRPVQAALGLLREERV
>NZ_CP016170.1|WP_066356088.1|5247410_5248331_-|LysR-family-transcriptional-regulator
MDWTYRLRLRNLKMLLSLAQTRNISHSAAMLNTTQPGLSKWLKDLEDDIGLPLFERHARGLRPTPYGEALIAHAQRIDAQLERASGDMAALRQGGGGRVVIGASGASASDTVPLAVMRLLERMPQARVKLVESTMDHLLAQLAQGELDIVVGRSAPEHHDPAILSESLYLEPVHMVARPRHPVFSLPRITWEDLMAYRWIVWPKGTPIRNALDTALAAAGKALPADHVESNSVTINLTLISNSDLVGVASHRAALRFSQMNAMRILPIRLSGFGAVTMYWRQETFQPAAVEMALDSLRAVVGEHQG
>NZ_CP016170.1|WP_066356083.1|5246627_5247254_-|LysE-family-translocator
MSLEHWLAFVAASAILLVIPGPTILSVISYSLAHGRRARWPLVAAVALGDSTALCVSLLGLGALLAASAFWFTVVKWIGGGYLLYLGLRMLGTGASGGALRAASAVPASRWKLFANTWLVTALNPKGIVFFVAFLPQFIEPARDASGQLWILALTFVALASLNATLYALFAGAASRWLSSPRARRGFHLAGGSLLSAAGVWALLARRP
>NZ_CP016170.1|WP_066356079.1|5245603_5246596_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKTSNPITTLRRLLAGAGLCALAAAPLAANAAYPERPITLIVSAAPGGTTDIAARLIAQPLAKALGQSVVVENKPGASGSIAAQAVSRAAPDGYTLLLQYSGYQVITPLITQGLNWDPIKSFAPVANVLSAPQVVVVRPSLPIKSMKELVDYAKAHPGELNYASSGNGSLQQVATELLNQMAGIKTTHIPYKGTGPALADLLSGAVDMTITTPPPLLGQIAAGKLRPLAVTGKARLESLPDVPTAAEAGYPDLIVSSWFAMYAPAGTPNDVIVKLSSEIEKIMKTDEFRKKAAEQGAEAEFMGPEQLGKYTRDELVRYKSVVEKANITAN
>NZ_CP016170.1|WP_066356078.1|5244237_5245431_+|CoA-transferase
MARQILAGIRVLELGQLIAGPFAAKTLADFGAQVIKIEPPGVGDPLRKWRMLHEGTSVWWEAQSRNKQSVCVDLRQPEGQDIVRQLAAEADVLIENFRPGTMEKWGLSWEALHRLNPRLIMLRISGYGQTGPKAGEPGFAAIGEAMAGLRYLNGEPGRAPVRAGLSLGDTIAGLHGALGVLLALYERDARGGTGQVIDAALYESIFNLTESLLPEYSVFGAVREPAGAALPGIAPSNAYPCQDGYVLIAGNGDGIYTRLMSRIGREDLARDPALARNDGRVARVTEIDQAIAAWTQARTIDQVLDAMREAGVPAGRIYSIADIAQDPHYRARQAIVTVESASGVAVEMPAVFPLLSGNPGQVRERAPTLGEDTDVVLREIGLDDERRAALRAAGVIA
>NZ_CP016170.1|WP_156770430.1|5242661_5244107_+|LuxR-family-transcriptional-regulator
MPSEAVHAVQDAALLRWSGCTANAAEVASVFGDDVAGRAAMLAMRPGWSASLALHGGTAAALRPLAEIHCEVSGQVAAMLGLPARVGEILRAVFEAWDGSGNPRGLRGAEIPPEVFVVVLAGDVEILGRTYGMAQAREIIRGKAQAAYPASLADIAIAHADAWLAELDRGGEATRDESPSRALQPTPATLRDAPLELIADVIDLKLPWMTGYSRAVATAAAACARRMALDDVTMDAVYRAGLIHGIGRAAVPNAIWNTPGRLSAAAWEKVRLVPYWTARAGKQTGALADAAELASYVYERADGSGYFRAVGTPAVSQPAQIVAAAVAWVALRCARPWRGAMPDDEAASLLRGQAERGRFDRPIIEALLAGGTGAGAGWSGAAGEAGGAGVGCSGGGGAGIVGVGGVKDTMDDAARPDAALLTPRERDVLRAISVGCTNKEAARQLALSPSTVRTHVENVFRKLQCTTRAAAILKASSLGLL
>NZ_CP016170.1|WP_066359620.1|5241580_5242360_-|alpha/beta-hydrolase
MKTLLKKFLPALFLTGALAATAAHAAPPAQDLKGKNIVLVHGAFADGSSWNKVIPLLEARGAHVVAVQNPLSSLRDDVDAARRAIEAQQGPVILVGHSWGGVVITEAGNTDKVKALVYVAAFAPDNGQSINDMTQGAPAPAWAAQLRKDSGGFLTLSTEGILQNFAQDLPAPAARLVAATQGPAAEAIFGTKVATAAWRNKPSAFVVADADRMIDPALQAKMAADIGATVTHVRSSHVPMLSQPAAVANAIIAEAKKVR
>NZ_CP016170.1|WP_066356071.1|5240979_5241306_-|hypothetical-protein
MLLPVMLQGLSILVVVGAACLALRHLLRGGWAGRIYSGIMLACLVLGVAGIATAPPDDSVHSQFAWGLWLVLLSVAGVTLPGLGALCLRVAAPGRRMRALCARLRRRS
>NZ_CP016170.1|WP_066356070.1|5240086_5240983_+|LysR-family-transcriptional-regulator
MNLARIDLVTLALFVSVARLGSISAGARQARLAVGAASKRISDLEAALGSPLLFRKAAGVELTDAGQACLAHATRILQEVDQMAGTLSDYAQGARGQVRIAANTSSITQFLPDDLSRFMTEHPAVRIELEEQNSSEIVAAVAENRADIGVFGERTPDAGLQTFPYKRDELMLVVPDSHPLATRASVAFAETLEYDYVGLPPSTSLAGLLAQECARLELPMKLRIQVRSFDAICRMVVATRGIGVLPRIAAEPHARSMQLRLIPLTDDWTRRWLLLAVRDVDTLALAPRMLLTQLRAAG
>NZ_CP016170.1|WP_066356069.1|5238397_5239948_+|glycerol-kinase-GlpK
MKNEYILALDQGTTSSRAIVFDRAGRARGVGQREFRQYYPHPGWVEHDANEIWRSQLDVAREALDNAGATAADIAAIGITNQRETTLIWDRATGRPLAHAIVWQDRRTAEACDRMRAEGKADFLQQRTGLVLDAYFAGTKLAWLLDHVPGARAAAERGEVAFGTIDTWLIWQLTGGKVHSTDCTNASRTLLFDIHTQDWSDELLQCLDIPRAVLPAIAPSSAVVAETLPQWFGGAIPIAGVAGDQQAATFGQACFKPGMAKNTYGTGCFMLMNVGDKPVASRHRLLSTVGWGLPRPAEDTADAQVFPNGGPAWTPTFMLEGGVFVAGAAVQWLRDGLGIIQRSEDVEALAGSVADTDDVFLVPAFAGLGAPHWDPYARGTLVGLTRGTSRAHVARATLESIALQSAELLTAMKADCGIELSELRVDGGAARNDLLMQMQADLLGVPVVRPRVSESTARGAAGLAGLAVGFWKDMDAFAAQWQAERRFAPAWSADRREARLRRWGQAVELSKNWARG
>NZ_CP016170.1|WP_066356094.1|5249815_5250514_+|fumarylacetoacetate-hydrolase-family-protein
MPYVFAPPATVAVPVAGSGDSFPVRRVYCVGRNYAAHAREMGFDPDREPPFFFCKPADAVMPVAEGATLDLPYPTETSNYHYEIELVAAIGKAGANIDVADALAHVYGYAVGLDMTRRDLQMKMREAGRPWELGKAFDDSAPIGPLHPAAAKGHFDRAGIWLKVNGQDKQRSDTSKLIWSVAETISYLSRYFRLEPGDLIYTGTPEGVGPVVKGDLMEGGVDGLGTLRAKVV
>NZ_CP016170.1|WP_066356101.1|5250517_5251774_+|flavin-dependent-oxidoreductase
MKDTDVIIVGAGVGGLVLALSLHQAGIACRVYEAVPEIKPLGVGINLLPHAARELDELGLLPALDKLGVHTKESIFFTRHGQFIYSEPAGKAAGYAWPQYSIHRGDLQMALLAAARERLGADSVLVDHRAVRVEQDADGVTVHMTDAAGAPRPSVRGAIAVGCDGIHSALRKQLYPDEGAPRYSGVNMWRGVTRCKPFLSGGSMVRAGWLSIGKMVIYPIRDNVDAEGNQLVNWVAEIESPEPAVRDWTRQGRLEDFFPAFADWHFDWLDVAALIQNADSVLEYPMVDQDPLPTWTQGRMTLLGDAAHPMVPRGSNGAGQAVIDARFLAGQLKRQGLTPQALQEYDRVRVAATTQVVLTNRKNPPDAILRVAYERSRDQRFDRIEDVISRDELQAISDRYKQVAGFDPETLKTRPSFL
>NZ_CP016170.1|WP_066356107.1|5251832_5252798_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKTLFRALAALALALTASVSQAAWPERPITLIVPFTPATGIDLVARQLAATLPKTLGQSVIVENLAGASGNIGTEKVARSAPDGYTFLVTVNTFVMNQPLYKEKLHYDPVKDFAPVSLTSWGTLLLVTHPSNPVNTVQQLEDAARKQPGKLTYGTPGVGTPHHLAMALLLDQTKTEMLHVPYKGTAGAVTDMLAGRLDYMFLPVHVALPQIKAGKLKAIATGSPKRIPQLPEVPTLTESGLQGADVDMWYGVLAPKGTPPAIVESLNKQIAEALKAPSTATAFEAQGMVPATSSPAEFGDLIAKDAKRWSDIVNRAGIKAD
>NZ_CP016170.1|WP_066356109.1|5252864_5253503_+|maleylacetoacetate-isomerase
MQLYSFFNSSTSYRVRIALALKGLDAGIRPINIRKLEHRAAAYMAMNPSGSVPMLHDGDLQLGQSLAIVDYLDATHPEPRLIPREAVARARVLELSSVIACDIHPVNNLRILRYLTDVLGVTAEQKDAWYRHWVQDGMRAVEALLERYGHGDFCFGDAPTLADVCLVPQIANAQRMGCDMSAYPRAMAVHAHCGTIEAFQRAAPSAQPDYTA
>NZ_CP016170.1|WP_066356114.1|5253638_5254646_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MSLNSFARLGRLLACGALAVAALAPAVGQAADNYPSKPLRFIVPYPPGGPLDTMARMLAEKVRGDLGQPVIVENRAGAGGNIGADLAAKAQPDGYTLVMGAVATHAINPWLFKNLPYDPIKDFAPVTIVASVPNVLVMNVDFAKKNNINSLGDLIAYAKANPGKLNYGSGGNGSAGHLSGELLKARAGVNIEHIPYQGAAPAQLALLSGQSDFMFDNLAASAPLIKDGKVKALAVTTRERSSLLPDVPTVEQSGVKDFDLGTWFGVFTTGGTPQAVVDKLNKAYGAALMQPDVRQRLLTMGSEIKPMSPQQFADFVRNEKSKYKEIVQVSGASTN
>NZ_CP016170.1|WP_066356117.1|5254698_5255469_-|SDR-family-oxidoreductase
MHGKVAIVTGASQGIGRSAAIRLARDFDAIALVARNRAKLEETAAAVREAGAEPLAIAADLADPTAAAAAVDATVTAFGGLDALLNIAGAVPQIDLFETSDAQWDQGMALKLHGARRLTIAAWPHLKSSQGAVVLMSGNSAQQPKAAAAALGTINAAIVALAKAFADRGIADGVQVNSVLPGAVMTDRRRSGLERWASLRGVTLEEAVARFPREAGIARFGESQEIADLMAFLVSPAARWMTGAALRVDGGEVQAV
>NZ_CP016170.1|WP_066356124.1|5255498_5256473_-|zinc-binding-dehydrogenase
MRAIVLEKFGGLDSLVYKDIPDPEPLPGHVVIEIKAFGINHAEMHMRRGEWAEAAPVSGIECVGVVKSCPGGEFPVGAKVAALMGGLGRTINGSYAEYTRAPASNVALIDADLPWADLAAIPETYATAWTCLFRNLDLQPGQTLAIRGATSAFGQAAVKLAVNAGAKVIATTRNPGRFDMLLGLGATRVEVEGPDLSKRIAEARQLDAVLDLVGNSTILDSLAMLRRGGKACLAGWLGGLAPIADFNPLLQMSSGVYLTFFGSFVFGTPGFPLSDVPLQAIARDVAAGRLQAKPSRVFRFEEIHEAHRVMEANEAAGKMVVVHD
>NZ_CP016170.1|WP_066356127.1|5256562_5257468_-|alpha/beta-hydrolase
MTTNATTANVTTAKAATRIAYRRVPAGGLDVFYREAGTPGAPKLLLLHGFPSSSHMFRDLIPLLADDFHIIAPDLPGFGQTEMPPREQFDYTFDNFARVMEAFTEAVGFDRYAVYVFDYGAPTGFRMALRHPERIRAIISQNGNAYEEGLSEGWNPIQAYWRDPSAQNRAALRALLTPETTKWQYTHGVADPAAVSPDGYGLDDHYLARPGADEIQLDIFGDYKNNVALYPDFQAYFRAHQPPLLAVWGRNDPFFLPPGAEAYKRDIPSARVRFFDTGHFALETHAGEIAAEIRAFLTSLA
>NZ_CP016170.1|WP_066356128.1|5257843_5258470_+|hypothetical-protein
MHDHAHPPAMFIADATALDFLNSIATPTDTPIDWISDGEGLLAWLEQAGLVPAEELAALRGRAMPGELDAVAAQARALREWFRDFVRRHMGRPLTPEALHGLEPLNRLLERDESYTQVVPAPVGALELRVTRRWRSPESLLLPIGEALARFVSTEDMTHVKACEGARCTLLFADHTRGHRRRWCSTAVCGNRAKVAAHRQRAKEAAGR
>NZ_CP016170.1|WP_066356129.1|5259185_5260397_-|AAA-family-ATPase
MILAVEIENFMSIRDRQRIDLQVGGAVDDCPERYAPTWRGSSRRVPKVIAFFGANASGKSTVLRSLQYLVWFVRESFQFGPAQSLPFEPFWDGSCHDAPTVLAVEFAGPESVRGVESGKPQCRYRYELRLHTAGGKRTVLNESLFFWPSRAKRLVRLFERDAAGDVVAGPDFGLAGHKSVLKKILRDNASVISTLAQLDHAPSLALQQAAYRVSSNIFLEKLQVNESQMLQYYQANPALLDALNGDLPRIDLGIQSMMIGQGPNGLIATFRHRGLSREVPLMLESHGTRQFLQIYPFLMDALQRGGIAIVDELDLAIHPTVLPEILRWFYSPQRNPHSAQLWMTCQNSSLLEELVKEEIYFCEKDPTGATSVYGLKDIQGVRRIDNFYRKYMGGTYGAVPTIG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP016170_4	4.1\|5249631\|31\|NZ_CP016170\|CRISPRCasFinder	5249631-5249661	31	NZ_CP011665	Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence	326129-326159	8	0.742

1. spacer 4.1|5249631|31|NZ_CP016170|CRISPRCasFinder matches to NZ_CP011665 (Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence) position: , mismatch: 8, identity: 0.742

agggtggggcccacccccaagcgctgcgcgc	CRISPR spacer
ccgtccgcgcgcacccccacgcgctgcgcgc	Protospacer
  * . * ** ******** ***********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1148502 : 1156200

Mollivirus(16.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066345133.1\|1148502_1149384_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0M4JBD3	Mollivirus	6.8e-51	37.3
WP_066345135.1\|1149773_1150349_+	disulfide bond formation protein B	NA	NA	NA	NA
WP_066345137.1\|1150506_1151034_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	1.6e-15	41.2
WP_066358108.1\|1151132_1152299_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_066345139.1\|1152364_1153408_+	threonylcarbamoyl-AMP synthase	S4VW33	Pandoravirus	1.6e-43	38.9
WP_066345141.1\|1153667_1154690_+	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	1.2e-67	41.1
WP_066345143.1\|1154701_1155418_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.5e-11	24.1
WP_066345145.1\|1155414_1156200_-	ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	9.4e-12	28.3

DBSCAN-SWA_2

2049289 : 2089533

Burkholderia_phage(26.92%)

integrase,capsid,protease,portal,tail,terminase,head

attL 2044472:2044487|attR 2051401:2051416

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2044472:2044487	attL	NA	NA	NA	NA
WP_066347460.1\|2049289_2050264_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4J8E5	uncultured_Caudovirales_phage	1.6e-64	42.7
WP_082988087.1\|2050190_2050421_-	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_066347461.1\|2050417_2050930_-	hypothetical protein	NA	NA	NA	NA
WP_066347463.1\|2050919_2051378_-	hypothetical protein	NA	NA	NA	NA
WP_156770187.1\|2051377_2051809_-	hypothetical protein	NA	NA	NA	NA
2051401:2051416	attR	NA	NA	NA	NA
WP_066347468.1\|2051801_2053133_-	hypothetical protein	NA	NA	NA	NA
WP_066347470.1\|2053134_2053398_-	hypothetical protein	NA	NA	NA	NA
WP_156770188.1\|2053394_2053847_-	hypothetical protein	NA	NA	NA	NA
WP_066347477.1\|2053843_2054194_-	hypothetical protein	A0A2H4PF41	Gordonia_phage	5.5e-12	38.0
WP_066347482.1\|2054186_2055041_-	DUF551 domain-containing protein	NA	NA	NA	NA
WP_082993587.1\|2055037_2055934_-	DNA cytosine methyltransferase	Q6J1P4	Burkholderia_virus	6.3e-105	58.5
WP_066347486.1\|2056064_2056310_+	hypothetical protein	NA	NA	NA	NA
WP_156770189.1\|2056362_2056557_-	hypothetical protein	NA	NA	NA	NA
WP_156770190.1\|2056553_2057129_-	hypothetical protein	A0A140XBB9	Dickeya_phage	5.3e-20	35.5
WP_066347493.1\|2057113_2058763_-	DEAD/DEAH box helicase	A0A0R6PK36	Moraxella_phage	9.9e-88	37.0
WP_156770191.1\|2058759_2059812_-	oxidoreductase	A0A173H0P7	Pseudoalteromonas_phage	6.8e-74	42.7
WP_066347495.1\|2059814_2060291_-	DUF669 domain-containing protein	A0A2H4GYE1	Pseudomonas_phage	4.1e-26	45.6
WP_066347498.1\|2060306_2061116_-	ATP-binding protein	A0A1B1INN1	uncultured_Mediterranean_phage	1.4e-47	42.5
WP_066347501.1\|2061117_2061492_-	hypothetical protein	NA	NA	NA	NA
WP_156770192.1\|2061495_2061633_-	hypothetical protein	NA	NA	NA	NA
WP_066347505.1\|2061735_2062041_-	hypothetical protein	NA	NA	NA	NA
WP_156770193.1\|2062477_2062783_-	hypothetical protein	NA	NA	NA	NA
WP_082993588.1\|2063173_2063689_+	Arc family DNA-binding protein	NA	NA	NA	NA
WP_066347512.1\|2063818_2064445_-	hypothetical protein	NA	NA	NA	NA
WP_066347519.1\|2064603_2065356_-	DUF1828 domain-containing protein	NA	NA	NA	NA
WP_066347522.1\|2065852_2066842_-	helix-turn-helix domain-containing protein	A0A0H5BBV1	Pseudomonas_phage	3.4e-27	35.8
WP_066358546.1\|2066916_2067114_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_066347524.1\|2067177_2067615_+	hypothetical protein	Q3HQZ3	Burkholderia_phage	2.4e-25	45.2
WP_066347533.1\|2067640_2069926_+	DUF3987 domain-containing protein	M4R151	Loktanella_phage	2.5e-81	36.0
WP_082993589.1\|2070217_2070637_+	VRR-NUC domain-containing protein	H7BUL6	unidentified_phage	5.0e-20	42.7
WP_156770194.1\|2070768_2071152_+	hypothetical protein	NA	NA	NA	NA
WP_066347538.1\|2071361_2071697_-	hypothetical protein	NA	NA	NA	NA
WP_066347548.1\|2071832_2072183_+	HNH endonuclease	NA	NA	NA	NA
WP_066347553.1\|2072279_2072588_+	hypothetical protein	Q3HQS6	Burkholderia_phage	3.0e-14	50.0
WP_066347555.1\|2072591_2074268_+\|terminase	terminase large subunit	Q3HQS7	Burkholderia_phage	1.3e-239	72.3
WP_066347558.1\|2074276_2075542_+\|portal	phage portal protein	Q3HQS8	Burkholderia_phage	7.5e-144	60.9
WP_066347562.1\|2075507_2076374_+\|protease	Clp protease ClpP	Q3HQS9	Burkholderia_phage	1.1e-106	73.6
WP_066347565.1\|2076378_2077656_+\|capsid	phage major capsid protein	Q3HQT0	Burkholderia_phage	1.5e-168	71.9
WP_066347570.1\|2077731_2077917_+	hypothetical protein	Q3HQT1	Burkholderia_phage	1.2e-07	51.9
WP_066347573.1\|2077919_2078399_+\|head,tail	phage gp6-like head-tail connector protein	K7PKT4	Enterobacteria_phage	2.8e-06	57.4
WP_066347575.1\|2078395_2078746_+\|head	phage head closure protein	Q7Y5K6	Xanthomonas_virus	4.8e-16	40.3
WP_066347578.1\|2078738_2079230_+	hypothetical protein	Q2NPI1	Xanthomonas_virus	4.2e-26	42.8
WP_066347581.1\|2079219_2079573_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_066347584.1\|2079625_2080282_+	hypothetical protein	A0A0H5BBY3	Pseudomonas_phage	5.8e-39	44.5
WP_066347587.1\|2080278_2080590_+	hypothetical protein	Q7Y5K2	Xanthomonas_virus	1.6e-07	34.0
WP_066347590.1\|2080598_2080892_+	hypothetical protein	NA	NA	NA	NA
WP_066347593.1\|2080893_2083722_+\|tail	phage tail tape measure protein	A0A2H4J107	uncultured_Caudovirales_phage	6.2e-122	34.5
WP_066347596.1\|2083727_2084078_+	hypothetical protein	NA	NA	NA	NA
WP_066347603.1\|2084074_2084551_+	DUF1833 domain-containing protein	I7GYA2	Xanthomonas_virus	4.8e-11	30.1
WP_082993853.1\|2084937_2085183_+	hypothetical protein	NA	NA	NA	NA
WP_066358550.1\|2085238_2085622_+	hypothetical protein	NA	NA	NA	NA
WP_156770376.1\|2085690_2089533_+	hypothetical protein	Q52PQ3	Xanthomonas_phage	4.3e-49	28.8

DBSCAN-SWA_3

4862312 : 4939708

Bacillus_phage(40.0%)

transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066342657.1\|4862312_4863560_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.9e-35	37.4
WP_066355163.1\|4864359_4865916_-	amidase	NA	NA	NA	NA
WP_066355168.1\|4866057_4866603_-	hypothetical protein	NA	NA	NA	NA
WP_082993888.1\|4866774_4867443_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_066355184.1\|4868007_4869012_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_066355187.1\|4869034_4869856_+	ABC transporter permease	NA	NA	NA	NA
WP_066355191.1\|4869852_4870626_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.0e-34	40.9
WP_066355195.1\|4870674_4871406_+	Asp/Glu/hydantoin racemase	NA	NA	NA	NA
WP_066355197.1\|4871402_4872950_+	dihydropyrimidinase	NA	NA	NA	NA
WP_066355199.1\|4872946_4874392_+	amidohydrolase family protein	NA	NA	NA	NA
WP_066355202.1\|4874335_4877935_-	AAA family ATPase	NA	NA	NA	NA
WP_066355210.1\|4878320_4879943_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_066355212.1\|4879966_4880485_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_066355216.1\|4880488_4881982_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_066355218.1\|4882104_4882593_+	Hcp family type VI secretion system effector	NA	NA	NA	NA
WP_066355223.1\|4882635_4883055_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_066355229.1\|4883084_4884809_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_066355232.1\|4884772_4885837_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_066355234.1\|4885833_4888629_+	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	2.2e-87	28.0
WP_066355238.1\|4888631_4891091_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_066355240.1\|4891106_4893551_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_066355242.1\|4893555_4896183_+	DUF2169 domain-containing protein	NA	NA	NA	NA
WP_066355246.1\|4896175_4897126_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_082988391.1\|4897144_4897852_+	DUF3540 domain-containing protein	NA	NA	NA	NA
WP_066355250.1\|4897865_4898270_+	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_066355253.1\|4898281_4898980_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_066355257.1\|4899000_4900395_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_082988586.1\|4900429_4901077_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_066355269.1\|4901103_4905033_+	hypothetical protein	NA	NA	NA	NA
WP_066355277.1\|4905096_4906056_-	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_066355280.1\|4906308_4907211_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_066355282.1\|4907241_4909002_-	dihydroxy-acid dehydratase	NA	NA	NA	NA
WP_066355284.1\|4909067_4910072_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_066355290.1\|4910292_4911681_+	MFS transporter	NA	NA	NA	NA
WP_066355292.1\|4911994_4912849_+	hypothetical protein	NA	NA	NA	NA
WP_066355297.1\|4913138_4914959_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.2e-28	28.0
WP_066355303.1\|4914989_4915538_+	cysteine hydrolase	NA	NA	NA	NA
WP_066355306.1\|4915791_4917354_+	hypothetical protein	NA	NA	NA	NA
WP_066355311.1\|4917385_4917688_-	YciI family protein	NA	NA	NA	NA
WP_082988392.1\|4918045_4919146_+	biotin synthase BioB	NA	NA	NA	NA
WP_082993889.1\|4919142_4920612_+	adenosylmethionine--8-amino-7-oxononanoate transaminase	NA	NA	NA	NA
WP_082993775.1\|4921396_4922533_+	dethiobiotin synthase	NA	NA	NA	NA
WP_066355322.1\|4922604_4923132_-	thioredoxin family protein	NA	NA	NA	NA
WP_066355323.1\|4923142_4923892_-	cytochrome c biogenesis protein CcdA	NA	NA	NA	NA
WP_066355330.1\|4924141_4924513_+	GFA family protein	NA	NA	NA	NA
WP_066355349.1\|4924872_4925613_+	response regulator	NA	NA	NA	NA
WP_066355356.1\|4925626_4926952_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	4.9e-13	26.8
WP_066355360.1\|4926977_4927361_-	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_066355366.1\|4927375_4928428_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_066355372.1\|4928424_4931067_-	DUF2169 domain-containing protein	NA	NA	NA	NA
WP_082988394.1\|4931071_4931473_-	hypothetical protein	NA	NA	NA	NA
WP_066355378.1\|4931469_4933857_-	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_066359488.1\|4934374_4935475_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_066355380.1\|4935507_4936077_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_066355382.1\|4936094_4937597_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_156770425.1\|4937781_4938252_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_066355386.1\|4938257_4939088_+	ImpE family protein	NA	NA	NA	NA
WP_082993776.1\|4939087_4939708_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP016170

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection