CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP016172	Bordetella flabilis strain AU10664, complete genome	2 crisprs	WYL,DinG,DEDDh,cas3,csa3	0	0	2	0
NZ_CP016173	Bordetella flabilis strain AU10664 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP016172_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016172_1

60035-60129

Orphan

Consensus_repeat	Method
CGGCCGCTTTGGCCGCCGTCTTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP016172_1

>merge|NZ_CP016172|1|60035-60129|CRISPRCasFinder
CGGCCGCTTTGGCCGCCGTCTTCGTGCCGGCCCTCGCCGTCTTCGTGGCTGTCTTGGACGGCGCTGCCCGACCGGCCGTTTTGGCCGCCGTCTTC

>NZ_CP016172|1|1|60035-60129|CRISPRCasFinder
CGGCCGCTTTGGCCGCCGTCTTC	GTGCCGGCCCTCGCCGTCTTCGTGGCTGTCTTGGACGGCGCTGCCCGAC
CGGCCGTTTTGGCCGCCGTCTTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016172.1\|WP_066652544.1\|72598_73288_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP016172.1\|WP_066652532.1\|62643_65262_+\|DUF4401-domain-containing-protein	unknown	unknown	gnl\|CDD\|379571
NZ_CP016172.1\|WP_066652522.1\|53500_54031_+\|nucleoside-2-deoxyribosyltransferase	unknown	unknown	gnl\|CDD\|226140
NZ_CP016172.1\|WP_066652528.1\|55754_56228_-\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NZ_CP016172.1\|WP_066652534.1\|68186_68915_-\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NZ_CP016172.1\|WP_066652527.1\|55180_55666_-\|SET-domain-containing-protein	unknown	unknown	gnl\|CDD\|380916
NZ_CP016172.1\|WP_066664421.1\|66932_68078_+\|DSD1-family-PLP-dependent-enzyme	unknown	unknown	gnl\|CDD\|143493
NZ_CP016172.1\|WP_066652533.1\|66207_66669_-\|DUF494-domain-containing-protein	unknown	unknown	gnl\|CDD\|377328
NZ_CP016172.1\|WP_066652535.1\|68895_69552_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_CP016172.1\|WP_066652539.1\|70223_71006_-\|transporter-substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270233
NZ_CP016172.1\|WP_157121894.1\|56322_58146_+\|biosynthetic-type-acetolactate-synthase-large-subunit	unknown	unknown	gnl\|CDD\|236380
NZ_CP016172.1\|WP_066652524.1\|54072_54789_-\|3,4-dihydroxy-2-butanone-4-phosphate-synthase	unknown	unknown	gnl\|CDD\|134031
NZ_CP016172.1\|WP_066664419.1\|65249_66134_-\|tRNA-glutamyl-Q(34)-synthetase-GluQRS	unknown	unknown	gnl\|CDD\|235573
NZ_CP016172.1\|WP_084025032.1\|52983_53436_+\|polyketide-cyclase	unknown	unknown	gnl\|CDD\|227259
NZ_CP016172.1\|WP_066652515.1\|50513_51416_+\|phytanoyl-CoA-dioxygenase-family-protein	unknown	unknown	gnl\|CDD\|368580
NZ_CP016172.1\|WP_066652541.1\|71330_72350_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|214599
NZ_CP016172.1\|WP_066652520.1\|51946_52879_+\|2-dehydropantoate-2-reductase	unknown	unknown	gnl\|CDD\|183829
NZ_CP016172.1\|WP_066652538.1\|69548_70217_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_CP016172.1\|WP_066652529.1\|58172_59606_-\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|143427
NZ_CP016172.1\|WP_066652518.1\|51495_51789_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226331

Protein	Function_ID	Function_description	E-value
NZ_CP016172.1\|WP_066652544.1\|72598_73288_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	3.59603e-46
NZ_CP016172.1\|WP_066652532.1\|62643_65262_+\|DUF4401-domain-containing-protein	gnl\|CDD\|379571	pfam14345, GDYXXLXY, GDYXXLXY protein. This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 171 and 199 amino acids in length. It contains a conserved GDYXXLXY motif.	6.1101e-40
NZ_CP016172.1\|WP_066652522.1\|53500_54031_+\|nucleoside-2-deoxyribosyltransferase	gnl\|CDD\|226140	COG3613, COG3613, Nucleoside 2-deoxyribosyltransferase [Nucleotide transport and metabolism].	3.0626e-49
NZ_CP016172.1\|WP_066652528.1\|55754_56228_-\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	1.86672e-49
NZ_CP016172.1\|WP_066652534.1\|68186_68915_-\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	2.24818e-144
NZ_CP016172.1\|WP_066652527.1\|55180_55666_-\|SET-domain-containing-protein	gnl\|CDD\|380916	cd10518, SET_SETD1-like, SET domain (including post-SET domain) found in SET domain-containing proteins (SETD1A/SETD1B), histone-lysine N-methyltransferases (KMT2A/KMT2B/KMT2C/KMT2D) and similar proteins. This family includes SET domain-containing protein 1A (SETD1A), 1B (SETD1B), as well as histone-lysine N-methyltransferase 2A (KMT2A), 2B (KMT2B), 2C (KMT2C), 2D (KMT2D). These proteins are histone-lysine N-methyltransferases (EC 2.1.1.43) that specifically methylate 'Lys-4' of histone H3 (H3K4me).	1.1801e-36
NZ_CP016172.1\|WP_066664421.1\|66932_68078_+\|DSD1-family-PLP-dependent-enzyme	gnl\|CDD\|143493	cd06819, PLPDE_III_LS_D-TA, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Low Specificity D-Threonine Aldolase. Low specificity D-threonine aldolase (Low specificity D-TA, EC 4.3.1.18), encoded by dtaAS gene from Arthrobacter sp. strain DK-38, is the prototype of this subfamily. Low specificity D-TAs are fold type III PLP-dependent enzymes that catalyze the interconversion between D-threonine/D-allo-threonine and glycine plus acetaldehyde. Both PLP and divalent cations (eg. Mn2+) are required for catalytic activity. Members of this subfamily show similarity to bacterial alanine racemase (AR), which contains an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. AR exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Based on its similarity to AR, it is possible that low specificity D-TAs also form dimers in solution. Experimental data show that the monomeric form of low specificity D-TAs exhibit full catalytic activity.	0
NZ_CP016172.1\|WP_066652533.1\|66207_66669_-\|DUF494-domain-containing-protein	gnl\|CDD\|377328	pfam04361, DUF494, Protein of unknown function (DUF494). Members of this family of uncharacterized proteins are often named Smg.	1.54127e-64
NZ_CP016172.1\|WP_066652535.1\|68895_69552_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	1.01198e-75
NZ_CP016172.1\|WP_066652539.1\|70223_71006_-\|transporter-substrate-binding-domain-containing-protein	gnl\|CDD\|270233	cd01072, PBP2_SMa0082_like, The substrate-binding domain of putatuve amino acid transporter; the type 2 periplasmic binding protein fold. This group includes the periplamic-binding protein component of a putative amino acid ABC transporter from Sinorhizobium meliloti and its related proteins. The putative SMa0082-like domain belongs to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.21899e-117
NZ_CP016172.1\|WP_157121894.1\|56322_58146_+\|biosynthetic-type-acetolactate-synthase-large-subunit	gnl\|CDD\|236380	PRK09107, PRK09107, acetolactate synthase 3 catalytic subunit; Validated.	0
NZ_CP016172.1\|WP_066652524.1\|54072_54789_-\|3,4-dihydroxy-2-butanone-4-phosphate-synthase	gnl\|CDD\|134031	PRK00014, ribB, 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional.	6.46339e-121
NZ_CP016172.1\|WP_066664419.1\|65249_66134_-\|tRNA-glutamyl-Q(34)-synthetase-GluQRS	gnl\|CDD\|235573	PRK05710, PRK05710, tRNA glutamyl-Q(34) synthetase GluQRS.	9.42377e-146
NZ_CP016172.1\|WP_084025032.1\|52983_53436_+\|polyketide-cyclase	gnl\|CDD\|227259	COG4922, COG4922, Uncharacterized protein conserved in bacteria [Function unknown].	8.46728e-30
NZ_CP016172.1\|WP_066652515.1\|50513_51416_+\|phytanoyl-CoA-dioxygenase-family-protein	gnl\|CDD\|368580	pfam05721, PhyH, Phytanoyl-CoA dioxygenase (PhyH). This family is made up of several eukaryotic phytanoyl-CoA dioxygenase (PhyH) proteins, ectoine hydroxylases and a number of bacterial deoxygenases. PhyH is a peroxisomal enzyme catalyzing the first step of phytanic acid alpha-oxidation. PhyH deficiency causes Refsum's disease (RD) which is an inherited neurological syndrome biochemically characterized by the accumulation of phytanic acid in plasma and tissues.	2.29641e-29
NZ_CP016172.1\|WP_066652541.1\|71330_72350_-\|hypothetical-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	1.27513e-15
NZ_CP016172.1\|WP_066652520.1\|51946_52879_+\|2-dehydropantoate-2-reductase	gnl\|CDD\|183829	PRK12921, PRK12921, oxidoreductase.	1.7567e-102
NZ_CP016172.1\|WP_066652538.1\|69548_70217_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	7.31387e-70
NZ_CP016172.1\|WP_066652529.1\|58172_59606_-\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|143427	cd07109, ALDH_AAS00426, Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like. Uncharacterized aldehyde dehydrogenase of Saccharopolyspora spinosa (AAS00426) and other similar sequences, are present in this CD.	0
NZ_CP016172.1\|WP_066652518.1\|51495_51789_+\|hypothetical-protein	gnl\|CDD\|226331	COG3809, COG3809, Uncharacterized protein conserved in bacteria [Function unknown].	3.48418e-24

>NZ_CP016172.1|WP_066652529.1|58172_59606_-|aldehyde-dehydrogenase-family-protein
MQQHFIDNRPVASSSGEFIPVIDPSTGAEFDAIPRGNAADIDRAVRAARKAYEGPWGALTAAERGRLLLKLSLLVMDHFDELAAIESRDCGKPTRQARADVTAIARYFEFYGGAADKLHGATLPYQNGYTVLTLREPHGVTGHIVPWNYPLQIFGRSVGGALAAGNACVVKPAEDACLSVLRIAELAAEAGFPPGAINVVTGYGHEAGDALARHPGIDHISFTGSPSIGILVTQTAAANHTPVTTELGGKSPQIVFADADFDAMLPVVINAIVQNAGQTCSAGSRLLVQRSAYEAVLDKVGAAFAALRTGPADMDLDCGPLIRKTQQARVADFLSQARGDGIATVAQGRLADGAPAQGYYQVPTLLRDVPLDHRLARDEVFGPVLAAIPFEDEADAVRIANSTDYGLVASIWTRDGGRQLRMARKVRAGQVFINNYGAGGGIELPFGGVKASGHGREKGFEALYGFTVLKTISIKHD
>NZ_CP016172.1|WP_157121894.1|56322_58146_+|biosynthetic-type-acetolactate-synthase-large-subunit
MVTMNDRLHTQALTGADAGRATPLPNGARILLDTLLANGVDTVFGYPGGAVLPLYDALYAEPRLRHVLVRHEQAAVHAAEGYARTTGRPGVVFVTSGPGMANTTSGLLDAMCDSIPVLCISGQVATSAIGTDAFQECDAIGISRPVTKWNTQIRSLDTVADTVERALRLTRQGRPGPVLVDFPKDIQQALPADQDEALPAAERHGVTALRARRQATKAAFKVPQSALRRAADLIAQARRPVFYGGGGLINAGPEACHAFTQLVRHVGAPCTLTLMGLGAFPAGDPQFLGMLGMHGTLEANLAMHHADLIICVGARFDDRITGRLADFCPHARKIHIDIDPASINKVVRVDVAMVGDCLPLVGALHEALAHRAPPAEQLETWWHRIERWRGKQCLRIEPRDDAILPQQLMQRLDAALAGRDAIVSTDVGQHQMWAAQYLKFDAPNRWLTSGGAGTMGYGVPAAIGAQVAHPDRTVVCVSGDASVLMNIQELSTAVQHDAPVKVVLCNNGYMGMVRQWQELIHGGRYSHSYNASLPDFVALARAFGWGAARVSDPAALDEALARCLESRGPYFLDVCVAEQENCYPMMPAGQGHHRMMLAGGVWYEDEA
>NZ_CP016172.1|WP_066652528.1|55754_56228_-|Lrp/AsnC-family-transcriptional-regulator
MHLDKFDLAILRVLQDNARASLNEIGAAVGLSSTPCWNRIKRMETAGVIRGYTVNIDPAALGFMDTVIVHVTLESHSEETLYEFGRALAQIPEVLEAFLVSGDYDYYIRIAVRDTRDYERLLREQLYRIPGIRHSKSSFVLRRLKESMLPLMPPAPI
>NZ_CP016172.1|WP_066652527.1|55180_55666_-|SET-domain-containing-protein
MTEEISKPWHVVRRSPLHGNGVFAARKIPAGTRILEYTGERISPKEADRRHPTNPDDPFHTFFFSLTSGKVIDGGVDGNDARWINHSCEPNCEAQEGRAGKRVYIVALRDLKRGEELFYDYGLVMDGKITKSLKEGYKCLCGAATCRGTMLALPKKKKKKA
>NZ_CP016172.1|WP_066652524.1|54072_54789_-|3,4-dihydroxy-2-butanone-4-phosphate-synthase
MSLAPSHTAVPDPRYPAIASQPFPMRLARALHHMRLGRPVILMDDFDRENEADLIVAADKITVPVMAQLIRDCSGIVCLCLDDETLERMALPPMVARNESRHGTAFTVSIEAREGVTTGVSAQDRVTTIRAAIAPHAKAGDVVSPGHVFPLRAQPGGVLARRGHTEGSVDLAVLAGLRPAAVLCELMNDDGTMARGAAIERYAAKHGLVALTIAELADYRRALARQDSEVPVEVASAA
>NZ_CP016172.1|WP_066652522.1|53500_54031_+|nucleoside-2-deoxyribosyltransferase
MTASGRAYTLYLAGFDVFRPDAVAYGESLKAMCRQHGIEGLYPLDNAGPAELRDRALAAWIYRSNIALIQRADGVLANLNPFRGAEPDSGTAFEVGYAVALGKPVWAYTRQAGSIVDQVAVAKSADGTRHVDAGGYTVEDFGMNLNLMLACSATVVVGDAAACLARVARDIGGGRQ
>NZ_CP016172.1|WP_084025032.1|52983_53436_+|polyketide-cyclase
MKLRTLLATALLLTAACAAGVAHAAPPANNKELVLAFFRMMFLEKNVDKAMQAYVDKGLIQHDPYLPDGADAMGDFFTSYFEQHPQANAEIKLVIAEGDLVMVQSLWKESPEDTGQALVDIFRAQNGKIVEHWAVSQDIPENPANRNTMF
>NZ_CP016172.1|WP_066652520.1|51946_52879_+|2-dehydropantoate-2-reductase
MRMLFLGAGGTGGYFGGRAAEAGADVTFLLRDARAAQVREQGLRIRSPRGDSTVRPKVVTTQTLSGHYDVIVLSCKAYDLRSAVQAIAPAMGPGSVILPIMNGMAQYDVLDHAFGAHRVLGGLCQINATLGPEGEVIHMGSHCGFIFGERTGEPRSARCVALEAALAEANFSSRLSTAIHQDSWEKYVFLCTLAAGTCLMRGSVGEIASTADGQAVMAALLGEAQAVSAAAGYRVRPEADAAARKLFSDAQSPATASMFRDLQQGSRVEADHVVGDMIARGVATGVATPYLRVAYAHLQVYQNRVQPRQA
>NZ_CP016172.1|WP_066652518.1|51495_51789_+|hypothetical-protein
MRCPVCKETDLVMSARQNIEIDYCPQCRGVWLDRGELDKLIERSVQETGAAQAAAPVAAAAPPPQGRPYRDDDHHGRYHGGHDRGYRKKSFWHEIFD
>NZ_CP016172.1|WP_066652515.1|50513_51416_+|phytanoyl-CoA-dioxygenase-family-protein
MNQQYLLPEEITAEYKKQGYISLETICPAEEVAQIRRTLMQMFEKKVGYEEGAQYDFASRDDPNKPQTFPSLHDPSHYAPELLKTTYHRRALAIAKQLLGEDAALYGEHALLKPARVGPETPWHQDEAFRSPDFEYRELSIWLALQPVGEVNGCMQFIPGSNRYEVLKHRSPGNDKTLHPLECCDDFPRSQAVAVPLPAGGCTVHDMRTLHYTGPNTSDAPRLAYILIFNVPPTYKPGLRKFEWLEGRRTDSQVRKREWHRRGGIAVEVMRRLPRARLTNGRWMAWAAIRAVSKVWNRAR
>NZ_CP016172.1|WP_066652532.1|62643_65262_+|DUF4401-domain-containing-protein
MQVDSQYAAGYEVHIWRAFLARATLALGLLLLASAAICGVAANWDAMTKAQRLAGAQGVLIVSAVLAAWLYRRPAATPIRAHGRACVVGLAAVLLGALLALVGQTYQTGADTWELFAGWAVLLLPWAVAARSQGVWLLWIVVANLALALLLGERVLSWWIVFGGPGFPSLVVSAANMFMLAIWEYSARRWHSRTGVGPRVLALLAVGVLTLALMFGESVVEGLGTYTGVAWVAVTLALGYYYLRVRLDLVVLALLAAAIVCVSLRVVGEWLLRVEPGVWVALPLAALLMGEAVVAARWLRRLAAGPGAARGDSEPQGASAGVAVEPVTVDTTTAQLGPRALRRTAAPWYVQGLLGLSAWMATLLVLAFVFMSGLVQSAPAALVIGLILCGAAVAIARNARQPFWRQCATALGFAGQILVAVGLSDANSVTSAALLMLVLSAAVYVLAPDAILRFLSGLMMASALFVLTAFNVGNKALYVQVLDWMAFDAVRGLVIWLPACVFAAWLAASAFLARERMPAALRDVVQPLAWAFSLAAQVSALQAAGVPVWQLPSLWQLHPPAAIFLVLAALLPAAVAWMVIRARGAALPGTIRVGVPLGLLLLAVCWLPSPGVAFALTWLLLGFGLGRPRLRRWGQAALLIYLVLYYYQLDVPLLQKAAWLAAAGVVLLLLRVLIWRLVRRAEVRASADQALADVAAAPVRSQPLWAGMMLAGLVLVLAVVNVGIWQREQLLATGQVVRLALAPVDPRALMQGDYMALHFAAARAVGALQDGDAAPPGLWGGPRTDGYLVLVPDEQGIAQPLRVQPAAQPHSGKEVVLRYRLRADGVRLVTNAYFFPEGEAARYETARYGELRVGDDGTALLVRLLGPDLQPL
>NZ_CP016172.1|WP_066664419.1|65249_66134_-|tRNA-glutamyl-Q(34)-synthetase-GluQRS
MDYIGRFAPSPSGPLHAGSLVAALASYLDSRAHAGAWLLRIEDVDAPRTVPGADRLIMQQLQALGLCWDGDVLWQSDRDAAYRAAFEQLSAQGLVYGCACTRREIIDNHAALARPQTALVDGERPYAGTCRNGLPPGRRPRAWRVRVPPGEETFVDRWLGPQRQDVAHAVGDFVLRRADGMWAYQLAVVVDDAAQGVTDIVRGADLLSSTARQRVLARLLGLPSPRVMHVPLVLDPITGLKLSKQNHAPPLDLSRPTHELARAWRALGFAPIAAETPAAFLAAATRQWAARYNG
>NZ_CP016172.1|WP_066652533.1|66207_66669_-|DUF494-domain-containing-protein
MFDILVYLFENYYTPQACPAADVLAKRLAAAGFEHEDIDDALGWLYGLAETTERCVDLAQQPATGTRIYTDSEYRQLGSEAIGFITFLETAGVLPAPLREIVIDRALAAPESPVPLSKLKITALMVLWSQEADIDNLVLEELLDDDGDVRCLH
>NZ_CP016172.1|WP_066664421.1|66932_68078_+|DSD1-family-PLP-dependent-enzyme
MDVAGGGTPLPALAPPAHIGDALSMVDTPSLVLDLDAFERNLQVMQDWADRCKVALRPHAKAHKCPEVALRQAALGARGICVQKVSEALPFVAAGIRDIHVSNEVVGEAKLRLLAALSRQARMSVCVDHASNVAELSRAVAAQGGRIDVLVELDVGQGRCGVASPTAALELARRIESLPGLRFAGLQAYHGSLQHKRGHIERANACREAAARARECARVLGEHGYACPIITGSGTGTAEFDGPGKVYTELQAGTYPFMDADYGDNEWAGPLAFGNSLFLLSSVMSTPSADRVVLDAGLKSTTVECGLPRVHDRPGLIYSAANDEHGVVRVAAGAAAPALGEKLLLVPSHCDPTFNLHDTLVAVRGGVVEGLWPIAARGLSR
>NZ_CP016172.1|WP_066652534.1|68186_68915_-|amino-acid-ABC-transporter-ATP-binding-protein
MPLIALEDVRKSFGATEVLKGVTLRIDPGEVIAIIGRSGSGKSTLLRCVNGLETIDSGSIMVADAKLGDDDLHLRALRLKVGMVFQQFNLFPHLTAGRNVMLSPMVTRKLPEAEARALARIMLEHVGLAHKFDAWPDQLSGGQQQRVAIARALAMQPIALLCDEITSALDPELVNEVLAVVRDLADDGMTLLMVTHEMRFAREVCDRVVFMHEGRVHEMGAPDEVFDAPRTPELRHFLGMAN
>NZ_CP016172.1|WP_066652535.1|68895_69552_-|amino-acid-ABC-transporter-permease
MIEFTLWDIVRNLLMAARWTIGLAAVAFAGGSVLGLLVLAMRVARPAWLRRAAWAYIELFQGTPLLMQLFLAFFGLALAGMDVPAWLAACTALVLWSAAFLAEIWRGCVEAIPRGQWEASASLAMSYGQQLRHVILPQALRIAVAPTVGFAVQIIKGTALTSIIGFTELSKASTIITNATFNPFTVYAVAAIIYFLLCWPLSRASQRLERKLNASHRA
>NZ_CP016172.1|WP_066652538.1|69548_70217_-|amino-acid-ABC-transporter-permease
MAYRFDFLAVADYAPVLLKGLAVTVELIAVGALAGVAVGIACAWARTQGPRWTRPPVTAYVELVRNTPFLIQLFFIFFGLPSIGVQLSEMQAACLAMAINLGAYSAEIIRAGIAATPPGQYEAGLSLAMTRMQIFRHVVLGPALARIWPALSSQIVIVMLGSAVCSQIAAEDLSFAANFIQSRNFRPFEIYIVTTLIYLALAIALRQLLRLTGRRIFGRRPA
>NZ_CP016172.1|WP_066652539.1|70223_71006_-|transporter-substrate-binding-domain-containing-protein
MNRRHLLLTLCAAATLCAAGPVRADALQDVLKTGRIRIAVPQDFPPFGSVGPDLKPLGYDIDTARLIGQRLGVVVELVPVTSANRIAYLQTGKVDLVISSMGKNAEREKVIDFSAAYAPFFNGVFGPATVKASSAQDLDGKTIGVTRGAVEDIELSKIAPAGATIKRYEDNNGTISAFLSGQVQLVATGNVVAAAILARNPPKKPETKFLIKDSPCYIGLNKNEPALKARLDTILAQAKQDGSLNAISRKWLGADIPAGL
>NZ_CP016172.1|WP_066652541.1|71330_72350_-|hypothetical-protein
MEEARSVSDLSQWIGKITSGKIRDIKEITLETRLLGLNAAIEASHVGEAGRGFAIVAGRVREVSERVEALANSLQAELRELGDSVTRELRRSRGQRLADLALNAIETIDRNLYERTCDVRWWASDTAVTDALCTPGGEPGDQAARHATQRLAVILDTYTVYLDIWIVDTSGKVLCNGRPASYPGAANHDVSAASWFRQALACRGPDDYASCDIECVPALGGAQAAIYAAPVHQPGGGAAVGVLAVFFDWRKQSAGVLANVRLAPEPGRSVRCMLVDARQRIIASTDGKGLLTDHFSLRLNEEKSGYYSEGDTLCGYAHTPGYETYPGMGWYGVVVDQAA
>NZ_CP016172.1|WP_066652544.1|72598_73288_-|GntR-family-transcriptional-regulator
MPASRNMVDTSAEHIAQDIASAIVGHRLPPGTRLREEALARAYGVSRTKIRAALLMLSKDKLIRTVPDKGAFVSKPSAAEAREIFAVRRILETAMAREFVARARPADYKRLEQHLRHERKAVAAGDAQLRNRLLGDFHILLAEIAGNSVLTEVLREMSARSAVLTVLYQSTADAACSSEEHHAFLAAARAGDADEACRLMIEHLQHVEAALDFDADAAPDGDLVAALLT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP016172_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016172_2

4302162-4302274

Orphan

Consensus_repeat	Method
CCTTTCGCCCCTTTGGTTCCTTT	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP016172_2

>merge|NZ_CP016172|2|4302162-4302274|CRISPRCasFinder
CCGCAAGCCCCCTTGGTCCCTTTCGCCCCTTTGGTTCCTTTTGCCCCTTTAGTTCCTTTTGCCCCTTTAGTTCCTTTTGCCCCTTTGGTTCCTTTGGCTCCTTTGGTTCCTCG

>NZ_CP016172|2|2|4302162-4302274|CRISPRCasFinder
CCGCAAGCCCCCTTGGTCCCTTT	CGCCCCTTTGGTTCCTTTTGCC
CCTTTAGTTCCTTTTGCCCCTTT	AGTTCCTTTTGCCCCTTTGGTT
CCTTTGGCTCCTTTGGTTCCTCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016172.1\|WP_066660952.1\|4308815_4309430_-\|fumarate-hydrolyase	unknown	unknown	gnl\|CDD\|224751
NZ_CP016172.1\|WP_066660947.1\|4304525_4306178_+\|thiamine-pyrophosphate-binding-protein	unknown	unknown	gnl\|CDD\|223107
NZ_CP016172.1\|WP_066660925.1\|4295038_4295647_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|119344
NZ_CP016172.1\|WP_066660949.1\|4307082_4308819_-\|FAD-binding-protein	unknown	unknown	gnl\|CDD\|235758
NZ_CP016172.1\|WP_066660936.1\|4299789_4300194_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016172.1\|WP_066660962.1\|4311855_4312203_-\|succinate-dehydrogenase	unknown	unknown	gnl\|CDD\|239577
NZ_CP016172.1\|WP_066660933.1\|4296667_4298575_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223348
NZ_CP016172.1\|WP_066660953.1\|4309432_4310308_-\|fumarate-hydratase	unknown	unknown	gnl\|CDD\|377546
NZ_CP016172.1\|WP_066660935.1\|4298571_4298937_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016172.1\|WP_084025869.1\|4306203_4306986_+\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
NZ_CP016172.1\|WP_157122336.1\|4294697_4295036_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016172.1\|WP_066660931.1\|4296197_4296671_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
NZ_CP016172.1\|WP_157122537.1\|4310394_4311333_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP016172.1\|WP_157122340.1\|4312202_4312916_-\|4Fe-4S-dicluster-domain-containing-protein	unknown	unknown	gnl\|CDD\|223555
NZ_CP016172.1\|WP_066660945.1\|4300601_4301780_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271177
NZ_CP016172.1\|WP_084026090.1\|4311502_4311856_-\|succinate-dehydrogenase,-cytochrome-b556-subunit	unknown	unknown	gnl\|CDD\|239581
NZ_CP016172.1\|WP_084025868.1\|4303434_4304472_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
NZ_CP016172.1\|WP_066660927.1\|4295673_4295904_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016172.1\|WP_066665558.1\|4299296_4299800_+\|DUF1643-domain-containing-protein	unknown	unknown	gnl\|CDD\|377919
NZ_CP016172.1\|WP_157122338.1\|4296021_4296201_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP016172.1\|WP_157122537.1\|4310394_4311333_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	6.50738e-137
NZ_CP016172.1\|WP_084025868.1\|4303434_4304472_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	3.5362e-97
NZ_CP016172.1\|WP_066660925.1\|4295038_4295647_+\|hypothetical-protein	gnl\|CDD\|119344	cd06552, ASCH_yqfb_like, ASC-1 homology domain, subfamily similar to Escherichia coli Yqfb. The ASCH domain, a small beta-barrel domain found in all three kingdoms of life, resembles the RNA-binding PUA domain and may also interact with RNA. ASCH has been proposed to function as an RNA-binding domain during coactivation, RNA-processing and the regulation of prokaryotic translation.	3.2005e-05
NZ_CP016172.1\|WP_066660949.1\|4307082_4308819_-\|FAD-binding-protein	gnl\|CDD\|235758	PRK06263, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed.	2.3144e-167
NZ_CP016172.1\|WP_066660962.1\|4311855_4312203_-\|succinate-dehydrogenase	gnl\|CDD\|239577	cd03497, SQR_TypeB_1_TM, Succinate:quinone oxidoreductase (SQR) Type B subfamily 1, transmembrane subunit; composed of proteins similar to Bacillus subtilis SQR. SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. Bacillus subtilis SQR reduces low potential quinones such as menaquinone. SQR is also called succinate dehydrogenase (Sdh) or Complex II and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Members of this subfamily are classified as Type B as they contain one transmembrane subunit and two heme groups. The heme and quinone binding sites reside on the transmembrane subunit. The transmembrane subunit of Bacillus subtilis SQR is also called Sdh cytochrome b558 subunit. The structural arrangement allows efficient electron transfer between the catalytic subunit, through iron-sulfur centers, and the transmembrane subunit containing the electron acceptor (quinone). The reversible reduction of quinone is an essential feature of respiration, allowing transfer of electrons between respiratory complexes.	2.6883e-05
NZ_CP016172.1\|WP_066660933.1\|4296667_4298575_+\|hypothetical-protein	gnl\|CDD\|223348	COG0270, Dcm, Site-specific DNA methylase [DNA replication, recombination, and repair].	4.11067e-29
NZ_CP016172.1\|WP_066660953.1\|4309432_4310308_-\|fumarate-hydratase	gnl\|CDD\|377546	pfam05681, Fumerase, Fumarate hydratase (Fumerase). This family consists of several bacterial fumarate hydratase proteins FumA and FumB. Fumarase, or fumarate hydratase (EC 4.2.1.2), is a component of the citric acid cycle. In facultative anaerobes such as Escherichia coli, fumarase also engages in the reductive pathway from oxaloacetate to succinate during anaerobic growth. Three fumarases, FumA, FumB, and FumC, have been reported in E. coli. fumA and fumB genes are homologous and encode products of identical sizes which form thermolabile dimers of Mr 120,000. FumA and FumB are class I enzymes and are members of the iron-dependent hydrolases, which include aconitase and malate hydratase. The active FumA contains a 4Fe-4S centre, and it can be inactivated upon oxidation to give a 3Fe-4S centre.	1.5471e-117
NZ_CP016172.1\|WP_066660952.1\|4308815_4309430_-\|fumarate-hydrolyase	gnl\|CDD\|224751	COG1838, FumA, Tartrate dehydratase beta subunit/Fumarate hydratase class I, C-terminal domain [Energy production and conversion].	1.89035e-44
NZ_CP016172.1\|WP_066660931.1\|4296197_4296671_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	2.04174e-07
NZ_CP016172.1\|WP_157122340.1\|4312202_4312916_-\|4Fe-4S-dicluster-domain-containing-protein	gnl\|CDD\|223555	COG0479, FrdB, Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion].	2.7207e-67
NZ_CP016172.1\|WP_066660945.1\|4300601_4301780_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271177	cd00796, INT_Rci_Hp1_C, Shufflon-specific DNA recombinase Rci and Bacteriophage Hp1_like integrase, C-terminal catalytic domain. Rci protein is a tyrosine recombinase specifically involved in Shufflon type of DNA rearrangement in bacteria. The shufflon of plasmid R64 consists of four invertible DNA segments which are separated and flanked by seven 19-bp repeat sequences. RCI recombinase facilitates the site-specific recombination between any inverted repeats results in an inversion of the DNA segment(s) either independently or in groups. HP1 integrase promotes site-specific recombination of the HP1 genome into that of Haemophilus influenza. Bacteriophage Hp1_like integrases are tyrosine based site specific recombinases. They belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	4.75033e-13
NZ_CP016172.1\|WP_084026090.1\|4311502_4311856_-\|succinate-dehydrogenase,-cytochrome-b556-subunit	gnl\|CDD\|239581	cd03501, SQR_TypeA_SdhC_like, Succinate:quinone oxidoreductase (SQR) Type A subfamily, Succinate dehydrogenase C (SdhC)-like subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. Members of this subfamily reduce low potential quinones such as menaquinone and thermoplasmaquinone. SQR is also called succinate dehydrogenase or Complex II, and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Members of this subfamily are similar to the Thermoplasma acidophilum SQR and are classified as Type A because they contain two transmembrane subunits as well as two heme groups. Although there are no structures available for this subfamily, the presence of two hemes has been proven spectroscopically for T. acidophilum. The two membrane anchor subunits are similar to the SdhD and SdhC subunits of bacterial SQRs, which contain heme and quinone binding sites. The two-electron oxidation of succinate in the flavoprotein active site is coupled to the two-electron reduction of quinone in the membrane anchor subunits via electron transport through FAD and three iron-sulfur centers. The reversible reduction of quinone is an essential feature of respiration, allowing transfer of electrons between respiratory complexes.	1.24257e-12
NZ_CP016172.1\|WP_066660947.1\|4304525_4306178_+\|thiamine-pyrophosphate-binding-protein	gnl\|CDD\|223107	COG0028, IlvB, Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism].	2.02464e-108
NZ_CP016172.1\|WP_084025869.1\|4306203_4306986_+\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	1.09085e-11
NZ_CP016172.1\|WP_066665558.1\|4299296_4299800_+\|DUF1643-domain-containing-protein	gnl\|CDD\|377919	pfam07799, DUF1643, Protein of unknown function (DUF1643). The members of this family are all sequences found within hypothetical proteins expressed by various bacterial species. The region concerned is approximately 150 residues long.	7.03113e-42

>NZ_CP016172.1|WP_066660945.1|4300601_4301780_+|tyrosine-type-recombinase/integrase
MGRSKTTGIYPAADGTYEVDAYYRKQRIRKRSFARYEDAEAFLIDAKARIGAGTALGQRPKTTLDFAAAHHLTLKQEMPSWETDRYLLTPVVEECGSLTLDEISDETLQPFLKRRIADGVKNGTINDALSIVQTICNRAATVWRHPNGMTWLEYPPKLTMLDESDKRPPRPISWAEQRALLPLMPPHLEKMALFNLNTGLREDPLVHLSWHWEARVPLADGLIVSVFVVPRRHVKGRKAERIVVCNSVAQSIIESQRGRHPDRVFTYAQRTKIGSKTKAKHRPVGSMNNTAWQNARSKAGLGDLHVHDLRHTVGMRLRDAGVAPRTQDEILWHSKAGMTNHYAIAMVRELYEALELIKQPGEAGDSANLLALVRSIQMQQVPQKSPSERKAA
>NZ_CP016172.1|WP_066660936.1|4299789_4300194_+|hypothetical-protein
MDDSKELLRRAAKAAGGLDWQWWTSNSYRRLTFKNGQNTRDGGALSGTVHPHDKWPDVSMAPGVQEFIERASPKAVLSLLDRIAELEAALRPFSAAAPDWTIDIKDNRWIDSRHNIYVGDLRRAAAALGGDDVQ
>NZ_CP016172.1|WP_066665558.1|4299296_4299800_+|DUF1643-domain-containing-protein
MSAILSPCGTYRYRLERTVGMVGPVYAFFGINPSTADASMDDATVRKWIGFTKRWGASRFIVGNVWPLRATDVRLLARSTRWRDIGLENERHILAMAAEADVLVPCWGDRKKVPRAMHNEIDELLSLLRGTRKPIMHFGLTASGDPKHPLMLAYDTPLIPWEVSDGR
>NZ_CP016172.1|WP_066660935.1|4298571_4298937_+|hypothetical-protein
MNTMTLDEFHAACKAQAKSAEVIVFKCPMCATLQTARELIAADAGPDFDAVERYLGFSCIGRFTGAAGPRRQPDGLPCDWTLGGLFRTHRLEVITPDGLHHPRFELAMLEEAQAHRASKGL
>NZ_CP016172.1|WP_066660933.1|4296667_4298575_+|hypothetical-protein
MIRNQFVLDVHPEILVDNFAGGGGASTGIEMALGRCVDIAINHDPEAVAMHEINHPQTRHYCESVWDVDPVEATQGRPVGLAWFSPDCKHFSKAKGGKPRDKRIRGLAWIVLRWAALVRPRVIMLENVEEFRTWGPLLESGQPCPARKGQTFRSFIHQLQEKGYAVEHRELRACDYGAPTIRKRLFLIARCDGQPIVWPEPTHGAPTSPEVQAGQRKPWRTAADCIDWSIPCPSIFERQRPLAEATLRRIARGIRRYVIDAAQPFIVGAGGPVYSGKPVPANRPFGALTTENHRHVVVPHITKFRTGSTGAALGEPMPTITAGPKENPAGAPHAVGIVAPSLVKVNHGGDDFRGRPLDAPIATLTGKHGTGIVAPTLVQAGFGERPGQAPRCLDLHKPLGTVTAQGRKHALVSAFLAKHYGGNYDGPGLPLGGPMHTATTVDHHAVVAAQLVGCGGRAGQSRPRDAGEPAQTLTAKADTCVVTSHLAKLRNNQFGQATDEPMPTLTAGGGHVADVRAFLVKYYSEGGQDQDCRDPMHTIPTKDRIGLVTVAGQEYVIADIGMRMLEPHELYAAQGFPGDYIIAPTINGRRLPKHAQVRMCGNSVCPPLAAALVRANVSDLSAWTPREAKEKRVAA
>NZ_CP016172.1|WP_066660931.1|4296197_4296671_+|class-I-SAM-dependent-methyltransferase
MTAAILDPCCGGRSFWFDPQHQGVLFGDIRSEQHTLCDGRAFNITPDLNMDFRAMPFADESFRLVVFDPPHLRRAGRDSWLRAKYGLLGDDWQDDLRRGFAECFRVLKPEGLLIFKWNETQIPVSKILPLAMARPLFGHKSGKRVDTHWITFMKDVA
>NZ_CP016172.1|WP_157122338.1|4296021_4296201_+|hypothetical-protein
MDQLALFDQQPQQPKSAEQLTYEAWPFPGLSWEQHQEIQAEWKAYAEKRRREQHRRIAA
>NZ_CP016172.1|WP_066660927.1|4295673_4295904_-|hypothetical-protein
MAKPVITPQQFIAEANKRLPANVQLFLTPRGATIETATGYDWTNRDSLNAVTAVKLVVDQLAEQYEVHPALTVGGG
>NZ_CP016172.1|WP_066660925.1|4295038_4295647_+|hypothetical-protein
MRERPILFSAPMVRAILAGTKTQTRRVVKPAKDRDIGCALAPCELAGEINRGEYRNSWYGKIGDRLWVRETHLNSWRINPEDPTGPRVFSHVAAFAADGHELSPGEKWIPSIHMLRAASRITLEITGVRVERLQQITAADARAEGILARGCLSCSEPEPCGCSSPHSSSLDDFRSLWLDINGPRSWNANPWVWVVEFRRVEA
>NZ_CP016172.1|WP_157122336.1|4294697_4295036_+|hypothetical-protein
MLLHTSLWCLDNQPNSEAFNNLARIFNVVGLALENDFRHQQEARLIAGGASALNQVMRKVEAGLKLSEHESAPIRVAINSMDSLLGRLSVTDLYLAMKRLDRIEDANVQEGV
>NZ_CP016172.1|WP_084025868.1|4303434_4304472_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MEPTPVRVSRPRAAARRPIARVLLAFAASISCSAPLHAQGSDAAYPDRPITVVVPFSAGGDADLAARNLAKAAHGILPQPLVVLNKGGANGAIGSQYVREAAPDGYTLLLARVGPQAILPALQPSLKYKWNDFTPLGLLDLNPMVCVVNGDAPYRTLRDLLDAIKAQPGKLNYSTSGPATALNLATQVLLDAAGLPRHAAAEIVYKGGGEATAAVLSKEVQFSCNNVTALIGNVKAGRLRALVTTTARPLTELPDVPTARQAGFPQLERVNGWSALYGPPGMPRPLVERWANLLGRLAEDKDWVAGVQNIGSIPNILSPGDTTQFVSEQYRMFSDLGTKLGIQIK
>NZ_CP016172.1|WP_066660947.1|4304525_4306178_+|thiamine-pyrophosphate-binding-protein
MTRSRNGADALVQTLASAGVKRIFTLSGNHIMPVFNACLDADIQLVHVRHEGAAVHMADAWARLTGEIGVAMVTGGPGHANAVSALYTAQMAEAPVLLLSGHAPNGQLGMGAFQEMRQAEVAAPLTKWSGTVASADRMALEVGTAIRIARSGRPGPVSLGLPTDALESACAAPADAPQSFDAIAQALAPEVAASLLRRLQAAQRPLILTGPAAMMGAARDRARELEAACGIAVIGMESPRGIGDPALGAYAQVLAQADCILLLGKRLDFTLKFGKAPALAADCVFLQVDAEAAEFERTRRAVGPRLLECALADTRSALQALIQAAAPTGGRHDAWTRDVHDAVAYRPADWQTASSSMPDRMHPVQALAPLQRLLDSDPDSVLICDGGEIGQWAQACLSAPTRVINGVAGSIGAALPFALAARMARPHAPVVTVMGDGTFGFHTAEIDTAVRYKLPFIAVVGNDARWNAEYQIQLRDYGPDRLIGCELLPARYDAVTAAFGGFGRQVTDPRQVAAAVDEARRSGLPACLNIMIEGLAAPNISRPSATPATA
>NZ_CP016172.1|WP_084025869.1|4306203_4306986_+|sulfite-exporter-TauE/SafE-family-protein
MWNFLVVHLGPAATGIGPLALLGAGAAIAMAYTIFGMTGFGSAIVAMPMLTQLMPLHHAVPIMLICDMIGGMLVGASSRSAVHMAELRRVAPWMLLGMLIGLGLLMSVPERPLLIVLGAGVLLYSLWRLRASDIFRPLAPGWAIPLGISGGGFTAMFGTGGPLYTIYLAGRLRDRNELRATIGTLIMLTGLTRLVMFTATGLLLDPAVLALAAWLLPCSLVGLRCGTWLRHRVKPAYIGRLLWTVLIIGSASLLVRALAG
>NZ_CP016172.1|WP_066660949.1|4307082_4308819_-|FAD-binding-protein
MSPAVPIKRMKTDILILGAGGAGLFAALHAHQRAPGLSITVAVKGLLGKCGCTRMVQGGYNVALAPGDSVERHFMDTIEGSKWLSNQDLAWTLVSTAIERIHELENELGCFFDRNPDGTVHQKAFAGQTFDRTVHKGDLTGIEIINRLSEQVWRRGIGRLEEHRALALIKTADGQALAGVLMVDVRSGEFVFVQAQAVLLATGGGPTMYKYHTPSGDKSCDGLAMALAAGLPLRDMEMVQFHPTGLLAGTETRMTGTVLEEGLRGAGGYLLNGDKERFMHRYDPRGERATRDIVSRGIYAEMRAGRTTPNGGVYIQMEHLGVDQVRKQFKGMVERCADCGFDLAGGLVEVVPTAHYMMGGVVFEPDCRTALRGLFAAGEDTGGVHGANRLGGNGVANSTVFGGIAGDSMAEWVGREGAWQIADEHAIEVAVRDALAPFQRPAQTLNPIREALYDCMWTDVGIMRDAQGLLRARGTLAQLQDRLSGVGVAGGERAFNPTWHDWLNLRSLITVSQVITEAALAREDSRGAHFREDFPQAGELAGSAYTVVRRQDDATHITREPVHFTRVAPGETLLRNAA
>NZ_CP016172.1|WP_066660952.1|4308815_4309430_-|fumarate-hydrolyase
MAHHELSMPITEAQVRQLRVNDTVTLQRTLYGIRDATQIHMFDRGRTTRLDLNGHAVIHTAPNVRKVPVSDDFPAGYQPVCIGTTTSDRMERFTQPLMAQYGVRLIIGKGGLRQASQDAFRELGGAYLAIIGGTAALETTWIERIEDVDLDDLNPESLWRFRIRDFGPLLVAMDSHGGSLYDTVKQDTADRRAAVLASLGVAAS
>NZ_CP016172.1|WP_066660953.1|4309432_4310308_-|fumarate-hydratase
MKPDLAAVEEAAKALYIRALKMLPPDIKQGIDTLASRERSEVARGVLETMRTNIRVAEDNDNLLCQDTGIPIYNVSIGRDVDVDGHALKEAIRKGCERATREHPLRSSVVHPLTRRNNHTSCGIEVPVIHIDFDDTPERLSIEMIPKGSGSENNSFLKMAVPAEGVDAIKTFVVDCVIAAGGKTCPPTIVGVGVGGTSDLCVALAKRAATRPLGSHCEDPEGAALEAALSEAVNQLGVGPQGLGGDGTAFAVHIELAATHITMNPVAVNMQCHSARRSRAVFTPQGTAYGF
>NZ_CP016172.1|WP_157122537.1|4310394_4311333_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MTATTLSGVVYADEPWPSKPVRIVVPFTAGGTTDVVARVLGARLGEMWHQSVIIDNRPGAGGAIGATMTAKSPPDGYTLLMASGSMFTVNPYLYRNLPYTLKDFDYITNVASGPMLVLVNDAVPARSLKELIALAKSQPKKLNFGSAGNGSQVHMAAEALAEAAGIDITHVPYKGEALAYNDLLAGQVQMVVGNIAAASTFAKSGRARALAVTGPARSPMMPDVPTAKEAGLPGYETVGWFALVTAAGTPQDIIDKVQRDTAKVLAEPAIRDKLASQGMTAVGNTPAELRKGIETESAKWKTVVSHRNLSID
>NZ_CP016172.1|WP_084026090.1|4311502_4311856_-|succinate-dehydrogenase,-cytochrome-b556-subunit
MRRNDVRARNHPAYWAFLVHRLSGLALALFLPLHFWALGQAIAGEAALDGFLRFADRPLFKFAEWGLVVLLSLHLMGGLRILVIEFAPWHHLRKDWLAVGLGASACTGLAFLLALVH
>NZ_CP016172.1|WP_066660962.1|4311855_4312203_-|succinate-dehydrogenase
MAALSVRTQARLWYLQRVSAMVMAVFVAVHIGIIVYAVRGGLSGGEILARTQGSVGFAAFYGLFVLACAVHVPIGLLRIAEEWLRWRGPSAAVAALAFGLLLAGMGLRAVYGVVA
>NZ_CP016172.1|WP_157122340.1|4312202_4312916_-|4Fe-4S-dicluster-domain-containing-protein
MDTLQVKVWRSAGDGGFVTYPVPRHTSQTVLDVVTYIQRELEPDLGYRYACRVGMCGSCAMTVNGKARWTCRTHVSKVAADGRLEVAPLSNLPVIKDLVTDMSAFFDKWSQAKGTFEGAQTRHDDFARVPPASPQRQAVDAGIECIGCGVCYASCDVVTWRPDYLGPAALNRAWTLMNDERDVQGSERLRAVAGDAGCHSCHTLGSCTERCPKALAPTAGIAGLKRMAAKAAMKGEL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1468805 : 1487546

Sinorhizobium_phage(37.5%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157122043.1\|1468805_1469255_-	hypothetical protein	C7BGF7	Burkholderia_phage	3.1e-07	42.3
WP_084025424.1\|1469992_1470586_+	ribonuclease HI	I6R1E6	Croceibacter_phage	7.1e-20	43.8
WP_066655098.1\|1470548_1470749_-	hypothetical protein	NA	NA	NA	NA
WP_066655100.1\|1470794_1471097_-	BrnA antitoxin family protein	A0A2H4J5Y5	uncultured_Caudovirales_phage	2.8e-20	54.6
WP_066664950.1\|1471074_1471359_-	hypothetical protein	NA	NA	NA	NA
WP_066655102.1\|1471430_1471817_+	hypothetical protein	R9TNL4	Vibrio_phage	9.6e-26	55.0
WP_066655103.1\|1471838_1472168_+	hypothetical protein	NA	NA	NA	NA
WP_066655105.1\|1472227_1472668_+	hypothetical protein	NA	NA	NA	NA
WP_084025426.1\|1472714_1473050_+	hypothetical protein	W8VYP4	Pseudomonas_phage	3.3e-14	50.5
WP_066655108.1\|1473359_1473845_+	hypothetical protein	NA	NA	NA	NA
WP_066655110.1\|1474110_1474680_+	hypothetical protein	NA	NA	NA	NA
WP_066655111.1\|1474679_1475354_+	recombinase family protein	Q1MVP4	Enterobacteria_phage	9.5e-13	31.5
WP_066655112.1\|1475406_1476813_+	hypothetical protein	A0A1B1INQ9	uncultured_Mediterranean_phage	3.8e-136	55.0
WP_066655118.1\|1476864_1477281_+	hypothetical protein	G1JW56	Mycobacterium_phage	2.1e-10	44.6
WP_066655120.1\|1477290_1477824_+	hypothetical protein	NA	NA	NA	NA
WP_066655122.1\|1477839_1478064_+	hypothetical protein	NA	NA	NA	NA
WP_157122046.1\|1478092_1478314_+	hypothetical protein	NA	NA	NA	NA
WP_066655126.1\|1478314_1480585_+	hypothetical protein	A0A1Y0T151	Sinorhizobium_phage	1.8e-135	45.0
WP_066655128.1\|1480588_1480870_+	hypothetical protein	NA	NA	NA	NA
WP_066655130.1\|1480912_1481974_+	hypothetical protein	A0A1Y0SVF7	Sinorhizobium_phage	4.2e-23	34.3
WP_084025428.1\|1481977_1482952_+	DUF5309 domain-containing protein	A0A1Y0T0F4	Sinorhizobium_phage	1.1e-91	55.8
WP_066655132.1\|1482987_1483302_+	hypothetical protein	A0A1Y0T0P7	Sinorhizobium_phage	4.4e-13	40.4
WP_066655134.1\|1483304_1483943_+	hypothetical protein	A0A1Y0T3P1	Sinorhizobium_phage	1.3e-30	37.7
WP_157122049.1\|1483942_1484350_+	hypothetical protein	NA	NA	NA	NA
WP_066655136.1\|1484361_1484760_+	hypothetical protein	A0A1Y0T1T3	Sinorhizobium_phage	8.4e-25	48.8
WP_157122052.1\|1484810_1485575_+	hypothetical protein	NA	NA	NA	NA
WP_066655142.1\|1485585_1486368_+	hypothetical protein	NA	NA	NA	NA
WP_084025430.1\|1486390_1486828_+	hypothetical protein	A0A1S5NV54	Burkholderia_phage	4.1e-17	40.0
WP_084025432.1\|1486842_1487043_+	hypothetical protein	NA	NA	NA	NA
WP_066655143.1\|1487039_1487546_+	lysozyme	A0A0U4JP67	Pseudomonas_phage	4.5e-31	53.7

DBSCAN-SWA_2

4259505 : 4299800

Pseudomonas_phage(21.88%)

tail,portal,head,capsid,protease,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066660806.1\|4259505_4260192_+	hypothetical protein	A0A1S5NTJ1	Burkholderia_phage	1.2e-18	33.1
WP_066665552.1\|4260905_4261085_+	DUF3606 domain-containing protein	NA	NA	NA	NA
WP_066660812.1\|4261088_4262078_+	hypothetical protein	A0A291AUP8	Sinorhizobium_phage	2.5e-41	36.6
WP_066660815.1\|4262146_4262326_+	type II toxin-antitoxin system HicA family toxin	A0A2H4JDU5	uncultured_Caudovirales_phage	3.8e-09	57.6
WP_066660835.1\|4262387_4262804_+	type II toxin-antitoxin system HicB family antitoxin	A0A0R6PH90	Moraxella_phage	7.9e-42	63.5
WP_066660837.1\|4262804_4263596_-	DNA adenine methylase	Q5ZQW7	Pseudomonas_phage	1.1e-119	76.5
WP_157122320.1\|4263741_4264260_-	hypothetical protein	NA	NA	NA	NA
WP_157122322.1\|4264743_4265205_-	hypothetical protein	NA	NA	NA	NA
WP_066660843.1\|4265219_4265750_-	glycoside hydrolase family 19 protein	A0A059VA40	Pseudomonas_phage	7.0e-43	59.5
WP_066660845.1\|4266000_4266417_-	hypothetical protein	NA	NA	NA	NA
WP_066660847.1\|4266431_4269998_-	host specificity protein J	Q8W6T0	Burkholderia_virus	1.8e-264	47.3
WP_066660849.1\|4269994_4270588_-\|tail	tail assembly protein	Q6JIL3	Burkholderia_virus	9.5e-57	62.4
WP_157122324.1\|4270634_4271057_-	hypothetical protein	NA	NA	NA	NA
WP_066660857.1\|4271069_4271846_-	C40 family peptidase	Q8W6T2	Burkholderia_virus	1.2e-67	50.4
WP_066660858.1\|4271855_4272581_-\|tail	phage minor tail protein L	Q6JIL5	Burkholderia_virus	1.2e-69	56.6
WP_066660859.1\|4272583_4273129_-	hypothetical protein	NA	NA	NA	NA
WP_066660860.1\|4273125_4274406_-	hypothetical protein	Q5ZGD1	Flavobacterium_phage	3.2e-17	30.0
WP_066660861.1\|4274406_4274742_-\|tail	phage tail protein	A0A0S2SYI2	Pseudomonas_phage	2.0e-24	48.6
WP_066660868.1\|4274741_4277573_-\|tail	phage tail tape measure protein	A0A2H4J7J3	uncultured_Caudovirales_phage	3.2e-94	35.7
WP_066665553.1\|4277575_4277821_-	DUF1799 domain-containing protein	NA	NA	NA	NA
WP_066660871.1\|4277883_4278195_-	hypothetical protein	NA	NA	NA	NA
WP_066660874.1\|4278194_4278848_-	hypothetical protein	A0A2H4J6K6	uncultured_Caudovirales_phage	6.0e-36	42.9
WP_066665554.1\|4278910_4279264_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_084025862.1\|4279253_4279793_-	HK97 gp10 family phage protein	I7GSL4	Xanthomonas_virus	1.2e-18	41.2
WP_084025863.1\|4279785_4280145_-\|head	phage head closure protein	NA	NA	NA	NA
WP_066660877.1\|4280141_4280483_-\|head,tail	phage gp6-like head-tail connector protein	Q3HQT2	Burkholderia_phage	1.6e-16	45.7
WP_066660880.1\|4280485_4280815_-	hypothetical protein	NA	NA	NA	NA
WP_066660884.1\|4280886_4282122_-\|capsid	phage major capsid protein	A0A1P8DTJ7	Proteus_phage	2.1e-151	68.4
WP_066660887.1\|4282131_4283016_-\|protease	Clp protease ClpP	A0A0U4B0F3	Pseudomonas_phage	3.0e-83	54.7
WP_157122326.1\|4283040_4284339_-\|portal	phage portal protein	A0A0U4IJ43	Pseudomonas_phage	3.9e-156	63.7
WP_084025864.1\|4284335_4286174_-\|terminase	terminase large subunit	C7BGG7	Burkholderia_phage	1.3e-200	59.8
WP_066660894.1\|4286735_4287173_-	HNH endonuclease	F1C587	Cronobacter_phage	5.4e-17	52.3
WP_157122328.1\|4287334_4287742_-	hypothetical protein	NA	NA	NA	NA
WP_157122330.1\|4287738_4288212_-	hypothetical protein	A0A2H4J580	uncultured_Caudovirales_phage	1.4e-10	44.6
WP_157122332.1\|4288628_4288979_+	hypothetical protein	NA	NA	NA	NA
WP_066660905.1\|4289220_4289667_-	hypothetical protein	Q3HQZ3	Burkholderia_phage	2.3e-31	49.0
WP_066660906.1\|4289740_4289953_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_143277380.1\|4289970_4290372_+	helix-turn-helix domain-containing protein	Q0SPH9	Clostridium_phage	9.7e-05	38.5
WP_066660908.1\|4290567_4290828_+	hypothetical protein	NA	NA	NA	NA
WP_066660912.1\|4291105_4291312_+	hypothetical protein	NA	NA	NA	NA
WP_066660914.1\|4291336_4291684_+	hypothetical protein	NA	NA	NA	NA
WP_066660916.1\|4291684_4292575_+	DUF2303 family protein	I6NVL7	Burkholderia_virus	5.3e-27	33.9
WP_157122334.1\|4292571_4293234_+	hypothetical protein	A0A1B0XU26	Freshwater_phage	6.5e-14	29.4
WP_066660920.1\|4293777_4294614_+	hypothetical protein	C7BGF1	Burkholderia_phage	3.9e-72	55.7
WP_157122336.1\|4294697_4295036_+	hypothetical protein	NA	NA	NA	NA
WP_066660925.1\|4295038_4295647_+	hypothetical protein	A0A059VF56	Pseudomonas_phage	4.8e-40	47.6
WP_066660927.1\|4295673_4295904_-	hypothetical protein	NA	NA	NA	NA
WP_157122338.1\|4296021_4296201_+	hypothetical protein	NA	NA	NA	NA
WP_066660931.1\|4296197_4296671_+	class I SAM-dependent methyltransferase	A0A0N7IRF6	Acinetobacter_phage	1.1e-60	66.2
WP_066660933.1\|4296667_4298575_+	hypothetical protein	H9C171	Pectobacterium_phage	7.5e-164	47.9
WP_066660935.1\|4298571_4298937_+	hypothetical protein	A0A240F4V4	Ochrobactrum_phage	2.2e-32	57.4
WP_066665558.1\|4299296_4299800_+	DUF1643 domain-containing protein	B5WZV8	Pseudomonas_phage	2.1e-44	56.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP016172

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection