CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP016224	Vibrio alginolyticus strain ZJ-T chromosome 1, complete sequence	1 crisprs	cas3,DinG,csa3,RT,csx1,DEDDh,cas14j,WYL	1	1	6	0
NZ_CP016225	Vibrio alginolyticus strain ZJ-T chromosome 2, complete sequence	0 crisprs	WYL,DEDDh,csa3,cas3	0	0	158	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP016224_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016224_1

2809850-2810096

Orphan

Consensus_repeat	Method
TGCCTCCTTAGCTCAGTAGGTAGAGCAACGGACTGATAATCCG	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP016224_1

>merge|NZ_CP016224|1|2809850-2810096|PILER-CR
TGCCGACTTAGCTCAGTAGGTAGAGCAACTGACTTGTAATCAGTAGGTCACCAGTTCGATTCCGGTAGTCGGCACCATTCTTTTGCCTCGATAGCTCAGTCGGTAGAGCAGAGGATTGAAAATCCTCGTGTCGGTGGTTCGATTCCGCCTCGAGGCACCATATCTGGTGCACTTGCTTCATAAGCAAGACACAAAAAAGAATAATTCCTCCTTAGCTCAGTTGGTAGAGCGACGGACTGTTAATCCG

>NZ_CP016224|1|1|2809850-2810096|PILER-CR
TGCCGACTTAGCTCAGTAGGTAGAGCAACTGACTTGTAATCAG	TAGGTCACCAGTTCGATTCCGGTAGTCGGCACCATTCTTT
TGCCTCGATAGCTCAGTCGGTAGAGCAGAGGATTGAAAATCCT	CGTGTCGGTGGTTCGATTCCGCCTCGAGGCACCATATCTGGTGCACTTGCTTCATAAGCAAGACACAAAAAAGAATAA
TTCCTCCTTAGCTCAGTTGGTAGAGCGACGGACTGTTAATCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016224.1\|WP_017635575.1\|2804015_2805092_+\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|182805
NZ_CP016224.1\|WP_005381002.1\|2805111_2805384_+\|oxidative-damage-protection-protein	unknown	unknown	gnl\|CDD\|180059
NZ_CP016224.1\|WP_005381031.1\|2822541_2823540_-\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380494
NZ_CP016224.1\|WP_054579416.1\|2823644_2824400_-\|chitin-disaccharide-deacetylase	unknown	unknown	gnl\|CDD\|235007
NZ_CP016224.1\|WP_005381048.1\|2824417_2825740_-\|6-phospho-beta-glucosidase	unknown	unknown	gnl\|CDD\|133432
NZ_CP016224.1\|WP_065274865.1\|2821157_2822411_-\|HD-GYP-domain-containing-protein	unknown	unknown	gnl\|CDD\|225116
NZ_CP016224.1\|WP_005381001.1\|2805461_2806601_+\|membrane-bound-lytic-murein-transglycosylase-MltC	unknown	unknown	gnl\|CDD\|183271
NZ_CP016224.1\|WP_005381010.1\|2798585_2799017_+\|DUF4426-domain-containing-protein	unknown	unknown	gnl\|CDD\|379616
NZ_CP016224.1\|WP_082240161.1\|2813020_2814457_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143421
NZ_CP016224.1\|WP_065274864.1\|2802046_2803075_-\|DNA-methylase	unknown	unknown	gnl\|CDD\|223971
NZ_CP016224.1\|WP_031777269.1\|2825752_2826064_-\|PTS-lactose/cellobiose-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|224364
NZ_CP016224.1\|WP_005384506.1\|2803092_2803812_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	unknown	unknown	gnl\|CDD\|234649
NZ_CP016224.1\|WP_005381009.1\|2799135_2799738_+\|XTP/dITP-diphosphatase	unknown	unknown	gnl\|CDD\|234648
NZ_CP016224.1\|WP_005381066.1\|2828090_2829374_+\|polysaccharide-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|200570
NZ_CP016224.1\|WP_025768824.1\|2807398_2809024_+\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|223910
NZ_CP016224.1\|WP_005381064.1\|2826115_2827450_-\|PTS-sugar-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|224372
NZ_CP016224.1\|WP_025768824.1\|2810405_2812031_+\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|223910
NZ_CP016224.1\|WP_065274863.1\|2799756_2800935_+\|radical-SAM-family-heme-chaperone-HemW	unknown	unknown	gnl\|CDD\|235550
NZ_CP016224.1\|WP_065274866.1\|2827537_2827843_-\|PTS-sugar-transporter-subunit-IIB	unknown	unknown	gnl\|CDD\|99906
NZ_CP016224.1\|WP_005381007.1\|2801027_2801948_-\|glutaminase-B	unknown	unknown	gnl\|CDD\|234880

Protein	Function_ID	Function_description	E-value
NZ_CP016224.1\|WP_017635575.1\|2804015_2805092_+\|A/G-specific-adenine-glycosylase	gnl\|CDD\|182805	PRK10880, PRK10880, adenine DNA glycosylase.	0
NZ_CP016224.1\|WP_005381002.1\|2805111_2805384_+\|oxidative-damage-protection-protein	gnl\|CDD\|180059	PRK05408, PRK05408, oxidative damage protection protein; Provisional.	2.80095e-59
NZ_CP016224.1\|WP_005381031.1\|2822541_2823540_-\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|380494	cd06270, PBP1_GalS-like, ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism. Ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism. Transcription of the galactose regulon genes is regulated by Gal iso-repressor (GalS) and Gal repressor (GalR) in different ways, but both repressors recognize the same DNA binding site in the absence of D-galactose. GalS is a dimeric protein like GalR,and its major role is in regulating expression of the high-affinity galactose transporter encoded by the mgl operon, whereas GalR is the exclusive regulator of galactose permease, the low-affinity galactose transporter. GalS and GalR are members of the LacI-GalR family of transcription regulators and both contain the type 1 periplasmic binding protein-like fold. Hence, they are homologous to the periplasmic sugar binding of ABC-type transport systems.	2.30744e-113
NZ_CP016224.1\|WP_054579416.1\|2823644_2824400_-\|chitin-disaccharide-deacetylase	gnl\|CDD\|235007	PRK02134, PRK02134, chitin disaccharide deacetylase.	1.04194e-124
NZ_CP016224.1\|WP_005381048.1\|2824417_2825740_-\|6-phospho-beta-glucosidase	gnl\|CDD\|133432	cd05296, GH4_P_beta_glucosidase, Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.	0
NZ_CP016224.1\|WP_065274865.1\|2821157_2822411_-\|HD-GYP-domain-containing-protein	gnl\|CDD\|225116	COG2206, COG2206, c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms].	6.06954e-72
NZ_CP016224.1\|WP_005381001.1\|2805461_2806601_+\|membrane-bound-lytic-murein-transglycosylase-MltC	gnl\|CDD\|183271	PRK11671, mltC, membrane-bound lytic murein transglycosylase MltC.	8.90498e-147
NZ_CP016224.1\|WP_005381010.1\|2798585_2799017_+\|DUF4426-domain-containing-protein	gnl\|CDD\|379616	pfam14467, DUF4426, Domain of unknown function (DUF4426). Members of this entry are found mostly in g-proteobacteria, especially in Vibrio. Strangely enough, there seems to be one eukaryotic homolog in Nematostella vectensis (NEMVEDRAFT_v1g226006), where the PA0388-like domain is fused with a domain homogous to the Methionine biosynthesis protein MetW (see below). In several Pseudomonas species, but also in Vibrio vulnificus and Azotobacter vinelandii PA0388 homologs are genomic neighbors of Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15) and Methionine biosynthesis protein MetW. On the other hand, in most Vibrio species it appears as a part of a conserved operon involved in possible response to stress.	4.01664e-66
NZ_CP016224.1\|WP_082240161.1\|2813020_2814457_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143421	cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like. Succinate-semialdehyde dehydrogenase, mitochondrial (SSADH, GabD, EC=1.2.1.24) catalyzes the NAD+-dependent oxidation of succinate semialdehyde (SSA) to succinate. This group includes the human aldehyde dehydrogenase family 5 member A1 (ALDH5A1) which is a mitochondrial homotetramer that converts SSA to succinate in the last step of 4-aminobutyric acid (GABA) catabolism. This CD also includes the Arabidopsis SSADH gene product ALDH5F1. Mutations in this gene result in the accumulation of H2O2, suggesting a role in plant defense against the environmental stress of elevated reactive oxygen species.	0
NZ_CP016224.1\|WP_065274864.1\|2802046_2803075_-\|DNA-methylase	gnl\|CDD\|223971	COG1041, COG1041, Predicted DNA modification methylase [DNA replication, recombination, and repair].	2.25681e-08
NZ_CP016224.1\|WP_031777269.1\|2825752_2826064_-\|PTS-lactose/cellobiose-transporter-subunit-IIA	gnl\|CDD\|224364	COG1447, CelC, Phosphotransferase system cellobiose-specific component IIA [Carbohydrate transport and metabolism].	6.82212e-37
NZ_CP016224.1\|WP_005384506.1\|2803092_2803812_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	gnl\|CDD\|234649	PRK00121, trmB, tRNA (guanine-N(7)-)-methyltransferase; Reviewed.	1.04237e-109
NZ_CP016224.1\|WP_005381009.1\|2799135_2799738_+\|XTP/dITP-diphosphatase	gnl\|CDD\|234648	PRK00120, PRK00120, dITP/XTP pyrophosphatase; Reviewed.	3.88474e-123
NZ_CP016224.1\|WP_005381066.1\|2828090_2829374_+\|polysaccharide-deacetylase-family-protein	gnl\|CDD\|200570	cd10946, CE4_Mll8295_like, Putative catalytic NodB homology domain of uncharacterized Mll8295 protein encoded from Rhizobium loti and its bacterial homologs. This family is represented by a putative polysaccharide deacetylase Mll8295 encoded from Rhizobium loti. Although its biological function still remains unknown, Mll8295 shows high sequence homology to the catalytic domain of Streptococcus pneumoniae polysaccharide deacetylase PgdA (SpPgdA), which is an extracellular metal-dependent polysaccharide deacetylase with de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. Both Mll8295 and SpPgdA belong to the carbohydrate esterase 4 (CE4) superfamily. This family also includes many uncharacterized bacterial polysaccharide deacetylases.	3.64002e-70
NZ_CP016224.1\|WP_025768824.1\|2807398_2809024_+\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|223910	COG0840, Tar, Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms].	1.01442e-61
NZ_CP016224.1\|WP_005381064.1\|2826115_2827450_-\|PTS-sugar-transporter-subunit-IIC	gnl\|CDD\|224372	COG1455, CelB, Phosphotransferase system cellobiose-specific component IIC [Carbohydrate transport and metabolism].	7.08839e-153
NZ_CP016224.1\|WP_025768824.1\|2810405_2812031_+\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|223910	COG0840, Tar, Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms].	1.01442e-61
NZ_CP016224.1\|WP_065274863.1\|2799756_2800935_+\|radical-SAM-family-heme-chaperone-HemW	gnl\|CDD\|235550	PRK05660, PRK05660, radical SAM family heme chaperone HemW.	0
NZ_CP016224.1\|WP_065274866.1\|2827537_2827843_-\|PTS-sugar-transporter-subunit-IIB	gnl\|CDD\|99906	cd05564, PTS_IIB_chitobiose_lichenan, PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In these systems, EII is either a lichenan- or an N,N-diacetylchitobiose-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain. In the chitobiose system, these subunits are expressed as separate proteins from chbA, chbB, and chbC of the chb operon (formerly the cel (cellulose) operon). In the lichenan system, these subunits are expressed from licA, licB, and licC of the lic operon. The lic operon of Bacillus subtilis is required for the transport and degradation of oligomeric beta-glucosides, which are produced by extracellular enzymes on substrates such as lichenan or barley glucan. The lic operon is transcribed from a gammaA-dependent promoter and is inducible by lichenan, lichenan hydrolysate, and cellobiose. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include chitobiose/lichenan, ascorbate, lactose, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.	3.52786e-44
NZ_CP016224.1\|WP_005381007.1\|2801027_2801948_-\|glutaminase-B	gnl\|CDD\|234880	PRK00971, PRK00971, glutaminase; Provisional.	0

>NZ_CP016224.1|WP_025768824.1|2807398_2809024_+|methyl-accepting-chemotaxis-protein
MKLKTQAYLLSAIILLALLALTATGLWTLRVASNLDNKARVTELFKSAYSILTEVEKMAIEGKMPEDEAKALATRLLRNNIYKDNEYVYVADENMMFIAAPLDPQLHGTSFHDFRDGSGNSVGQLILDVLGHKTGQIVEYTWSQKQADGSIEEKHSIAEKTPHWGWVVGTGIGFNEVNARFWSTAQWQLVLCLIIAGSILSGLIISIRKMLHLLGGEPNDVRKAVQAVAQGDIQTSFDTVAPRGSIYRAVQDMSQSLATMVTNLEKSMHALRAELFAVESRSNTIADLTVSQQQSTAMIATAMTEMASSANHVANSASDTANNTDEADKQSQHTQKLIHNTVENIQGLASQLNTASKAVADLDQDVNNIVKVLDVIGDIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRNLAGRTQDSTKEIQYMISNLQEGSRNAIHTMEICAETSESTVTESKNASEALQQIVTALESITTMSQQIATAAAEQTQVSDDIALRINLIEESGGQLNSVVTESQSSTQSLASLANELEGWVNKFSVKH
>NZ_CP016224.1|WP_005381001.1|2805461_2806601_+|membrane-bound-lytic-murein-transglycosylase-MltC
MKKIVFIAAALLMAGCSREFVEKIYDVNYEPTNRFANNLAELPGQFEKDTAALDALINSFSGNIQKRWGKKEIKYAGKSNYVKYIDNYLSRAEVDFRKGVITIETVSPTEPQKHLKDAIVTTLLTPDDPAHVDLFSSKGITLEGQPFLYKQVVDQDNKPIQWSWRANRFAEYLIANKIKTKNVDFKKAYYVEIPMVEDHFSTRSYQYADIVRRASKKYDIPEDLIYAIIKTESSFNPYAVSWANAYGLMQVVPKTAGRDVFKLVKKRSGQPSPEYLFNPENNIDTGTAYFYILKNRYLREVRHPTSLEYSMISAYNGGTGGVLNTFHRSDRKRAMQDLNSLQPNQVYWALTKKHPNAEARRYLEKVTNFKKEFNSKQTL
>NZ_CP016224.1|WP_005381002.1|2805111_2805384_+|oxidative-damage-protection-protein
MSRTVFCARLKKEGEGLDFQLYPGELGKRIFDNISKEAWAQWQHKQTMLINEKKLNMMDPEHRKLIETEMVNFLFEGKDVHIEGYTPPSE
>NZ_CP016224.1|WP_017635575.1|2804015_2805092_+|A/G-specific-adenine-glycosylase
MTPFASAILEWYDAYGRKDLPWQQNKTAYSVWLSEIMLQQTQVTTVIPYYQRFLERFPTVIDLANAEQDEVLHLWTGLGYYARARNLHKAAQEVASTYNGEFPLDIEKMNALPGIGRSTAAAILSSVYKQPHAILDGNVKRTLSRCFAVAGWPGQKKVENQLWEIAETHTPQTDVDKYNQAMMDMGAMVCTRSKPKCSLCPVADLCVAKQQGNVLDYPGKKPKKDKPIKQTRFVMLHHNTENGHEVWLEQRPQTGIWGGLFCFPQTEHVDAESDIELLLDQRGIQASNIKQKQTLITFRHTFSHYHLDITPILIDLSKQPDVIMEGNKGLWYNLSKPEEVGLAAPVKLLLETLPHELR
>NZ_CP016224.1|WP_005384506.1|2803092_2803812_-|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB
MSEVTTNEYNEDGKLIRKIRSFVRREGRLTKGQESAMNECWPTMGIDFKAELLDWKEVFGNDNPVVLEIGFGMGASLVEMAKNAPEKNFIGIEVHSPGVGACLADAREAGITNLRVMCHDAVEVFEHMIPNGSLSTLQLFFPDPWHKKRHHKRRIVQLGFAEMVREKLIPNEGIFHMATDWENYAEHMIEVMNQAPGFENIAKDGDFVPRPDDRPLTKFEARGHRLGHGVWDIKYKRIA
>NZ_CP016224.1|WP_065274864.1|2802046_2803075_-|DNA-methylase
MYHYAILANPGHNRIYFDSAMTIACSELKAILASQGVDVTEIGSKDVGLPAALVFSCQEALTDEQARRIAASSIYYALFEVREDGLLRPVQAPVFNTFPESMSQILRYTGKTNEQFTRLMVNIGISASNTGSEQLTLMDPMCGKGTTLFEGLIHGLNVVGVEINAKWVQEIQTFIVKFMKNGRFKHKVSKEKRTAGGKKVADGFVVEAAANKEDYNQGHLQFMKLYSADTRIADQVVKKNSVDVMVSDLPYGVQHGSKNAKDSKLNRSPLELLKEALPAWKVVLKKQGSVVLSFNEFTLKWKDVAALFEEQGWKVLSEEPYIGYLHRVDQSINRNIIVAVKP
>NZ_CP016224.1|WP_005381007.1|2801027_2801948_-|glutaminase-B
MKPTVEILTDILAEVRPLIGQGKVADYIPALAKVPSNKLGIAVYTNEGEVIKAGDADEPFSIQSISKALSLTLAMCLYKQEEIWSRVGKEPSGQAFNSLIQLEMEQGIPRNPFINAGAIVVADLLQTRLSAPRQRLLEFVRQLSGDTHIVYDKVVAASEMMHGDRNAAIAYLMRSFGNFENEVIPVLQNYFHACALKMSCVDLAKTFSYLANKGTSVQTGKPVVSPVQTKQLNALLATCGLYDGAGEFAYRVGMPGKSGVGGGIIAVVPGEMTISVWSPELDPSGNSLAGTKALELLSERIGRSIF
>NZ_CP016224.1|WP_065274863.1|2799756_2800935_+|radical-SAM-family-heme-chaperone-HemW
MLTPPALSLYVHIPWCVQKCPYCDFNSHALKTEIPEEEYISALLEDLDTDIEKYRLNEAPRPLHSIFIGGGTPSLISAEGIERLLKGIEARIPFKPEIEITMEANPGTIEAERFVGYRKAGVTRISIGVQSFEQQKLERLGRIHGQDEAVNAAHLAHQIGLNSFNLDLMHGLPDQSIEQALADLDKAIELAPPHLSWYQLTIEPNTMFYYKPPTLPDDDDLWDIFELGHQKLAAAGYVQYEISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFTDGRIIRTTKVKHPRGYLAAYQNMVKPYLHTEHVVADEDRPFEFFMNRFRLIEACPKQDYVDTTGLPLSTIQETINWAIEMGYLSETPTHWQITEKGKLFLNDLLEAFMAEESEE
>NZ_CP016224.1|WP_005381009.1|2799135_2799738_+|XTP/dITP-diphosphatase
MKKIVLATGNQGKVREMADLLSDFGFEVLAQSEFNVSEVAETGTTFIENAIIKARHAAQETGLPAIADDSGLEVDFLKGAPGIYSARYAGESASDQENLEKLLAAMEGVPEAERTARFHCVLVLMRHENDPTPIVCHGKWEGRILTEAHGENGFGYDPIFFVPEDNCASAELEPARKKQLSHRGKALKSLFAQLSEQVSQ
>NZ_CP016224.1|WP_005381010.1|2798585_2799017_+|DUF4426-domain-containing-protein
MSKWITALLISLLSLPSFADQFKNMKDIEVHYVAFNSTFLTPKVARSYDIKRNGYLAVVNISVLDRASLGKPALEAKIAGRAKNLIGQTQTLTFREVKEGNAIYYLAELPITHEETFTFDIDVKAGNKGSGKLKFTQKFYVEE
>NZ_CP016224.1|WP_025768824.1|2810405_2812031_+|methyl-accepting-chemotaxis-protein
MKLKTQAYLLSAIILLALLALTATGLWTLRVASNLDNKARVTELFKSAYSILTEVEKMAIEGKMPEDEAKALATRLLRNNIYKDNEYVYVADENMMFIAAPLDPQLHGTSFHDFRDGSGNSVGQLILDVLGHKTGQIVEYTWSQKQADGSIEEKHSIAEKTPHWGWVVGTGIGFNEVNARFWSTAQWQLVLCLIIAGSILSGLIISIRKMLHLLGGEPNDVRKAVQAVAQGDIQTSFDTVAPRGSIYRAVQDMSQSLATMVTNLEKSMHALRAELFAVESRSNTIADLTVSQQQSTAMIATAMTEMASSANHVANSASDTANNTDEADKQSQHTQKLIHNTVENIQGLASQLNTASKAVADLDQDVNNIVKVLDVIGDIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRNLAGRTQDSTKEIQYMISNLQEGSRNAIHTMEICAETSESTVTESKNASEALQQIVTALESITTMSQQIATAAAEQTQVSDDIALRINLIEESGGQLNSVVTESQSSTQSLASLANELEGWVNKFSVKH
>NZ_CP016224.1|WP_082240161.1|2813020_2814457_-|NAD-dependent-succinate-semialdehyde-dehydrogenase
MMQQIKNETLKSVFKQWSSDEGIVVINPATEQELIRLKPSTLDELDDLIGQCKTEQVRWAKLSAKERSRRLRGWYQLLLDNAEDIATIITLEQGKPLAESKGEVMYGASFVEWFSEEAKRAYGEVIPAPTTDRRLSAIRQPVGVCAAITPWNFPIAMITRKAAPALAAGCGMLIKPSELTPLTAIAVVELAYQAGIPKELLSVVVSEQAAEFGQVLSTDPRIQKISFTGSTRVGKILMKQASDSVKAVSMELGGNAPFIVFEDADLDEAAEGLVASKFRNAGQTCVCTNRLYVHKNVKQAFIDKVLSKLSKLKLGNGLEKGVTLGPVITMASKHRLEAAIDQAVQEGASIANSPQRRPGRFMEPVLLDSVTQNMSIVQQELFGPVLPIVTFENDYQVLEMANDTEYGLACYFYTNSLKRIVTFSEGLEYGMVGVNEGIISTEVAPFGGVKESGVGREGAKQGLDEYLETKYICLGGLS
>NZ_CP016224.1|WP_065274865.1|2821157_2822411_-|HD-GYP-domain-containing-protein
MAAIKLTVDRIQPGLHIRLPLKWNDHPFLLNSFKIKDQEQVEMIRHLGVKFVYFNPEQSDAVPLPVDQRQADRVTNEASLDHETQKMWQEKQNRIEKLSAYRRRVIQCEKEFERSLARMRSVMTKIRNRPTAAVDEAKLLIEDIVEKLMCDDNVTLHLMNGKNEFEDIYFHSLNVAVISMMIGRAKGYSAAQLKELSFSALFHDIGKIKIPTAILRKQLPLTEPETNYLKLHTKYGVDLASQIEAFPEVARIVIAQHHELRDGSGYPKGLKGDEINEFAQIIALANAFDNLCHTPIVSDQKIPYTALSHLYKNCKHLYKEENLNILIKFMGVFPPGTVVHLSNNMVGLVISVNASHLLFPNVLVYDPSVPRTQAPIIDLASKDIKIVNAIHPSKLPDKVKEYLNPRSRISYFFDSDE
>NZ_CP016224.1|WP_005381031.1|2822541_2823540_-|LacI-family-DNA-binding-transcriptional-regulator
MARIKDVAELAGVNRSTVSRIINGEGKFREETRKKVEQAMAQLNYRPSAIARSLATSSSNMVGLLVTYYTGGFFGEMMEQVQTELDIHKKFLITAQGHHSAQGEKEAIQRFNDLRCDGYVLHSRYLSDDDLRELAKQPTPFVLLDRYVEGIEERCVTFNHHHASRIAVEHLLAGGHRKIACIAGPSQRHNSVLRKLGYIDAMKDAGIDIDESWCEEGNYGRQSGYDAMAAILQRHPDVTAVFSCSEEMTVGAMQYLHEHSISVPEQISLTSFDSVDLCESLYPTVSAVHFPISDMARVAVQTLMGLVKDQEVIDKPVFEAKLKIRKADRSLK
>NZ_CP016224.1|WP_054579416.1|2823644_2824400_-|chitin-disaccharide-deacetylase
MKVIFNADDFGLTRGVNSGIVKAHQQGVVHSTTMMVGMDAEQHALELARHNPDLKIGVHLRFTAGVPITKHPNLTNGRAHFINYDELWSKQDFETQVIYDEAKAQVEHFLSLGLELSHLDSHHHAHTHPQILPVIKEVANEYRVPLRGTGLCQESMTIRYIFTDEFYDQKVSLDGLMAHLLSLKADYDLVEVMCHPAEADQALILKSGYALQRELELQVLTSPILKEQLAHHGITVTDYSELVSTNQMVGV
>NZ_CP016224.1|WP_005381048.1|2824417_2825740_-|6-phospho-beta-glucosidase
MSREAIKLAIIGGGSSYTPELVEGVIKRLEYLPVKKIHFVDIESGAEKLEIIKGLAQRMVDKAGAKIEIKAGFDRRAAIKDADFVMTQFRVGGLAARANDERIPIKYDVIGQETTGPGGFAKALRTIPVILDICKDIEELAPNAWMLNFTNPAGLVSEAVSKYTKVKSIGLCNVPVSMEMMIAEMMECEPKELQLEFAGLNHLVWVHKAWLNGEDITQTVLEKVGDGANFSMKNIWEEPWDPAFLKALGAIPCPYHRYFYQTDAMLAEEKQSADEKGTRAEQVMETENALFKLYQDPTLDHKPKELEERGGAYYSDASLNLVDSIYNNRNSIHVVNVLNNGAINGLPDDAVIECSAVIGSWGAKPLAVGELSNNIKGLLHQVKAYEQLTIEAAVEGNYDKALMALTNNPLVPDIGRAKSILDDILAVNAPYLPQFKLTTL
>NZ_CP016224.1|WP_031777269.1|2825752_2826064_-|PTS-lactose/cellobiose-transporter-subunit-IIA
MEQELVVMEIICNAGEARSLSYEALRLSREQDFEAADEKLSQARECINKAHLIQTQLIEEDQGEGKVPMTLVMVHAQDHLMTTILAQEMAVEIVALNKKISNK
>NZ_CP016224.1|WP_005381064.1|2826115_2827450_-|PTS-sugar-transporter-subunit-IIC
MKLYDAIIGAVEKHIAPIAAKVGNQPHVRAMRDGFIVAMPFIIVGSFILIFAFPPFAEDTTFTFGRIWLDFATTHFDTIMMPYNMSMGIMTIFVSLGVAYSLAKAYKMDGITSAVLSLMSFLLIAAPAKDGALSMSHMGGTGIFTAVMCAFFSVELYRFMKKHNITIRMPEQVPPAIARSFEVLLPVLAIFITLYPLSLFVQTQYDMLIPDAVMAIFKPLISASNSLPAIIGALLLCQLLWFAGIHGAAIVVGLLSPIFLTNIGANIEAFVAGEPIPNVFTQPFWDFYIFIGGSGATLALVMLMSFSRSVHLKSIGRMSAVPGFFQINEPVIFGSPVVMNPTLFIPFVFAPVINATIAYFAVHVGFVGMGVATTPWTTPALIGASWGSGWTFAPVLLVIGLLILDLIIYFPFFKMFEKQMLEQELPTTKETKGDTQPSGEGVTA
>NZ_CP016224.1|WP_065274866.1|2827537_2827843_-|PTS-sugar-transporter-subunit-IIB
MKKILLCCSAGMSTSMLVKKMEQAAENKGIECKIDAMSVNAFEDAIKEYDVCLLGPQVRFQLEELRKTAQEHGKNIDAISHQHYGMMKGEEVLEQALELIN
>NZ_CP016224.1|WP_005381066.1|2828090_2829374_+|polysaccharide-deacetylase-family-protein
MKFNKLAIATLVSAALSQHSFAQTDSKGTIYLTFDDGPINASIDVIQVLNQEDIKATFYFNAWHLDGIGDENEDRSLEALKLALDTGHIVANHSYDHMVHNCVDEFGPNSAAECNATGDHQLNSYQDPVYDASMFTENLSVLAKYLPNITSYPNYKATEFARLPYTNGWRVTKDFKADGLCATSDDLKPWEPGYVCDTSNPSNSVKAAIEVQNILANNGYQTHGWDVDWAPENWGIEMPANSLTEAEAFLGYVDSALNTCAPTTINPINSKAQEFPCGTPLHADKVIVLTHEFLFEDGKRGMGATQNLPKLAKFIQLAKQAGYDFDTMDNYTPNWQVGHNYDAGDYVLHLGTVYQAVTNHTAQQDWAPSPTSSLWTNADPATNWTQNVSYKQGDVVTYQGLRYLVDVPHVSQADWTPNTQNTLFTAL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	NZ_CP016225.1	1827621-1827660	0	1.0
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	NZ_CP016224.1	2806886-2806925	1	0.975

1. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to position: 1827621-1827660, mismatch: 0, identity: 1.0

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccattcttt	Protospacer
****************************************

2. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to position: 2806886-2806925, mismatch: 1, identity: 0.975

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatttttt	Protospacer
************************************.***

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	NZ_LN868946	Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384 plasmid 4, complete sequence	103821-103860	4	0.9
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	NZ_CP041417	Escherichia coli strain STEC711 plasmid pSTEC711_1, complete sequence	296499-296538	5	0.875
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	KU052038	Escherichia phage SerU-LTIIb, partial genome	1164-1203	5	0.875
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	KU052038	Escherichia phage SerU-LTIIb, partial genome	3070-3109	5	0.875
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	LN997803	Escherichia coli phage phi467	15123-15162	5	0.875
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	NZ_CP023526	Cedecea neteri strain FDAARGOS_392 plasmid unnamed, complete sequence	1927-1966	5	0.875
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	NZ_CP022660	Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-2, complete sequence	52075-52114	5	0.875
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	NZ_CP045061	Salmonella enterica subsp. enterica serovar Muenchen strain LG26 plasmid pLG26p2, complete sequence	52081-52120	5	0.875
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	NZ_CP045054	Salmonella enterica subsp. enterica serovar Muenchen strain LG24 plasmid pLG24p2, complete sequence	52086-52125	5	0.875
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	NZ_CP045058	Salmonella enterica subsp. enterica serovar Muenchen strain LG25 plasmid pLG25p2, complete sequence	52085-52124	5	0.875
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	NC_021742	Serratia liquefaciens ATCC 27592 plasmid unnamed, complete sequence	35425-35464	5	0.875
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	MH791411	UNVERIFIED: Escherichia phage Ecwhy_1, complete genome	13642-13681	5	0.875
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	MH494197	Escherichia phage CMSTMSU, complete genome	196769-196808	5	0.875
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	NZ_CP054057	Scandinavium goeteborgense strain CCUG 66741 plasmid pSg66741_1, complete sequence	85814-85853	6	0.85
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	KY653118	Morganella phage IME1369_01, complete genome	695-734	6	0.85
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	LC494302	Escherichia phage SP27 DNA, complete genome	76611-76650	8	0.8
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	LT603033	Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I	17117-17156	8	0.8
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	NC_027364	Escherichia phage PBECO 4, complete genome	207829-207868	8	0.8
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	NC_049942	Escherichia phage JLK-2012, complete sequence	23524-23563	8	0.8
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	MK817115	Escherichia phage vB_EcoM_phAPEC6, complete genome	52942-52981	9	0.775
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	MH383160	Escherichia phage UB, complete genome	272121-272160	9	0.775
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	MK327931	Escherichia phage vB_EcoM_G17, complete genome	77926-77965	9	0.775
NZ_CP016224_1	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	KM507819	Escherichia phage 121Q, complete genome	77938-77977	10	0.75

1. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to NZ_LN868946 (Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384 plasmid 4, complete sequence) position: , mismatch: 4, identity: 0.9

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatcaagt	Protospacer
***********************************.   *

2. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to NZ_CP041417 (Escherichia coli strain STEC711 plasmid pSTEC711_1, complete sequence) position: , mismatch: 5, identity: 0.875

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatatgcg	Protospacer
*********************************** . .

3. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to KU052038 (Escherichia phage SerU-LTIIb, partial genome) position: , mismatch: 5, identity: 0.875

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatatgcg	Protospacer
*********************************** . .

4. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to KU052038 (Escherichia phage SerU-LTIIb, partial genome) position: , mismatch: 5, identity: 0.875

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatatgcg	Protospacer
*********************************** . .

5. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to LN997803 (Escherichia coli phage phi467) position: , mismatch: 5, identity: 0.875

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatatgcg	Protospacer
*********************************** . .

6. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to NZ_CP023526 (Cedecea neteri strain FDAARGOS_392 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.875

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccagaatgc	Protospacer
**********************************   * .

7. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to NZ_CP022660 (Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-2, complete sequence) position: , mismatch: 5, identity: 0.875

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccacttacg	Protospacer
**********************************.*. .

8. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to NZ_CP045061 (Salmonella enterica subsp. enterica serovar Muenchen strain LG26 plasmid pLG26p2, complete sequence) position: , mismatch: 5, identity: 0.875

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccacttacg	Protospacer
**********************************.*. .

9. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to NZ_CP045054 (Salmonella enterica subsp. enterica serovar Muenchen strain LG24 plasmid pLG24p2, complete sequence) position: , mismatch: 5, identity: 0.875

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccacttacg	Protospacer
**********************************.*. .

10. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to NZ_CP045058 (Salmonella enterica subsp. enterica serovar Muenchen strain LG25 plasmid pLG25p2, complete sequence) position: , mismatch: 5, identity: 0.875

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccacttacg	Protospacer
**********************************.*. .

11. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to NC_021742 (Serratia liquefaciens ATCC 27592 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.875

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
taggtcaccagttcgattccggtagccggcaccaatcaag	Protospacer
*************************.******** **

12. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to MH791411 (UNVERIFIED: Escherichia phage Ecwhy_1, complete genome) position: , mismatch: 5, identity: 0.875

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcacaaatcagc	Protospacer
******************************** * **  .

13. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to MH494197 (Escherichia phage CMSTMSU, complete genome) position: , mismatch: 5, identity: 0.875

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcacaaatcagc	Protospacer
******************************** * **  .

14. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to NZ_CP054057 (Scandinavium goeteborgense strain CCUG 66741 plasmid pSg66741_1, complete sequence) position: , mismatch: 6, identity: 0.85

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccaaatgcg	Protospacer
**********************************  . .

15. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to KY653118 (Morganella phage IME1369_01, complete genome) position: , mismatch: 6, identity: 0.85

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
taggtcaccagttcgactccggtagccggcaccatattaa	Protospacer
****************.********.********* .*

16. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to LC494302 (Escherichia phage SP27 DNA, complete genome) position: , mismatch: 8, identity: 0.8

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
aaggtcaccagttcgattccggtagtcggcacaaaataaa	Protospacer
 ******************************* *  .

17. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to LT603033 (Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I) position: , mismatch: 8, identity: 0.8

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
aaggtcaccagttcgattccggtagtcggcacaaaataaa	Protospacer
 ******************************* *  .

18. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to NC_027364 (Escherichia phage PBECO 4, complete genome) position: , mismatch: 8, identity: 0.8

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
aaggtcaccagttcgattccggtagtcggcacaaaataaa	Protospacer
 ******************************* *  .

19. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to NC_049942 (Escherichia phage JLK-2012, complete sequence) position: , mismatch: 8, identity: 0.8

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
caggtcgccagttcgattccggtagccggcaccatatgcg	Protospacer
.*****.******************.********* . .

20. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to MK817115 (Escherichia phage vB_EcoM_phAPEC6, complete genome) position: , mismatch: 9, identity: 0.775

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
aatgtcaccagttcgattccggtagtcggcacaaaataaa	Protospacer
 * ***************************** *  .

21. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to MH383160 (Escherichia phage UB, complete genome) position: , mismatch: 9, identity: 0.775

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
aatgtcaccagttcgattccggtagtcggcacaaaataaa	Protospacer
 * ***************************** *  .

22. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to MK327931 (Escherichia phage vB_EcoM_G17, complete genome) position: , mismatch: 9, identity: 0.775

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
aatgtcaccagttcgattccggtagtcggcacaaaataaa	Protospacer
 * ***************************** *  .

23. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to KM507819 (Escherichia phage 121Q, complete genome) position: , mismatch: 10, identity: 0.75

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
aatgtcaccagttcaattccggtagtcggcacaaaataaa	Protospacer
 * ***********.***************** *  .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2151 : 59341

Paramecium_bursaria_Chlorella_virus(13.33%)

integrase,protease,transposase

attL 22878:22893|attR 46414:46429

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010446562.1\|2151_3072_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	4.6e-175	98.7
WP_065274082.1\|3228_4308_+	UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase	NA	NA	NA	NA
WP_065274083.1\|6203_7502_+	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_065274084.1\|7498_8356_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_065274085.1\|8357_9422_+	EpsG family protein	NA	NA	NA	NA
WP_065274086.1\|9424_10567_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_162780832.1\|10658_11102_+	CatB-related O-acetyltransferase	NA	NA	NA	NA
WP_065274088.1\|11106_12018_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_114139448.1\|12001_12553_+	colanic acid biosynthesis acetyltransferase WcaF	NA	NA	NA	NA
WP_065274090.1\|12562_13669_+	GDP-mannose 4,6-dehydratase	M1IBC3	Acanthocystis_turfacea_Chlorella_virus	3.6e-126	62.6
WP_162780833.1\|13680_14646_+	NAD-dependent epimerase/dehydratase family protein	A0A0E3HIR9	Synechococcus_phage	1.1e-83	52.3
WP_065274091.1\|14653_15121_+	GDP-mannose mannosyl hydrolase	NA	NA	NA	NA
WP_065274092.1\|15138_16545_+	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	2.3e-53	30.9
WP_065274093.1\|16544_17291_+	glycosyltransferase	A0A1V0SAH6	Catovirus	3.9e-07	34.8
WP_065274094.1\|17295_18714_+	phosphomannomutase	NA	NA	NA	NA
WP_065275046.1\|18771_19989_+	mannose-6-phosphate isomerase, class I	NA	NA	NA	NA
WP_065274095.1\|20477_21644_+	nucleotide sugar dehydrogenase	O41091	Paramecium_bursaria_Chlorella_virus	8.8e-115	55.3
WP_065274096.1\|21676_22558_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.8e-59	43.4
WP_065274097.1\|22718_24251_-\|transposase	IS66 family transposase	S5VTP8	Leptospira_phage	1.1e-24	40.5
22878:22893	attL	NA	NA	NA	NA
WP_025590488.1\|24310_24664_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	5.3e-15	44.6
WP_011999494.1\|24660_24972_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_065274098.1\|25881_26493_-	hypothetical protein	NA	NA	NA	NA
WP_065274099.1\|26489_27653_-\|integrase	site-specific integrase	A0A1W6JTA0	Pseudomonas_phage	2.1e-28	27.6
WP_065274100.1\|27901_29176_-	hypothetical protein	NA	NA	NA	NA
WP_065274101.1\|29168_32102_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_065274102.1\|32076_33723_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_005397605.1\|34451_34865_+	hypothetical protein	NA	NA	NA	NA
WP_065274104.1\|35924_37271_+	ATP-binding protein	NA	NA	NA	NA
WP_065274105.1\|37833_38109_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_065275047.1\|38101_39337_+	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_065274106.1\|39379_39679_+	hypothetical protein	NA	NA	NA	NA
WP_114139449.1\|40152_40314_+	hypothetical protein	NA	NA	NA	NA
WP_065274107.1\|40574_40811_+	hypothetical protein	NA	NA	NA	NA
WP_005397970.1\|41028_41199_+	hypothetical protein	NA	NA	NA	NA
WP_005397969.1\|41198_41594_+	type II toxin-antitoxin system death-on-curing family toxin	NA	NA	NA	NA
WP_031780673.1\|43623_45726_+	hypothetical protein	NA	NA	NA	NA
WP_005397963.1\|45823_46990_+	nucleotide sugar dehydrogenase	O41091	Paramecium_bursaria_Chlorella_virus	8.8e-115	55.5
46414:46429	attR	NA	NA	NA	NA
WP_005397961.1\|47059_47938_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.9e-61	44.5
WP_005384863.1\|48037_48808_-	triose-phosphate isomerase	NA	NA	NA	NA
WP_005397960.1\|49077_49425_+	5-carboxymethyl-2-hydroxymuconate Delta-isomerase	NA	NA	NA	NA
WP_005397959.1\|49642_50065_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_065274108.1\|50379_51522_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A077SLN2	Escherichia_phage	2.4e-133	69.3
WP_065274109.1\|51578_52007_+\|transposase	IS200/IS605 family transposase	A0A1S5RHE3	Helicobacter_phage	1.1e-25	49.3
WP_065274110.1\|52231_52582_-	DUF3135 domain-containing protein	NA	NA	NA	NA
WP_065274111.1\|52742_53363_-	transcriptional regulator	NA	NA	NA	NA
WP_005383180.1\|53891_54899_-	class II fructose-bisphosphatase	NA	NA	NA	NA
WP_005379536.1\|55247_55490_+	cell division protein ZapB	NA	NA	NA	NA
WP_005397954.1\|55625_56132_-	ribonuclease E activity regulator RraA	NA	NA	NA	NA
WP_065274112.1\|56208_57126_-	1,4-dihydroxy-2-naphthoate polyprenyltransferase	NA	NA	NA	NA
WP_005397950.1\|57434_58766_-	HslU--HslV peptidase ATPase subunit	A0A191ZC11	Erwinia_phage	1.8e-39	27.0
WP_005383176.1\|58789_59341_-\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA

DBSCAN-SWA_2

529832 : 536616

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005383771.1\|529832_530972_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	4.5e-63	42.0
WP_025768889.1\|530989_532240_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.1e-99	48.7
WP_005381578.1\|532446_532896_+	transcriptional regulator NrdR	NA	NA	NA	NA
WP_025768890.1\|532903_534031_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.9e-45	34.8
WP_005381574.1\|534039_534693_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	3.1e-32	36.6
WP_005381573.1\|534866_535976_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.2e-65	39.8
WP_005381572.1\|536145_536616_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-32	48.7

DBSCAN-SWA_3

1828715 : 1893809

Vibrio_phage(46.43%)

head,protease,portal,capsid,terminase,transposase,tail,integrase,tRNA

attL 1872604:1872619|attR 1897281:1897296

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053350311.1\|1828715_1829357_-\|tRNA	alanyl-tRNA editing protein	NA	NA	NA	NA
WP_053350310.1\|1829499_1830045_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_005389307.1\|1830298_1830862_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_065274600.1\|1831005_1831419_-	hypothetical protein	NA	NA	NA	NA
WP_065274601.1\|1831560_1832169_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_065274602.1\|1832312_1832714_-	DUF2007 domain-containing protein	NA	NA	NA	NA
WP_065274603.1\|1832818_1833340_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_033906599.1\|1833679_1834636_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_065274604.1\|1835276_1835810_-	hypothetical protein	NA	NA	NA	NA
WP_065275073.1\|1836009_1837563_-	DUF4263 domain-containing protein	NA	NA	NA	NA
WP_033906599.1\|1837992_1838949_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_082240170.1\|1839962_1840133_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_033906599.1\|1840885_1841842_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_082240170.1\|1842855_1843026_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_033906599.1\|1843778_1844735_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_054702813.1\|1844757_1845288_-	hypothetical protein	NA	NA	NA	NA
WP_082240152.1\|1845316_1845442_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_065274605.1\|1845431_1845836_-	hypothetical protein	NA	NA	NA	NA
WP_081097955.1\|1845874_1846081_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_065274606.1\|1845989_1846568_-	hypothetical protein	NA	NA	NA	NA
WP_082240171.1\|1846594_1846708_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_033906599.1\|1846907_1847864_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_082240153.1\|1848457_1849207_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_005398409.1\|1849259_1849544_+	DNA-damage-inducible protein J	NA	NA	NA	NA
WP_005398411.1\|1849540_1849819_+	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	NA	NA	NA	NA
WP_077200588.1\|1849847_1849976_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_025553613.1\|1850571_1850784_-	hypothetical protein	NA	NA	NA	NA
WP_080960423.1\|1851293_1851410_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_065274609.1\|1852022_1852742_-	hypothetical protein	NA	NA	NA	NA
WP_072612521.1\|1852774_1852867_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_029804518.1\|1852889_1853540_-	hypothetical protein	NA	NA	NA	NA
WP_033906599.1\|1853883_1854840_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_065274610.1\|1854874_1855342_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_065274611.1\|1855581_1855989_-	hypothetical protein	NA	NA	NA	NA
WP_065274612.1\|1856316_1857273_+\|integrase	integron integrase	A0A0K2CP59	Brevibacillus_phage	5.9e-16	27.2
WP_162780830.1\|1857635_1857782_-	hypothetical protein	NA	NA	NA	NA
WP_065274613.1\|1858643_1859021_+	hypothetical protein	NA	NA	NA	NA
WP_065274614.1\|1859167_1862050_-	hypothetical protein	A0A0H5ART3	Pseudomonas_phage	3.7e-98	30.0
WP_065274615.1\|1862024_1862447_-	C40 family peptidase	NA	NA	NA	NA
WP_065274616.1\|1862465_1862954_-	DUF1833 family protein	A0A2H4J983	uncultured_Caudovirales_phage	7.4e-23	40.6
WP_065274617.1\|1863047_1866410_-	hypothetical protein	NA	NA	NA	NA
WP_065274618.1\|1866409_1866883_-	hypothetical protein	Q9MCA0	Pseudomonas_phage	4.2e-07	30.7
WP_065274620.1\|1869309_1869660_-	hypothetical protein	NA	NA	NA	NA
WP_065274621.1\|1869676_1870123_-	hypothetical protein	NA	NA	NA	NA
WP_065274622.1\|1870138_1870525_-	hypothetical protein	NA	NA	NA	NA
WP_065274623.1\|1870521_1870959_-	hypothetical protein	Q6UAX1	Klebsiella_phage	5.2e-20	46.4
WP_065274624.1\|1870961_1871312_-\|head	phage head closure protein	NA	NA	NA	NA
WP_065274625.1\|1871318_1871651_-\|head,tail	phage gp6-like head-tail connector protein	A0A1J0GUX7	Halomonas_phage	4.2e-14	44.3
WP_065274626.1\|1871643_1871856_-	hypothetical protein	NA	NA	NA	NA
WP_065274627.1\|1871916_1873113_-\|capsid	phage major capsid protein	Q8SBH8	Shigella_phage	9.4e-96	47.1
1872604:1872619	attL	NA	NA	NA	NA
WP_065274628.1\|1873145_1873760_-\|head,protease	HK97 family phage prohead protease	Q8SBH9	Shigella_phage	1.2e-49	58.0
WP_065274629.1\|1873752_1874952_-\|portal	phage portal protein	A0A1J0GUY8	Halomonas_phage	1.7e-129	59.6
WP_065274630.1\|1875102_1876836_-\|terminase	terminase large subunit	A0A1J0GUY5	Halomonas_phage	1.9e-177	54.9
WP_065274631.1\|1876838_1877291_-\|terminase	phage terminase small subunit P27 family	A0A1J0GV10	Halomonas_phage	2.3e-23	49.5
WP_065274632.1\|1877649_1878009_-	HNH endonuclease	A0A1P8DTD1	Proteus_phage	5.4e-39	62.1
WP_065274633.1\|1878347_1878590_-	hypothetical protein	NA	NA	NA	NA
WP_065274634.1\|1878701_1878965_-	hypothetical protein	NA	NA	NA	NA
WP_162780831.1\|1879005_1879374_-	hypothetical protein	W6E9J9	Shewanella_phage	2.1e-22	39.5
WP_065274635.1\|1879345_1879636_-	hypothetical protein	NA	NA	NA	NA
WP_065274636.1\|1879706_1880396_-	hypothetical protein	R9TRM8	Vibrio_phage	2.5e-56	48.6
WP_082240172.1\|1880603_1880876_+	hypothetical protein	NA	NA	NA	NA
WP_065274638.1\|1881072_1881678_+	hypothetical protein	NA	NA	NA	NA
WP_065274639.1\|1881887_1882136_+	hypothetical protein	NA	NA	NA	NA
WP_065274640.1\|1882171_1882450_+	hypothetical protein	NA	NA	NA	NA
WP_065274641.1\|1882561_1883533_-	DUF968 domain-containing protein	R9TRM9	Vibrio_phage	3.0e-60	43.5
WP_065274642.1\|1883543_1883849_-	DUF4406 domain-containing protein	A0A1V0E824	Vibrio_phage	4.6e-23	53.9
WP_065274643.1\|1883845_1884154_-	hypothetical protein	R9TNL4	Vibrio_phage	5.3e-35	66.7
WP_014232323.1\|1884150_1884339_-	hypothetical protein	R9TR49	Vibrio_phage	5.7e-16	69.5
WP_065274644.1\|1884335_1885037_-	DNA-binding protein	R9TMN1	Vibrio_phage	1.6e-74	67.7
WP_065274645.1\|1885203_1886190_-	helix-turn-helix domain-containing protein	R9TPU9	Vibrio_phage	2.5e-110	64.9
WP_065274646.1\|1886189_1886768_-	phage N-6-adenine-methyltransferase	A0A1V0E8C8	Vibrio_phage	1.0e-71	69.9
WP_086027146.1\|1886767_1886941_-	hypothetical protein	NA	NA	NA	NA
WP_065274647.1\|1887120_1887312_-	hypothetical protein	NA	NA	NA	NA
WP_065274648.1\|1887308_1887818_-	hypothetical protein	NA	NA	NA	NA
WP_020335501.1\|1887849_1888062_-	hypothetical protein	A0A1I9KFF6	Aeromonas_phage	2.0e-09	56.1
WP_065274649.1\|1888097_1888898_+	helix-turn-helix transcriptional regulator	R9TNM0	Vibrio_phage	3.6e-59	53.2
WP_065274650.1\|1888991_1889534_+	porin family protein	NA	NA	NA	NA
WP_065274651.1\|1889879_1890272_+	hypothetical protein	R9TMP0	Vibrio_phage	2.7e-60	89.3
WP_065274652.1\|1890312_1891131_+	DUF2303 family protein	R9TRN9	Vibrio_phage	4.4e-121	79.8
WP_065274653.1\|1891182_1891560_+	hypothetical protein	NA	NA	NA	NA
WP_065274654.1\|1891561_1891774_+	hypothetical protein	NA	NA	NA	NA
WP_065274655.1\|1891766_1892024_+	hypothetical protein	M4MCS9	Vibrio_phage	6.2e-05	38.1
WP_065274656.1\|1892023_1892239_+	hypothetical protein	A0A1V0E8D5	Vibrio_phage	2.5e-07	37.3
WP_014232338.1\|1892343_1892574_+	DUF1233 family excisionase	NA	NA	NA	NA
WP_065274657.1\|1892573_1893809_+\|integrase	tyrosine-type recombinase/integrase	A0A0U2JGI6	Escherichia_phage	3.6e-74	40.4
1897281:1897296	attR	NA	NA	NA	NA

DBSCAN-SWA_4

2508616 : 2564265

uncultured_virus(30.0%)

integrase,transposase

attL 2504232:2504245|attR 2568651:2568664

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2504232:2504245	attL	NA	NA	NA	NA
WP_032479266.1\|2508616_2509720_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q9G0F2	Phage_Gifsy-1	1.8e-141	67.1
WP_008844786.1\|2509782_2512194_-	type IV secretion system protein TraC	NA	NA	NA	NA
WP_008305510.1\|2512193_2512886_-	DsbC family protein	NA	NA	NA	NA
WP_000356587.1\|2513017_2513956_-	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_002026815.1\|2513948_2514740_-	hypothetical protein	NA	NA	NA	NA
WP_000180225.1\|2514959_2515346_-	hypothetical protein	NA	NA	NA	NA
WP_148532759.1\|2515342_2515915_-	TraV family lipoprotein	NA	NA	NA	NA
WP_053410659.1\|2515989_2517279_-	conjugal transfer protein TraB	NA	NA	NA	NA
WP_053410672.1\|2517285_2518179_-	hypothetical protein	NA	NA	NA	NA
WP_000667170.1\|2518162_2518789_-	hypothetical protein	NA	NA	NA	NA
WP_000433891.1\|2518785_2519067_-	type IV conjugative transfer system protein TraL	NA	NA	NA	NA
WP_065274788.1\|2519221_2520427_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	2.8e-79	75.5
WP_053410661.1\|2520502_2521609_-	ImmA/IrrE family metallo-endopeptidase	A0A0A7RTT7	Clostridium_phage	1.3e-35	29.0
WP_129980172.1\|2521601_2522198_-	hypothetical protein	NA	NA	NA	NA
WP_053410662.1\|2522311_2522947_-	DUF4400 domain-containing protein	NA	NA	NA	NA
WP_053410663.1\|2522933_2523494_-	hypothetical protein	NA	NA	NA	NA
WP_053410664.1\|2523503_2525324_-	conjugative transfer system coupling protein TraD	NA	NA	NA	NA
WP_053410665.1\|2525372_2527523_-	phosphohydrolase	NA	NA	NA	NA
WP_053410666.1\|2527679_2528861_-	DUF4268 domain-containing protein	NA	NA	NA	NA
WP_053410667.1\|2528932_2531359_-	hypothetical protein	NA	NA	NA	NA
WP_053410668.1\|2531358_2535240_-	hypothetical protein	NA	NA	NA	NA
WP_053410669.1\|2535336_2537988_-	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_065274789.1\|2537989_2539810_-	site-specific DNA-methyltransferase	A0A2K5B2C1	Erysipelothrix_phage	3.1e-58	37.8
WP_065274790.1\|2539890_2540814_-	WYL domain-containing protein	NA	NA	NA	NA
WP_000284112.1\|2541135_2541435_-	hypothetical protein	NA	NA	NA	NA
WP_000196208.1\|2541522_2542428_-	DNA polymerase III subunit epsilon	A0A2H4P6W5	Pseudomonas_phage	8.1e-07	25.6
WP_000182836.1\|2542810_2543068_-	hypothetical protein	NA	NA	NA	NA
WP_000116661.1\|2543066_2543516_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A218MND2	uncultured_virus	4.1e-36	57.1
WP_001883756.1\|2543523_2543793_+	hypothetical protein	A0A218MNF2	uncultured_virus	9.3e-28	76.3
WP_001043260.1\|2546219_2547035_+	sulfonamide-resistant dihydropteroate synthase Sul2	NA	NA	NA	NA
WP_001082319.1\|2547095_2547899_+	aminoglycoside O-phosphotransferase APH(3'')-Ib	Q75ZG1	Hepacivirus	4.9e-24	34.3
WP_000480968.1\|2547898_2548735_+	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
WP_001120891.1\|2548706_2549246_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_000985631.1\|2549663_2552642_-\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_065275084.1\|2553177_2553384_+	hypothetical protein	NA	NA	NA	NA
WP_000884724.1\|2553732_2554125_-	hypothetical protein	NA	NA	NA	NA
WP_080007274.1\|2554173_2554296_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_000703246.1\|2554280_2554754_-	trimethoprim-resistant dihydrofolate reductase DfrA31	A0A1B2IBQ4	Erwinia_phage	4.0e-18	34.3
WP_000361705.1\|2554916_2555573_-	quinolone resistance pentapeptide repeat protein QnrVC5	NA	NA	NA	NA
WP_000985631.1\|2555715_2558694_-\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_000348524.1\|2560867_2561311_-	hypothetical protein	NA	NA	NA	NA
WP_000497807.1\|2561775_2562750_+	ParM/StbA family protein	NA	NA	NA	NA
WP_001995600.1\|2562752_2563022_+	hypothetical protein	NA	NA	NA	NA
WP_065274792.1\|2563023_2564265_+\|integrase	integrase family protein	A0A291AWU1	Escherichia_phage	1.1e-75	39.5
2568651:2568664	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2580825 : 2624339

Burkholderia_phage(25.0%)

integrase,tRNA,transposase,protease

attL 2574035:2574049|attR 2608231:2608245

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2574035:2574049	attL	NA	NA	NA	NA
WP_033906599.1\|2580825_2581782_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_065274804.1\|2581804_2582338_-	hypothetical protein	C7BGG4	Burkholderia_phage	5.6e-08	32.2
WP_033906599.1\|2582691_2583648_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_054702813.1\|2583670_2584201_-	hypothetical protein	NA	NA	NA	NA
WP_082240152.1\|2584229_2584355_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_065274605.1\|2584344_2584749_-	hypothetical protein	NA	NA	NA	NA
WP_081097955.1\|2584787_2584994_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_065274606.1\|2584902_2585481_-	hypothetical protein	NA	NA	NA	NA
WP_082240171.1\|2585507_2585621_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_033906599.1\|2585820_2586777_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_065274805.1\|2586805_2587336_-	hypothetical protein	NA	NA	NA	NA
WP_065274806.1\|2587473_2588721_-	DUF3644 domain-containing protein	NA	NA	NA	NA
WP_114139512.1\|2588761_2588878_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_065274807.1\|2588878_2589457_-	hypothetical protein	NA	NA	NA	NA
WP_065274808.1\|2589602_2589935_-	hypothetical protein	NA	NA	NA	NA
WP_082240175.1\|2589971_2590085_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_033906599.1\|2590284_2591241_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_065274809.1\|2591263_2591971_-	hypothetical protein	NA	NA	NA	NA
WP_154215390.1\|2592277_2592439_-	hypothetical protein	NA	NA	NA	NA
WP_065274810.1\|2593068_2593329_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_065274811.1\|2593456_2594011_+	hypothetical protein	NA	NA	NA	NA
WP_065274812.1\|2594327_2595632_+	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_065274813.1\|2596289_2596703_-	hypothetical protein	NA	NA	NA	NA
WP_025767087.1\|2596843_2597452_-	hypothetical protein	NA	NA	NA	NA
WP_065274814.1\|2597972_2598386_+	DNA polymerase V	A0A1B1ITQ0	uncultured_Mediterranean_phage	2.2e-20	45.8
WP_065274815.1\|2598385_2599642_+	Y-family DNA polymerase	I6RSM4	Salmonella_phage	6.0e-85	41.6
WP_065274816.1\|2599826_2600534_-	hypothetical protein	NA	NA	NA	NA
WP_065274817.1\|2600814_2601588_-	hypothetical protein	NA	NA	NA	NA
WP_065274818.1\|2601934_2602579_-	hypothetical protein	NA	NA	NA	NA
WP_065274819.1\|2602575_2604729_-	hypothetical protein	NA	NA	NA	NA
WP_065274820.1\|2604742_2606872_-	hypothetical protein	NA	NA	NA	NA
WP_065274821.1\|2606875_2608108_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_005380103.1\|2608468_2608891_-	MarR family transcriptional regulator	NA	NA	NA	NA
2608231:2608245	attR	NA	NA	NA	NA
WP_005380101.1\|2608990_2609911_-	lipoprotein NlpI	NA	NA	NA	NA
WP_005380098.1\|2610089_2612225_-	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
WP_005380094.1\|2612517_2612787_-	30S ribosomal protein S15	NA	NA	NA	NA
WP_005380088.1\|2612928_2613882_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_005380087.1\|2613881_2614277_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_005380086.1\|2614391_2617103_-	translation initiation factor IF-2	NA	NA	NA	NA
WP_054579095.1\|2617125_2618613_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_005386424.1\|2618649_2619105_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_005380080.1\|2619563_2619902_-	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_005388992.1\|2620122_2621463_-	phosphoglucosamine mutase	NA	NA	NA	NA
WP_065274822.1\|2621482_2622313_-	dihydropteroate synthase	NA	NA	NA	NA
WP_017635895.1\|2622365_2624339_-\|protease	ATP-dependent zinc metalloprotease FtsH	A0A0P0BXI2	Ostreococcus_lucimarinus_virus	3.8e-118	44.0

DBSCAN-SWA_6

2726877 : 2743945

uncultured_Mediterranean_phage(18.18%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005380872.1\|2726877_2729460_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	5.9e-79	38.1
WP_017633543.1\|2729602_2730070_-	recombination regulator RecX	NA	NA	NA	NA
WP_005380874.1\|2730197_2731241_-	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	8.1e-112	61.0
WP_065274846.1\|2731441_2731924_-	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	1.8e-26	48.1
WP_065274847.1\|2732008_2734570_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	1.0e-30	23.2
WP_005380887.1\|2734652_2735639_-	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	6.9e-36	35.2
WP_017633546.1\|2735719_2736643_-	peptidoglycan DD-metalloendopeptidase family protein	D7RWE0	Brochothrix_phage	4.1e-06	35.2
WP_005380892.1\|2736656_2737283_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	2.3e-37	54.5
WP_005380894.1\|2737282_2738059_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	2.3e-66	49.4
WP_065274848.1\|2738058_2739102_-\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_005380896.1\|2739147_2739624_-	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_017633548.1\|2739638_2740346_-	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	A0A2H4UTB4	Bodo_saltans_virus	7.0e-06	24.3
WP_005380907.1\|2740347_2740629_-	cell division protein FtsB	NA	NA	NA	NA
WP_005380909.1\|2740924_2742226_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	9.1e-137	60.3
WP_065274849.1\|2742304_2743945_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.6e-154	52.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP016225

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 1800

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017819704.1\|426_1800_+	sensor histidine kinase	W8CYF6	Bacillus_phage	4.2e-15	24.5

DBSCAN-SWA_2

13886 : 22878

Organic_Lake_phycodnavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017635536.1\|13886_14615_+	metal ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	1.1e-09	28.2
WP_005393560.1\|14614_15490_+	metal ABC transporter permease	NA	NA	NA	NA
WP_005374240.1\|15512_16382_+	zinc ABC transporter solute-binding protein	NA	NA	NA	NA
WP_005374238.1\|16597_17647_+	porin	Q1MVN1	Enterobacteria_phage	4.2e-07	23.1
WP_082240176.1\|17865_20031_-	S9 family peptidase	F2Y2Z7	Organic_Lake_phycodnavirus	1.1e-33	26.6
WP_005374234.1\|20342_21548_-	multidrug efflux MFS transporter EmrD	NA	NA	NA	NA
WP_005374233.1\|21957_22878_-	agmatinase	A0A0N9R043	Chrysochromulina_ericina_virus	3.1e-06	27.8

DBSCAN-SWA_3

29825 : 30725

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275099.1\|29825_30725_-	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	2.7e-07	42.5

DBSCAN-SWA_4

48071 : 48767

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053307132.1\|48071_48767_+	hypothetical protein	A0A125RNP1	Pseudomonas_phage	2.6e-21	38.8

DBSCAN-SWA_5

59137 : 68985

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275108.1\|59137_59743_-	alpha-ketoglutarate-dependent dioxygenase AlkB	A0A0B5J690	Pandoravirus	9.4e-20	35.2
WP_054865439.1\|59875_61231_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	7.1e-15	32.1
WP_082240177.1\|61618_63175_-	DUF3612 domain-containing protein	NA	NA	NA	NA
WP_064354490.1\|63349_63928_+	malate synthase	NA	NA	NA	NA
WP_047102820.1\|64018_65032_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.7e-16	36.6
WP_064376704.1\|65381_66734_+	DASH family cryptochrome	F2Y1V1	Organic_Lake_phycodnavirus	5.4e-31	38.5
WP_065275109.1\|66733_68278_+	deoxyribodipyrimidine photolyase	A0A1V0SE91	Indivirus	3.3e-53	31.6
WP_017819732.1\|68277_68985_+	SDR family oxidoreductase	Q56AQ6	Bacillus_thuringiensis_phage	6.9e-30	35.6

DBSCAN-SWA_6

73838 : 74525

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005497912.1\|73838_74525_-	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	2.1e-15	31.2

DBSCAN-SWA_7

81421 : 84563

Dickeya_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005384341.1\|81421_82597_+	efflux RND transporter periplasmic adaptor subunit	A0A140XAI1	Dickeya_phage	1.3e-17	44.7
WP_065275115.1\|82598_84563_+	MacB family efflux pump subunit	G9BWD6	Planktothrix_phage	2.7e-39	40.8

DBSCAN-SWA_8

89182 : 91213

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275116.1\|89182_91213_+	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	4.1e-27	30.9

DBSCAN-SWA_9

100212 : 101319

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275121.1\|100212_101319_+	putative 2-aminoethylphosphonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.8e-31	36.8

DBSCAN-SWA_10

110380 : 112427

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275126.1\|110380_111361_+	OmpA family protein	G3M9Z0	Bacillus_virus	6.0e-08	26.4
WP_065275127.1\|111557_112427_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	2.2e-14	26.3

DBSCAN-SWA_11

117761 : 119463

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005374021.1\|117761_118280_+	NUDIX domain-containing protein	A0A2H4J8B3	uncultured_Caudovirales_phage	2.1e-31	46.2
WP_065275132.1\|118716_119463_-	lytic transglycosylase domain-containing protein	I1VXB7	Halocynthia_phage	3.1e-12	42.1

DBSCAN-SWA_12

138636 : 143235

Micromonas_pusilla_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054865459.1\|138636_138987_-	rhodanese-like domain-containing protein	G9E686	Micromonas_pusilla_virus	5.3e-07	29.7
WP_005373989.1\|139254_139545_+	co-chaperone GroES	A0A221S386	uncultured_virus	2.0e-12	38.1
WP_053304624.1\|139578_141177_+	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	8.2e-180	65.8
WP_082240179.1\|141282_141492_+	hypothetical protein	NA	NA	NA	NA
WP_033906294.1\|141623_142235_-	LysE family translocator	NA	NA	NA	NA
WP_005388706.1\|142344_143235_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	9.0e-11	23.5

DBSCAN-SWA_13

155383 : 156694

Agrobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042523435.1\|155383_156694_+	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	4.0e-39	30.4

DBSCAN-SWA_14

160094 : 160979

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275140.1\|160094_160979_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	8.7e-14	35.8

DBSCAN-SWA_15

165471 : 166701

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275142.1\|165471_166701_-	glycine betaine/L-proline ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.8e-24	39.3

DBSCAN-SWA_16

170339 : 172364

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005387204.1\|170339_172364_-	elongation factor G	A0A1S5SF82	Streptococcus_phage	7.0e-35	23.0

DBSCAN-SWA_17

183560 : 186719

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275148.1\|183560_186719_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	7.3e-47	20.5

DBSCAN-SWA_18

190221 : 197165

Leptospira_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275149.1\|190221_193323_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	6.5e-64	23.7
WP_053349324.1\|193319_194648_-	acriflavin resistance protein	NA	NA	NA	NA
WP_053349323.1\|194634_195291_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_053304601.1\|195483_196143_-	HAD family hydrolase	NA	NA	NA	NA
WP_065275150.1\|196145_197165_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.6e-35	38.6

DBSCAN-SWA_19

201745 : 203368

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005387086.1\|201745_203368_-	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	1.3e-10	22.9

DBSCAN-SWA_20

208206 : 222005

Yersinia_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275152.1\|208206_209466_-\|tRNA	tyrosine--tRNA ligase	A0A2C9CYK4	Yersinia_phage	2.6e-88	44.6
WP_021707696.1\|209548_210355_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_005373824.1\|210548_211328_-	hypothetical protein	NA	NA	NA	NA
WP_005373822.1\|211498_213871_-	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	1.6e-171	37.8
WP_005373820.1\|214122_214959_+	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_065275153.1\|215043_216108_-	L-asparaginase 2	NA	NA	NA	NA
WP_054574549.1\|216478_217735_-	adenylosuccinate synthase	A0A2R8FF47	Brazilian_cedratvirus	5.9e-48	31.7
WP_005373812.1\|217840_218710_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_017819813.1\|218729_219122_+	ribosome recycling factor	NA	NA	NA	NA
WP_065275154.1\|219199_219814_+	LysE family translocator	NA	NA	NA	NA
WP_054574550.1\|219907_220429_-	DUF2058 domain-containing protein	NA	NA	NA	NA
WP_065275155.1\|220601_222005_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	6.4e-19	26.1

DBSCAN-SWA_21

226846 : 231832

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082240180.1\|226846_228280_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	4.5e-12	24.0
WP_065275158.1\|228300_229323_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_064354539.1\|229454_230216_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.5e-09	27.0
WP_023585584.1\|230256_230769_+	2,4'-dihydroxyacetophenone dioxygenase	NA	NA	NA	NA
WP_065275159.1\|230773_231832_+	zinc-binding dehydrogenase	E3SJ82	Synechococcus_phage	1.3e-11	25.8

DBSCAN-SWA_22

238884 : 240453

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275163.1\|238884_240453_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	4.4e-53	35.7

DBSCAN-SWA_23

253102 : 274204

Tupanvirus(12.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275166.1\|253102_254707_-	S8 family peptidase	A0A2K9L5T6	Tupanvirus	1.4e-33	42.4
WP_054865502.1\|255636_256575_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_054576367.1\|256726_258670_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	1.3e-09	28.1
WP_005378556.1\|258701_259580_+	alpha/beta hydrolase	S5WL92	Mycobacterium_phage	1.5e-13	24.4
WP_065275617.1\|260319_261693_+	carbohydrate porin	NA	NA	NA	NA
WP_065275167.1\|261756_262743_-	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	9.3e-25	30.2
WP_025767958.1\|262978_264418_+	PTS sucrose transporter subunit IIBC	NA	NA	NA	NA
WP_065275168.1\|264583_265507_+	aminoimidazole riboside kinase	NA	NA	NA	NA
WP_065275169.1\|265538_266993_+	sucrose-6-phosphate hydrolase	S6ATV4	Bacillus_phage	3.2e-21	24.0
WP_005373705.1\|267430_268288_+	glutathione-dependent disulfide-bond oxidoreductase	NA	NA	NA	NA
WP_053304564.1\|269471_270641_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	8.6e-86	46.5
WP_005373701.1\|270852_271260_+	cell division protein DamX	NA	NA	NA	NA
WP_005373699.1\|271309_271783_-	peroxiredoxin	M1I839	Pelagibacter_phage	9.3e-23	43.1
WP_017819853.1\|271909_272926_-	adenosine deaminase	NA	NA	NA	NA
WP_017633782.1\|273353_273494_-	hypothetical protein	NA	NA	NA	NA
WP_005373692.1\|273544_273754_-	hypothetical protein	NA	NA	NA	NA
WP_005373691.1\|273994_274204_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	1.8e-18	65.2

DBSCAN-SWA_24

282106 : 284118

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373675.1\|282106_283405_-	HAMP domain-containing protein	W8CYF6	Bacillus_phage	3.7e-21	29.0
WP_005373673.1\|283404_284118_-	response regulator	W8CYM9	Bacillus_phage	7.9e-34	34.4

DBSCAN-SWA_25

287543 : 292691

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373655.1\|287543_288200_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	5.4e-37	38.4
WP_005373653.1\|288558_289176_-	hypothetical protein	A0A2I7SAF7	Vibrio_phage	2.6e-17	33.5
WP_065275173.1\|289293_291147_-	MFS transporter	NA	NA	NA	NA
WP_054574577.1\|291293_292052_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_065275174.1\|292052_292691_-	HD domain-containing protein	A0A1D6Y7U0	Golden_Marseillevirus	1.5e-12	34.9

DBSCAN-SWA_26

297728 : 299051

Micromonas_pusilla_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017635160.1\|297728_299051_-	AarF/ABC1/UbiB kinase family protein	G9E5W0	Micromonas_pusilla_virus	8.4e-21	28.9

DBSCAN-SWA_27

305203 : 306526

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373622.1\|305203_306526_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	1.1e-07	22.6

DBSCAN-SWA_28

315729 : 318366

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275180.1\|315729_318366_+	response regulator	A0A1V0SGX0	Hokovirus	3.8e-49	30.7

DBSCAN-SWA_29

321471 : 325794

Invertebrate_iridovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053304534.1\|321471_321789_+	GIY-YIG nuclease family protein	W8W2G4	Invertebrate_iridovirus	2.5e-11	48.6
WP_005385634.1\|322120_323218_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_065275181.1\|323217_325794_+	response regulator	A0A1V0SGX0	Hokovirus	2.0e-50	34.6

DBSCAN-SWA_30

330984 : 331608

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373579.1\|330984_331608_+	class I SAM-dependent methyltransferase	A0A1B1IT46	uncultured_Mediterranean_phage	8.5e-08	31.7

DBSCAN-SWA_31

336108 : 337011

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373567.1\|336108_337011_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.7e-36	36.4

DBSCAN-SWA_32

352641 : 353106

Xanthomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373515.1\|352641_353106_-	cell division protein DedD	A0A292GIT0	Xanthomonas_phage	2.2e-24	41.7

DBSCAN-SWA_33

357903 : 369772

uncultured_Caudovirales_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025767924.1\|357903_359673_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.3e-24	29.6
WP_065275189.1\|359773_360187_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_017819896.1\|360263_360866_+	beta-phosphoglucomutase family hydrolase	NA	NA	NA	NA
WP_017635198.1\|360954_361947_-	OmpA family protein	NA	NA	NA	NA
WP_065275190.1\|362406_363459_+	3-deoxy-7-phosphoheptulonate synthase AroG	S4W5F1	Pandoravirus	1.5e-81	50.5
WP_025767923.1\|363618_364791_+	MFS transporter	NA	NA	NA	NA
WP_065275191.1\|365000_366563_+	methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	3.4e-29	43.4
WP_042522667.1\|366704_368696_-	transketolase	NA	NA	NA	NA
WP_005373488.1\|368821_369772_-	transaldolase	M4SIN4	Cyanophage	1.1e-11	28.2

DBSCAN-SWA_34

375160 : 378096

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275195.1\|375160_375910_-	molybdopterin-synthase adenylyltransferase MoeB	S4VW33	Pandoravirus	4.6e-08	34.4
WP_017635208.1\|375919_377155_-	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_005373478.1\|377442_378096_+	GTP cyclohydrolase I FolE	R9TJA5	Vibrio_phage	3.4e-55	54.3

DBSCAN-SWA_35

381820 : 383238

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373470.1\|381820_382234_-	helix-turn-helix transcriptional regulator	A0A1C6ZDG7	Pseudomonas_phage	3.1e-06	41.3
WP_065275196.1\|382329_383238_+	aldo/keto reductase family oxidoreductase	A0A1V0SDE7	Indivirus	7.3e-08	28.8

DBSCAN-SWA_36

387110 : 388154

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373458.1\|387110_388154_+	GMP reductase	A0A0N9Q9A5	Chrysochromulina_ericina_virus	1.0e-98	53.8

DBSCAN-SWA_37

393947 : 396736

Organic_Lake_phycodnavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009705685.1\|393947_394751_+	ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	6.4e-16	30.0
WP_065275202.1\|394750_395608_+	ferric iron reductase FhuF-like transporter family protein	NA	NA	NA	NA
WP_065275203.1\|395761_396736_-	peptidoglycan DD-metalloendopeptidase family protein	Q8SBN9	Clostridium_phage	1.5e-19	35.6

DBSCAN-SWA_38

417674 : 423479

Cronobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275620.1\|417674_420353_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	8.3e-92	31.4
WP_005373415.1\|420809_421328_+	Hcp family type VI secretion system effector	NA	NA	NA	NA
WP_065275207.1\|421400_423479_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	8.0e-34	26.3

DBSCAN-SWA_39

427531 : 429532

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042523531.1\|427531_429532_+	protein kinase	A0A1B1IUU3	uncultured_Mediterranean_phage	4.4e-13	30.2

DBSCAN-SWA_40

454723 : 456487

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373334.1\|454723_455632_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	2.4e-11	29.9
WP_005373333.1\|455767_456487_+	SDR family oxidoreductase	W8CYX9	Bacillus_phage	1.9e-06	33.3

DBSCAN-SWA_41

467854 : 469885

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_114139527.1\|467854_469885_-	acetoacetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	7.6e-21	24.1

DBSCAN-SWA_42

473684 : 474485

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373297.1\|473684_474485_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.3e-13	25.0

DBSCAN-SWA_43

479818 : 487087

Anomala_cuprea_entomopoxvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031777150.1\|479818_480601_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.2e-14	28.1
WP_017820353.1\|480610_481813_+	AMP-binding protein	NA	NA	NA	NA
WP_017820352.1\|481949_482546_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_065275215.1\|482834_483593_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.1e-12	28.2
WP_065275216.1\|483589_485293_-	acetolactate synthase AlsS	M4QSI1	Ostreococcus_lucimarinus_virus	8.3e-21	22.9
WP_082240184.1\|485322_486120_-	acetolactate decarboxylase	NA	NA	NA	NA
WP_065275218.1\|486205_487087_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.7e-06	45.3

DBSCAN-SWA_44

495044 : 500464

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349205.1\|495044_495947_-	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	8.5e-49	39.9
WP_065275220.1\|495927_497976_-	acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha	NA	NA	NA	NA
WP_017633676.1\|497968_498751_-	gamma-carboxygeranoyl-CoA hydratase	NA	NA	NA	NA
WP_053349203.1\|498856_500464_-	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	9.6e-19	66.7

DBSCAN-SWA_45

508366 : 509263

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275225.1\|508366_509263_+	3-hydroxyisobutyrate dehydrogenase	A0A077SLF7	Escherichia_phage	8.2e-28	29.2

DBSCAN-SWA_46

515375 : 527626

Catovirus(25.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373209.1\|515375_517091_+\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	6.1e-56	30.3
WP_005382646.1\|517127_518066_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_005392552.1\|518143_518986_+\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_042523602.1\|518988_520167_+\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.8e-25	33.2
WP_042523604.1\|520263_520920_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_017633662.1\|521163_521598_+	globin	NA	NA	NA	NA
WP_005373196.1\|521639_522422_-	slipin family protein	A0A2K9L3L2	Tupanvirus	2.8e-24	29.9
WP_065275227.1\|522432_523809_-	nodulation protein NfeD	NA	NA	NA	NA
WP_005373180.1\|524307_525276_+	c-type cytochrome	NA	NA	NA	NA
WP_005373178.1\|525268_527626_+	response regulator	A0A1V0SGX0	Hokovirus	1.9e-55	35.4

DBSCAN-SWA_47

543472 : 553068

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373143.1\|543472_544351_+	ribose ABC transporter substrate-binding protein RbsB	C6ZCU4	Enterobacteria_phage	7.3e-05	23.1
WP_065275230.1\|544573_545491_+	ribokinase	NA	NA	NA	NA
WP_065275231.1\|545526_546549_+	substrate-binding domain-containing protein	C6ZCU4	Enterobacteria_phage	6.3e-32	29.3
WP_065275232.1\|547048_547780_+	nicotinamide riboside transporter PnuC	A0A126HGA3	Vibrio_phage	2.0e-24	33.6
WP_065275233.1\|547790_548522_+	nucleoside phosphorylase	D0R0G0	Streptococcus_phage	2.1e-05	31.3
WP_005382613.1\|548656_549337_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_065275234.1\|549500_550409_+	siderophore ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_017820306.1\|550431_551367_+	iron chelate uptake ABC transporter family permease subunit	A0A2H4IY97	uncultured_Caudovirales_phage	2.0e-69	43.2
WP_005376631.1\|551359_552310_+	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_005376629.1\|552312_553068_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.5e-14	26.6

DBSCAN-SWA_48

557087 : 557339

Salicola_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005376619.1\|557087_557339_-	membrane protein	A0A248SJ16	Salicola_phage	2.1e-05	38.9

DBSCAN-SWA_49

580286 : 587010

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053303491.1\|580286_582356_+	DNA helicase IV	A7KV33	Bacillus_phage	1.7e-20	25.8
WP_005376571.1\|582433_582889_-	methylglyoxal synthase	NA	NA	NA	NA
WP_062731016.1\|582953_583958_-	TMAO reductase system periplasmic protein TorT	NA	NA	NA	NA
WP_064369292.1\|584046_587010_+	TMAO reductase system sensor histidine kinase/response regulator TorS	A0A1V0SGX0	Hokovirus	4.3e-49	33.6

DBSCAN-SWA_50

590398 : 597090

Tetraselmis_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005376560.1\|590398_591946_+	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	4.2e-165	57.4
WP_065275238.1\|592080_592950_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_047008268.1\|593078_594605_+	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	1.0e-134	52.7
WP_065275239.1\|594719_596021_+	anaerobic sulfatase maturase	NA	NA	NA	NA
WP_065275240.1\|596106_597090_+	MoxR family ATPase	W0UTA7	Sulfolobus_monocaudavirus	1.5e-06	24.3

DBSCAN-SWA_51

602777 : 605192

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005376542.1\|602777_603203_+	riboflavin-specific deaminase	A0A1V0SE20	Indivirus	2.0e-24	50.4
WP_005376541.1\|603375_604281_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_065275244.1\|604289_605192_+	lipid kinase YegS	A0A1V0SBJ0	Catovirus	2.4e-11	29.9

DBSCAN-SWA_52

612113 : 617174

Diadromus_pulchellus_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005376527.1\|612113_613238_-	acyl-CoA desaturase	F2NZ38	Diadromus_pulchellus_ascovirus	2.0e-31	31.8
WP_005376525.1\|613509_614058_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_054577832.1\|614147_614765_-	HAD family phosphatase	NA	NA	NA	NA
WP_065275248.1\|615128_617174_+	hybrid sensor histidine kinase/response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	3.0e-09	30.9

DBSCAN-SWA_53

620188 : 630277

Hokovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275250.1\|620188_623854_+	transporter substrate-binding domain-containing protein	A0A1V0SGX0	Hokovirus	8.5e-31	36.2
WP_065275251.1\|623837_625004_+	EAL domain-containing protein	NA	NA	NA	NA
WP_017635347.1\|624996_625593_+	response regulator transcription factor	NA	NA	NA	NA
WP_065275252.1\|625602_626973_+	GGDEF domain-containing protein	G3MA91	Bacillus_virus	3.1e-10	30.3
WP_065275253.1\|627130_628018_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_017821556.1\|628014_628623_-	response regulator transcription factor	NA	NA	NA	NA
WP_025998672.1\|629296_630277_+	chemotaxis protein CheV	Q56AR1	Bacillus_thuringiensis_phage	4.6e-133	74.1

DBSCAN-SWA_54

646225 : 648076

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275256.1\|646225_648076_-	acyltransferase	B5WZU0	Pseudomonas_phage	4.6e-57	28.7

DBSCAN-SWA_55

654038 : 654575

Ochrobactrum_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275623.1\|654038_654575_+	AAA family ATPase	A0A219VHB7	Ochrobactrum_phage	3.9e-09	37.2

DBSCAN-SWA_56

658947 : 659454

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054576019.1\|658947_659454_+	peptide deformylase	E3SLL2	Synechococcus_phage	4.5e-15	41.0

DBSCAN-SWA_57

664583 : 667132

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275262.1\|664583_666344_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	3.1e-63	31.6
WP_005376459.1\|666517_667132_-	3'-5' exonuclease	A0A0A7RWA3	Clostridium_phage	1.3e-21	38.0

DBSCAN-SWA_58

670605 : 671802

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033906522.1\|670605_671802_-	lipase family protein	Q58MF5	Prochlorococcus_phage	1.6e-10	34.4

DBSCAN-SWA_59

678805 : 683526

Prochlorococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275266.1\|678805_681670_-	aminomethyl-transferring glycine dehydrogenase	E3SN07	Prochlorococcus_phage	1.3e-271	52.1
WP_005376432.1\|681796_682177_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_005376430.1\|682230_683526_-	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	5.9e-104	52.6

DBSCAN-SWA_60

689003 : 692063

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275268.1\|689003_692063_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	3.6e-51	22.1

DBSCAN-SWA_61

703634 : 704369

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275275.1\|703634_704369_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.0e-28	35.8

DBSCAN-SWA_62

707996 : 712473

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275276.1\|707996_711158_+	chitinase	A0A2K9KZQ8	Tupanvirus	1.5e-23	25.7
WP_006742254.1\|711255_712473_-	glucose-1-phosphate adenylyltransferase	A0A291LA53	Escherichia_phage	8.9e-09	24.6

DBSCAN-SWA_63

716538 : 722888

Vibrio_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005397614.1\|716538_717009_-	CreA family protein	A0A2I7SAK3	Vibrio_phage	1.1e-23	42.5
WP_005386088.1\|717154_717664_+	hypothetical protein	NA	NA	NA	NA
WP_065275278.1\|717859_718528_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_005376380.1\|718958_720389_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.8e-08	63.2
WP_017820948.1\|720703_720877_+	hypothetical protein	NA	NA	NA	NA
WP_053303599.1\|720958_721561_+	DUF479 domain-containing protein	NA	NA	NA	NA
WP_005376383.1\|721628_722888_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	4.6e-53	33.9

DBSCAN-SWA_64

734158 : 735178

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031781325.1\|734158_735178_+	TerC/Alx family metal homeostasis membrane protein	A0A291LBC5	Escherichia_phage	1.8e-39	39.8

DBSCAN-SWA_65

747060 : 747900

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005376329.1\|747060_747900_+	isopenicillin N synthase family oxygenase	S4VNP9	Pandoravirus	1.6e-09	39.4

DBSCAN-SWA_66

754432 : 755125

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054575180.1\|754432_755125_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.0e-14	27.9

DBSCAN-SWA_67

762091 : 765121

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275285.1\|762091_764050_+	diguanylate cyclase	G3MA91	Bacillus_virus	2.3e-27	40.7
WP_005376309.1\|764104_765121_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	4.0e-79	45.6

DBSCAN-SWA_68

786103 : 809518

uncultured_Mediterranean_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275295.1\|786103_789013_+	DEAD/DEAH box helicase	A0A1B1IUI1	uncultured_Mediterranean_phage	3.0e-47	28.4
WP_065275296.1\|789014_794066_+	hypothetical protein	A0A1B1IUC6	uncultured_Mediterranean_phage	1.5e-14	23.0
WP_065275297.1\|794058_797184_+	DEAD/DEAH box helicase family protein	A0A2H4J643	uncultured_Caudovirales_phage	1.2e-38	25.9
WP_065275298.1\|797190_798852_+	hypothetical protein	NA	NA	NA	NA
WP_065275299.1\|799156_803077_+	AAA family ATPase	A0A0K2FLP8	Brevibacillus_phage	1.2e-19	25.1
WP_065275300.1\|803086_809518_+	DEAD/DEAH box helicase	A0A1B1IUF6	uncultured_Mediterranean_phage	2.5e-70	23.2

DBSCAN-SWA_69

822599 : 824750

Brevibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275306.1\|822599_824750_-	AAA family ATPase	A0A0K2FLP8	Brevibacillus_phage	1.9e-30	26.6

DBSCAN-SWA_70

837116 : 837779

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005376251.1\|837116_837779_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.9e-27	33.6

DBSCAN-SWA_71

843684 : 848027

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275318.1\|843684_844923_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	8.7e-12	29.0
WP_017634619.1\|845173_846133_-	diguanylate cyclase	W8CYM9	Bacillus_phage	1.8e-09	32.2
WP_005376232.1\|846406_846844_+	DUF3069 domain-containing protein	NA	NA	NA	NA
WP_065275319.1\|846920_848027_-	molybdenum ABC transporter ATP-binding protein ModC	G9BWD6	Planktothrix_phage	4.6e-20	31.0

DBSCAN-SWA_72

856853 : 859528

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005376213.1\|856853_857324_-	anaerobic ribonucleoside-triphosphate reductase-activating protein	H6WXC9	Vibrio_phage	1.6e-51	62.9
WP_065275322.1\|857407_859528_-	anaerobic ribonucleoside-triphosphate reductase	A0A2I7QNQ7	Vibrio_phage	5.1e-270	65.3

DBSCAN-SWA_73

878798 : 880061

Archaeal_BJ1_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275328.1\|878798_880061_+	hydroxymethylglutaryl-CoA reductase	A2RQD2	Archaeal_BJ1_virus	4.7e-05	38.6

DBSCAN-SWA_74

884715 : 885150

Streptomyces_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275331.1\|884715_885150_+	thioredoxin TrxC	A0A1J0GW78	Streptomyces_phage	1.4e-12	39.6

DBSCAN-SWA_75

899782 : 906813

Bacillus_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025767735.1\|899782_900742_+	diguanylate cyclase	G3MA91	Bacillus_virus	2.5e-14	31.0
WP_065275336.1\|900969_901956_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_017820191.1\|901957_903295_+	diguanylate cyclase	G3MA91	Bacillus_virus	4.1e-15	26.9
WP_005376038.1\|903530_904523_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_065275626.1\|905025_905955_+	CHAD domain-containing protein	NA	NA	NA	NA
WP_005375991.1\|906024_906813_+	lipase	Q6XLV5	Feldmannia_irregularis_virus	5.0e-05	28.7

DBSCAN-SWA_76

909850 : 911482

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375988.1\|909850_911482_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.8e-18	31.0

DBSCAN-SWA_77

919487 : 921934

Aphanizomenon_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275339.1\|919487_921149_-	DUF3763 domain-containing protein	A0A2H4PB07	Aphanizomenon_phage	9.2e-33	29.0
WP_017820203.1\|921418_921934_+	NUDIX hydrolase	Q5ULM8	Lactobacillus_virus	2.7e-07	28.6

DBSCAN-SWA_78

926417 : 926951

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025767720.1\|926417_926951_-	lipocalin	A0A1W6JNX6	Morganella_phage	2.5e-40	46.8

DBSCAN-SWA_79

930764 : 938540

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275341.1\|930764_931898_-	exonuclease SbcCD subunit D	A0A217ER54	Bacillus_phage	5.7e-10	27.9
WP_065275342.1\|932257_933097_-	NAD/NADP transhydrogenase subunit beta	NA	NA	NA	NA
WP_005375969.1\|933097_933388_-	type VI secretion protein	NA	NA	NA	NA
WP_005375968.1\|933399_935235_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	4.9e-27	25.1
WP_005375967.1\|935284_935764_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_065275343.1\|935972_938540_-	type VI secretion system ATPase TssH	H6X3M6	Enterobacteria_phage	6.5e-86	31.1

DBSCAN-SWA_80

956960 : 959111

Powai_lake_megavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275349.1\|956960_959111_+	serine/threonine protein kinase	A0A167RIZ6	Powai_lake_megavirus	2.3e-20	28.3

DBSCAN-SWA_81

967216 : 968053

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005450080.1\|967216_968053_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.2e-30	37.6

DBSCAN-SWA_82

980048 : 981962

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082240191.1\|980048_981962_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.6e-20	31.8

DBSCAN-SWA_83

987235 : 987904

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025767686.1\|987235_987904_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.0e-27	33.9

DBSCAN-SWA_84

1004625 : 1009096

Lactobacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275367.1\|1004625_1005456_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.8e-06	27.8
WP_054578999.1\|1005465_1006038_-	protocatechuate 3,4-dioxygenase	NA	NA	NA	NA
WP_065275368.1\|1006176_1006845_-	arginine ABC transporter permease ArtM	NA	NA	NA	NA
WP_042521067.1\|1006841_1007531_-	arginine ABC transporter permease ArtQ	NA	NA	NA	NA
WP_054579000.1\|1007532_1008264_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_042521069.1\|1008352_1009096_-	arginine ABC transporter ATP-binding protein ArtP	G9BWD6	Planktothrix_phage	3.2e-25	34.4

DBSCAN-SWA_85

1016049 : 1017651

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005390956.1\|1016049_1017651_-	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	8.6e-12	23.9

DBSCAN-SWA_86

1029147 : 1030922

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375778.1\|1029147_1029906_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	7.5e-06	27.1
WP_065275372.1\|1030016_1030922_-	3-hydroxyisobutyrate dehydrogenase	A0A077SLF7	Escherichia_phage	4.7e-23	27.6

DBSCAN-SWA_87

1038719 : 1044731

Pike_perch_iridovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275375.1\|1038719_1040324_+	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	1.2e-18	65.3
WP_065275376.1\|1040353_1041193_+	gamma-carboxygeranoyl-CoA hydratase	NA	NA	NA	NA
WP_065275377.1\|1041192_1042101_+	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	7.7e-50	40.0
WP_017634269.1\|1042147_1043026_-	DMT family transporter	NA	NA	NA	NA
WP_017821064.1\|1043417_1044731_-	PAS domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	6.4e-13	51.1

DBSCAN-SWA_88

1050957 : 1052007

Pontimonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080960069.1\|1050957_1052007_-	peptidoglycan DD-metalloendopeptidase family protein	A0A2K9VGT1	Pontimonas_phage	2.2e-16	37.5

DBSCAN-SWA_89

1067058 : 1071407

Chrysochromulina_ericina_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375680.1\|1067058_1068990_-	DEAD/DEAH box helicase	A0A0N9Q9J4	Chrysochromulina_ericina_virus	4.6e-52	29.8
WP_054579642.1\|1069403_1071407_+	exoribonuclease II	Q0GXV6	Lactococcus_phage	4.7e-31	24.5

DBSCAN-SWA_90

1075090 : 1078381

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033907145.1\|1075090_1076641_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	5.4e-27	30.2
WP_065275383.1\|1076926_1078381_+	molybdate ABC transporter ATP-binding protein ModF	Q9EMR9	Amsacta_moorei_entomopoxvirus	1.6e-09	23.8

DBSCAN-SWA_91

1085136 : 1086429

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375652.1\|1085136_1086429_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	6.4e-50	31.3

DBSCAN-SWA_92

1089593 : 1089806

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375644.1\|1089593_1089806_+	cold-shock protein	A0A1W6JNX5	Morganella_phage	4.4e-17	61.4

DBSCAN-SWA_93

1100425 : 1105585

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275386.1\|1100425_1102195_+	alkaline phosphatase	E3SII1	Synechococcus_phage	3.5e-06	33.3
WP_005375563.1\|1102266_1102605_-	4a-hydroxytetrahydrobiopterin dehydratase	NA	NA	NA	NA
WP_065275387.1\|1102594_1103389_-	phenylalanine 4-monooxygenase	NA	NA	NA	NA
WP_065275388.1\|1103611_1105585_+	acetoacetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	6.9e-19	26.8

DBSCAN-SWA_94

1114993 : 1117774

Clostridium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005388254.1\|1114993_1115473_-	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	6.3e-19	35.0
WP_065275394.1\|1115773_1117774_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.7e-20	26.2

DBSCAN-SWA_95

1139006 : 1141238

Feldmannia_species_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053350477.1\|1139006_1141238_+	response regulator	B5LWN0	Feldmannia_species_virus	3.3e-09	32.3

DBSCAN-SWA_96

1146854 : 1150604

Vibrio_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017635872.1\|1146854_1147745_-	sigma-70 family RNA polymerase sigma factor	A0A2I7SAT0	Vibrio_phage	1.2e-23	32.4
WP_065275397.1\|1148078_1149521_-	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	9.8e-15	28.5
WP_017635870.1\|1149732_1150029_-	alternative ribosome-rescue factor A	NA	NA	NA	NA
WP_005375625.1\|1150394_1150604_+	cold-shock protein	Q9AZD3	Lactococcus_phage	1.7e-16	66.1

DBSCAN-SWA_97

1159536 : 1164353

Flavobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017821601.1\|1159536_1161168_-	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	3.3e-11	36.4
WP_053350487.1\|1161164_1162328_-	cytochrome c oxidase subunit II	NA	NA	NA	NA
WP_017821603.1\|1162658_1164353_+	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	1.6e-93	36.4

DBSCAN-SWA_98

1172580 : 1173195

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053307846.1\|1172580_1173195_+	glutaredoxin	A0A0K1YA09	Cronobacter_phage	2.0e-09	45.1

DBSCAN-SWA_99

1176484 : 1179695

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375494.1\|1176484_1178305_+	phosphodiesterase	A0A127AWB9	Bacillus_phage	2.1e-06	28.8
WP_025768471.1\|1178411_1179695_-	peptidoglycan DD-metalloendopeptidase family protein	A0A2L1IVP0	Streptomyces_phage	1.0e-15	43.9

DBSCAN-SWA_100

1184132 : 1186004

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054574423.1\|1184132_1186004_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.6e-25	38.0

DBSCAN-SWA_101

1191553 : 1192429

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017635840.1\|1191553_1192429_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.2e-07	27.0

DBSCAN-SWA_102

1203073 : 1204000

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047101669.1\|1203073_1204000_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.8e-23	32.7

DBSCAN-SWA_103

1218486 : 1221721

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375420.1\|1218486_1219338_+	carbenicillin-hydrolyzing class A beta-lactamase CARB-42	Q1MVP3	Enterobacteria_phage	1.1e-50	43.3
WP_065275412.1\|1219620_1220670_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	4.9e-16	30.2
WP_005375417.1\|1221181_1221721_+	spermidine N1-acetyltransferase	G3MB37	Bacillus_virus	7.6e-05	25.0

DBSCAN-SWA_104

1229648 : 1233586

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275416.1\|1229648_1231808_-	S9 family peptidase	A0A1V0SHT0	Klosneuvirus	2.1e-69	35.2
WP_053350525.1\|1232014_1233586_-	ABC-F family ATP-binding cassette domain-containing protein	Q6DMX7	Streptococcus_phage	8.4e-28	25.8

DBSCAN-SWA_105

1247422 : 1248982

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275420.1\|1247422_1248982_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.2e-27	36.9

DBSCAN-SWA_106

1254572 : 1258455

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031777205.1\|1254572_1255205_-	aldolase	A0A077SK32	Escherichia_phage	1.0e-69	62.6
WP_065275632.1\|1255231_1256488_-	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	4.7e-130	56.0
WP_065275424.1\|1256513_1257422_-	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	2.8e-100	67.0
WP_005375354.1\|1257696_1258455_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.6e-56	47.4

DBSCAN-SWA_107

1261895 : 1263526

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009698234.1\|1261895_1262744_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.0e-17	33.8
WP_082240194.1\|1262764_1263526_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-12	27.0

DBSCAN-SWA_108

1268612 : 1275082

Proteus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025507102.1\|1268612_1269110_-	ribonuclease HI	A0A2H4PRM3	Proteus_phage	1.4e-16	37.6
WP_005483022.1\|1269278_1269890_-	hypothetical protein	NA	NA	NA	NA
WP_005479249.1\|1270551_1270752_-	hypothetical protein	NA	NA	NA	NA
WP_065275426.1\|1270899_1271544_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	2.4e-13	33.2
WP_025505472.1\|1271818_1273546_-	recombinase family protein	Q3HQV4	Burkholderia_phage	7.1e-28	28.7
WP_005479216.1\|1273608_1273890_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_005385059.1\|1274167_1275082_+	chemotaxis protein CheV	Q56AR1	Bacillus_thuringiensis_phage	1.2e-23	26.1

DBSCAN-SWA_109

1282246 : 1283029

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005385036.1\|1282246_1283029_+	heme ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.9e-15	30.6

DBSCAN-SWA_110

1289090 : 1289921

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275433.1\|1289090_1289921_+	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	1.3e-59	48.5

DBSCAN-SWA_111

1296309 : 1297254

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033906772.1\|1296309_1297254_+	iron chelate uptake ABC transporter family permease subunit	A0A2H4IY97	uncultured_Caudovirales_phage	1.9e-59	35.6

DBSCAN-SWA_112

1301765 : 1305064

Pithovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275437.1\|1301765_1303376_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	3.4e-16	31.3
WP_017821247.1\|1303372_1305064_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.4e-22	40.3

DBSCAN-SWA_113

1312884 : 1314003

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375271.1\|1312884_1314003_+	maltose/maltodextrin ABC transporter ATP-binding protein MalK	G3M9Y6	Bacillus_virus	2.0e-23	32.4

DBSCAN-SWA_114

1329575 : 1332088

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017821260.1\|1329575_1331015_+	catalase	A0A2K9L0T1	Tupanvirus	4.7e-102	47.2
WP_005375233.1\|1331209_1332088_-	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	3.1e-27	32.6

DBSCAN-SWA_115

1346083 : 1358163

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021035854.1\|1346083_1347820_+	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	2.0e-30	27.5
WP_054578636.1\|1347912_1348839_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	6.9e-54	38.4
WP_065275452.1\|1349086_1350451_-	Ktr system potassium transporter B	NA	NA	NA	NA
WP_025768537.1\|1350452_1351106_-	TrkA family potassium uptake protein	NA	NA	NA	NA
WP_025768538.1\|1351257_1351956_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.5e-24	30.8
WP_162171731.1\|1351952_1352996_-	DUF4118 domain-containing protein	W8CYF6	Bacillus_phage	2.2e-16	27.0
WP_033906862.1\|1353224_1355078_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.1e-30	26.4
WP_054578633.1\|1355223_1357326_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_017635311.1\|1357377_1358163_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-14	28.2

DBSCAN-SWA_116

1363401 : 1365120

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375169.1\|1363401_1365120_-	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	2.7e-19	24.2

DBSCAN-SWA_117

1368126 : 1370043

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017821859.1\|1368126_1370043_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.5e-18	52.9

DBSCAN-SWA_118

1377227 : 1385207

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275462.1\|1377227_1379354_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.7e-10	33.0
WP_005375156.1\|1379682_1380432_-	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.5e-14	28.6
WP_005383923.1\|1380492_1381356_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_005375154.1\|1381378_1382311_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_005375153.1\|1382411_1383233_-	phosphate ABC transporter substrate-binding protein	E3SLK5	Synechococcus_phage	7.3e-07	28.5
WP_065275463.1\|1383563_1385207_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.8e-10	58.0

DBSCAN-SWA_119

1391773 : 1399442

Organic_Lake_phycodnavirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275468.1\|1391773_1393771_-	S9 family peptidase	F2Y2S5	Organic_Lake_phycodnavirus	1.6e-10	30.3
WP_017820508.1\|1394095_1395439_-	DEAD/DEAH box helicase	E3T5E1	Cafeteria_roenbergensis_virus	5.7e-41	31.2
WP_005375145.1\|1395989_1396244_+	membrane protein	NA	NA	NA	NA
WP_005375144.1\|1396270_1397197_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_033906725.1\|1397203_1398619_-	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	3.4e-60	31.1
WP_065275469.1\|1398641_1399442_-	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	2.1e-19	30.3

DBSCAN-SWA_120

1404665 : 1415086

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017820511.1\|1404665_1406249_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	4.0e-17	40.7
WP_005375135.1\|1406493_1406874_+	DUF3302 domain-containing protein	NA	NA	NA	NA
WP_005375134.1\|1406873_1408004_+	HlyD family secretion protein	NA	NA	NA	NA
WP_065275470.1\|1408339_1408888_+	ECF-type riboflavin transporter substrate-binding protein	NA	NA	NA	NA
WP_065275471.1\|1408894_1410634_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.5e-20	35.1
WP_065275472.1\|1410630_1411470_+	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_025768568.1\|1411592_1411874_-	hypothetical protein	A0A2H4IYD3	uncultured_Caudovirales_phage	8.2e-19	61.6
WP_005375129.1\|1412080_1413262_-	MFS transporter	NA	NA	NA	NA
WP_065275473.1\|1413461_1414316_-	quinol dehydrogenase ferredoxin subunit NapH	NA	NA	NA	NA
WP_005383947.1\|1414315_1415086_-	ferredoxin-type protein NapG	A0A077SLP0	Escherichia_phage	7.3e-09	28.1

DBSCAN-SWA_121

1419654 : 1421283

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375120.1\|1419654_1421283_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.8e-31	46.8

DBSCAN-SWA_122

1424707 : 1428615

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275475.1\|1424707_1426339_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.1e-20	32.6
WP_065275476.1\|1426581_1428615_-	S9 family peptidase	A0A1V0SHT0	Klosneuvirus	1.6e-66	31.7

DBSCAN-SWA_123

1441376 : 1443646

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033906709.1\|1441376_1442408_-	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	6.5e-21	88.5
WP_065275482.1\|1442452_1443646_-	glycine C-acetyltransferase	V5LQ39	Emiliania_huxleyi_virus	8.6e-41	29.8

DBSCAN-SWA_124

1449131 : 1451897

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017635497.1\|1449131_1449647_+	superoxide dismutase family protein	Q9MC02	Salmonella_phage	1.6e-44	53.3
WP_065275485.1\|1449675_1451049_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_005375088.1\|1451165_1451897_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-30	32.8

DBSCAN-SWA_125

1462034 : 1463093

Neodiprion_lecontei_nucleopolyhedrovirus(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025768593.1\|1462034_1463093_+\|protease	serine protease	Q6JPG5	Neodiprion_lecontei_nucleopolyhedrovirus	7.2e-15	27.4

DBSCAN-SWA_126

1487354 : 1493701

Lactococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275491.1\|1487354_1487732_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	1.4e-26	48.4
WP_005374999.1\|1487844_1488060_-	TIGR02450 family Trp-rich protein	NA	NA	NA	NA
WP_064369614.1\|1488198_1488672_-	HPP family protein	NA	NA	NA	NA
WP_065275492.1\|1488770_1489316_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_065275493.1\|1489400_1491824_-	formate C-acetyltransferase/glycerol dehydratase family glycyl radical enzyme	A0A1S6KUZ1	Providencia_phage	3.9e-08	40.8
WP_065275494.1\|1491826_1492768_-	glycyl-radical enzyme activating protein	A0A2P0VNQ0	Tetraselmis_virus	6.6e-12	24.1
WP_065275635.1\|1493026_1493701_+	fructose-6-phosphate aldolase	A0A0E3FNR2	Synechococcus_phage	6.8e-27	31.8

DBSCAN-SWA_127

1499816 : 1501007

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054574896.1\|1499816_1501007_+	MFS transporter	S4TR35	Salmonella_phage	3.2e-11	23.3

DBSCAN-SWA_128

1522051 : 1523209

Stx2-converting_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029803147.1\|1522051_1523209_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	1.9e-77	43.1

DBSCAN-SWA_129

1526633 : 1530626

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275505.1\|1526633_1528115_+	deoxyribodipyrimidine photo-lyase	A0A1V0S949	Catovirus	2.1e-28	25.4
WP_005384595.1\|1528195_1528696_+	fasciclin domain-containing protein	NA	NA	NA	NA
WP_065275506.1\|1529162_1530626_+	N-acetylglucosamine-binding protein GbpA	A0A0K1Y848	Apis_mellifera_filamentous_virus	1.2e-12	31.5

DBSCAN-SWA_130

1545248 : 1545623

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275513.1\|1545248_1545623_-	DUF1232 domain-containing protein	A0A2I7S9Z5	Vibrio_phage	1.6e-25	53.5

DBSCAN-SWA_131

1557628 : 1560082

Iris_mild_mosaic_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053307964.1\|1557628_1560082_-	glycogen/starch/alpha-glucan phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	3.0e-16	44.8

DBSCAN-SWA_132

1566303 : 1566612

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005374825.1\|1566303_1566612_+	PTS transporter subunit EIIB	A0A2I7SAJ6	Vibrio_phage	3.4e-10	41.7

DBSCAN-SWA_133

1576736 : 1578353

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275518.1\|1576736_1578353_-	endonuclease I	A0A2P0VMP9	Tetraselmis_virus	6.0e-13	31.4

DBSCAN-SWA_134

1594751 : 1595486

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275522.1\|1594751_1595486_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.2e-13	29.4

DBSCAN-SWA_135

1606563 : 1619810

Enterobacteria_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005374731.1\|1606563_1607571_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.0e-18	27.6
WP_065275528.1\|1607717_1608362_+	recombinase family protein	NA	NA	NA	NA
WP_065275529.1\|1608358_1609543_+	multidrug effflux MFS transporter	S4TR35	Salmonella_phage	1.0e-22	28.4
WP_114139543.1\|1609620_1610265_+	START domain-containing protein	NA	NA	NA	NA
WP_025998608.1\|1610348_1612085_-	hypothetical protein	NA	NA	NA	NA
WP_005374721.1\|1612530_1613484_+	M23 family metallopeptidase	V5R8R0	Arthrobacter_phage	3.6e-13	42.2
WP_080659230.1\|1613387_1613840_+	polymer-forming cytoskeletal protein	NA	NA	NA	NA
WP_065275530.1\|1613927_1616678_-	insulinase family protein	A0A2P1EL85	Moumouvirus	3.1e-17	30.0
WP_054575393.1\|1619045_1619810_-	Fe(3+) dicitrate ABC transporter ATP-binding protein FecE	G9BWD6	Planktothrix_phage	4.9e-13	28.9

DBSCAN-SWA_136

1633430 : 1643839

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275538.1\|1633430_1634633_+	type III PLP-dependent enzyme	A0A060D2X4	Bovine_gammaherpesvirus	1.0e-12	24.5
WP_065275539.1\|1634707_1635952_-	carbohydrate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_017634508.1\|1635954_1637385_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.2e-07	21.4
WP_065275540.1\|1637374_1638082_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.9e-33	37.1
WP_082240198.1\|1638347_1639790_+	PTS transporter subunit EIIC	A0A2I7SAJ6	Vibrio_phage	4.3e-10	42.4
WP_005383492.1\|1639885_1640332_-	DUF302 domain-containing protein	NA	NA	NA	NA
WP_065275542.1\|1640559_1642551_+	U32 family peptidase	Q6DW11	Phage_TP	2.4e-19	27.0
WP_005374689.1\|1642656_1642902_+	DUF3297 family protein	NA	NA	NA	NA
WP_064355001.1\|1643128_1643839_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.0e-20	28.4

DBSCAN-SWA_137

1654049 : 1655618

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275548.1\|1654049_1655618_+	alkyl hydroperoxide reductase subunit F	G3MA85	Bacillus_virus	1.3e-39	32.4

DBSCAN-SWA_138

1659764 : 1660250

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047102449.1\|1659764_1660250_+	sigma-70 family RNA polymerase sigma factor	G0X4Y0	Salmonella_phage	6.6e-08	26.7

DBSCAN-SWA_139

1663955 : 1668716

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275552.1\|1663955_1665194_-	DEAD/DEAH box helicase	A0A1B1IS59	uncultured_Mediterranean_phage	6.4e-47	31.1
WP_005374598.1\|1665459_1666461_-	amidinotransferase	NA	NA	NA	NA
WP_005374597.1\|1666865_1668716_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	6.0e-33	25.4

DBSCAN-SWA_140

1679234 : 1681722

Bordetella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025768702.1\|1679234_1680047_-	AraC family transcriptional regulator	A0A291LAM3	Bordetella_phage	1.4e-05	35.4
WP_082240199.1\|1681002_1681722_+	helix-turn-helix transcriptional regulator	A2I306	Vibrio_virus	6.6e-36	41.6

DBSCAN-SWA_141

1689934 : 1692049

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005374556.1\|1689934_1692049_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	4.0e-33	26.6

DBSCAN-SWA_142

1702566 : 1710545

Burkholderia_virus(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275563.1\|1702566_1703478_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	6.0e-10	24.8
WP_065275564.1\|1703566_1704226_+	CatB-related O-acetyltransferase	A0A2R8FE91	Brazilian_cedratvirus	1.1e-26	40.4
WP_065275565.1\|1704281_1705961_-	DUF342 domain-containing protein	NA	NA	NA	NA
WP_065275566.1\|1706212_1708240_-\|tRNA	tRNA(Met) cytidine acetyltransferase	Q56AQ2	Bacillus_thuringiensis_phage	1.0e-09	27.7
WP_005374504.1\|1708345_1709320_-	ParB/RepB/Spo0J family partition protein	Q6UAV8	Klebsiella_phage	5.6e-22	30.3
WP_005374503.1\|1709327_1710545_-	ParA family protein	Q1MVJ3	Enterobacteria_phage	4.5e-37	29.8

DBSCAN-SWA_143

1714510 : 1720944

Bacillus_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275568.1\|1714510_1715443_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-14	31.8
WP_065275569.1\|1715445_1716294_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.4e-16	30.8
WP_005374493.1\|1716655_1716853_+	hypothetical protein	NA	NA	NA	NA
WP_082240200.1\|1717091_1718153_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.9e-39	44.0
WP_005374490.1\|1718221_1718977_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_064369543.1\|1719045_1720944_+	hybrid sensor histidine kinase/response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	2.5e-58	37.7

DBSCAN-SWA_144

1724332 : 1725031

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054578576.1\|1724332_1725031_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.6e-40	41.7

DBSCAN-SWA_145

1728439 : 1732688

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275573.1\|1728439_1729462_+	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	1.4e-20	30.7
WP_053303980.1\|1729477_1730269_+	response regulator transcription factor	NA	NA	NA	NA
WP_020195057.1\|1730409_1730904_-	peptidyl-prolyl cis-trans isomerase	A0A076FI46	Aureococcus_anophage	1.3e-11	31.4
WP_065275574.1\|1731026_1732688_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.1e-17	65.4

DBSCAN-SWA_146

1737098 : 1737956

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005383221.1\|1737098_1737956_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.8e-16	28.3

DBSCAN-SWA_147

1747363 : 1747846

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025768736.1\|1747363_1747846_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	1.4e-29	47.0

DBSCAN-SWA_148

1754952 : 1760551

Orgyia_leucostigma_nucleopolyhedrovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275585.1\|1754952_1757499_-	chitinase	B0FDP2	Orgyia_leucostigma_nucleopolyhedrovirus	1.0e-147	48.0
WP_005374408.1\|1757868_1758372_-	DUF2850 domain-containing protein	NA	NA	NA	NA
WP_065275586.1\|1758700_1758985_+	pyrimidine/purine nucleoside phosphorylase	NA	NA	NA	NA
WP_005374405.1\|1759117_1759399_+	hypothetical protein	NA	NA	NA	NA
WP_065275587.1\|1759402_1760551_-	GGDEF domain-containing protein	G3MA91	Bacillus_virus	3.1e-19	33.3

DBSCAN-SWA_149

1764901 : 1772241

Diadromus_pulchellus_ascovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275591.1\|1764901_1765768_-	MBL fold metallo-hydrolase	F2NZ47	Diadromus_pulchellus_ascovirus	1.2e-20	28.0
WP_017633830.1\|1765894_1766782_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_017633831.1\|1766876_1767680_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_031778858.1\|1767773_1768178_-	hypothetical protein	NA	NA	NA	NA
WP_017821028.1\|1768187_1769285_-	GGDEF domain-containing protein	G3MA91	Bacillus_virus	1.1e-10	33.8
WP_017633833.1\|1769290_1769749_-	oxidoreductase	NA	NA	NA	NA
WP_005374382.1\|1770190_1771030_-	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_017633834.1\|1771092_1772241_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	8.9e-35	28.9

DBSCAN-SWA_150

1776699 : 1777878

Agrotis_ipsilon_multiple_nucleopolyhedrovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275592.1\|1776699_1777878_+	Spindolin	B6D5U4	Agrotis_ipsilon_multiple_nucleopolyhedrovirus	3.6e-31	38.1

DBSCAN-SWA_151

1786807 : 1787344

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053350101.1\|1786807_1787344_-	DUF924 domain-containing protein	A0A1V0SIY0	Klosneuvirus	1.2e-23	36.5

DBSCAN-SWA_152

1793048 : 1795718

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042522351.1\|1793048_1794185_+	glycerate kinase	W6LM47	Streptococcus_phage	3.7e-41	37.0
WP_065275596.1\|1794281_1795718_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	5.2e-24	26.6

DBSCAN-SWA_153

1799464 : 1804556

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275598.1\|1799464_1800196_-	glucose 1-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	4.8e-26	31.7
WP_025768771.1\|1800205_1800721_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_005374302.1\|1800991_1802086_+	cytochrome c	NA	NA	NA	NA
WP_065275599.1\|1802108_1804556_+	molybdopterin guanine dinucleotide-containing S/N-oxide reductase	A0A077SK27	Escherichia_phage	3.3e-79	29.5

DBSCAN-SWA_154

1809597 : 1810353

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064354467.1\|1809597_1810353_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.5e-27	40.4

DBSCAN-SWA_155

1826449 : 1829261

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005388683.1\|1826449_1827373_-	type I pantothenate kinase	A0A1B1ISL9	uncultured_Mediterranean_phage	1.8e-30	34.2
WP_005381361.1\|1828076_1829261_+	elongation factor Tu	A0A076FFS6	Aureococcus_anophage	5.0e-33	28.5

DBSCAN-SWA_156

1833235 : 1841571

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005384685.1\|1833235_1837264_+	DNA-directed RNA polymerase subunit beta	A0A1B1ISA9	uncultured_Mediterranean_phage	3.6e-22	29.8
WP_005382514.1\|1837368_1841571_+	DNA-directed RNA polymerase subunit beta'	R4TQM7	Phaeocystis_globosa_virus	9.4e-50	25.2

DBSCAN-SWA_157

1848385 : 1852460

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005382524.1\|1848385_1848658_+	DNA-binding protein HU-alpha	A7KV42	Bacillus_phage	2.0e-22	60.7
WP_053303483.1\|1848697_1849396_+	DUF1481 domain-containing protein	NA	NA	NA	NA
WP_065275608.1\|1849480_1850770_-	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_017635551.1\|1850867_1852460_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	7.9e-74	51.0

DBSCAN-SWA_158

1868032 : 1870498

Only_Syngen_Nebraska_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275611.1\|1868032_1869028_-	2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	6.9e-68	42.1
WP_005374271.1\|1869269_1869752_+	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_065275612.1\|1869787_1870498_-	glycerophosphoryl diester phosphodiesterase	A0A173GBD0	Staphylococcus_phage	5.5e-19	28.6

Anti-CRISPR protein detection

Acr_ID: NZ_CP016225.1|WP_005381361.1|1828076_1829261_+|elongation-factor-Tu

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP016225.1|WP_005381361.1|1828076_1829261_+|elongation-factor-Tu

1828076_1829261_+

394 aa aa

1826449-1829261

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP016224_1	Orphan	1.1\|2809893\|40\|NZ_CP016224\|PILER-CR	2809893-2809932	40	1827621-1827660	0

1. spacer 1.1|2809893|40|NZ_CP016224|PILER-CR matches to NZ_CP016225 position: 1827621-1827660, mismatch: 0

taggtcaccagttcgattccggtagtcggcaccattcttt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccattcttt	Protospacer
****************************************

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP016224

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP016225

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information