CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP016346	Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 strain ATCC 14048 chromosome 2, complete sequence	0 crisprs	csa3,cas3,DEDDh	0	0	1	0
NZ_CP016345	Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 strain ATCC 14048 chromosome 1, complete sequence	1 crisprs	cas3,DinG,csa3,cas5f,cas7f,cas6f,csx1,DEDDh	1	1	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1175264 : 1183109

Bacillus_virus(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014235081.1\|1175264_1176116_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	4.4e-31	36.9
WP_020335006.1\|1176145_1177177_-	taurine ABC transporter substrate-binding protein	G3M9Z0	Bacillus_virus	1.8e-07	27.7
WP_020335007.1\|1177392_1178808_-	aminotransferase class III-fold pyridoxal phosphate-dependent enzyme	A0A1V0SKB7	Klosneuvirus	2.4e-21	24.5
WP_024372629.1\|1178987_1180463_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	2.4e-16	27.3
WP_020335009.1\|1180656_1181382_+	TSUP family transporter	NA	NA	NA	NA
WP_020335010.1\|1181401_1182178_+	SDR family NAD(P)-dependent oxidoreductase	F2NZ12	Diadromus_pulchellus_ascovirus	7.6e-06	29.6
WP_020335011.1\|1182413_1183109_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-22	29.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP016345

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP016345_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016345_1

2746845-2747101

Orphan

Consensus_repeat	Method
GTGCCTCCTTAGCTCAGTAGGTAGAGCAACGGACTGATAATCCG	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP016345_1

>merge|NZ_CP016345|1|2746845-2747101|PILER-CR
GTGCCGACTTAGCTCAGTAGGTAGAGCAACTGACTTGTAATCAGTAGGTCACCAGTTCGATTCCGGTAGTCGGCACCATTCTTTTGCCTCGATAGCTCAGTCGGTAGAGCAGAGGATTGAAAATCCTCGTGTCGGTGGTTCGATTCCGCCTCGAGGCACCATTATTTGGTGCACTTGCTTAATTTAATTGATTAGCAAGACACAAACAGAATAGTTCCTCCTTAGCTCAGTTGGTAGAGCGACGGACTGTTAATCCG

>NZ_CP016345|1|1|2746845-2747101|PILER-CR
GTGCCGACTTAGCTCAGTAGGTAGAGCAACTGACTTGTAATCAG	TAGGTCACCAGTTCGATTCCGGTAGTCGGCACCATTCTT
TTGCCTCGATAGCTCAGTCGGTAGAGCAGAGGATTGAAAATCCT	CGTGTCGGTGGTTCGATTCCGCCTCGAGGCACCATTATTTGGTGCACTTGCTTAATTTAATTGATTAGCAAGACACAAACAGAATA
GTTCCTCCTTAGCTCAGTTGGTAGAGCGACGGACTGTTAATCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016345.1\|WP_014233039.1\|2740664_2741585_-\|glutaminase-B	unknown	unknown	gnl\|CDD\|234880
NZ_CP016345.1\|WP_014233048.1\|2759412_2760351_-\|bile-acid:sodium-symporter-family-protein	unknown	unknown	gnl\|CDD\|223462
NZ_CP016345.1\|WP_020334005.1\|2743636_2744713_+\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|182805
NZ_CP016345.1\|WP_020334476.1\|2766550_2768059_+\|leucyl-aminopeptidase	unknown	unknown	gnl\|CDD\|234863
NZ_CP016345.1\|WP_024372823.1\|2739410_2740586_+\|radical-SAM-family-heme-chaperone-HemW	unknown	unknown	gnl\|CDD\|235550
NZ_CP016345.1\|WP_020334004.1\|2741673_2742702_-\|DNA-methylase	unknown	unknown	gnl\|CDD\|223971
NZ_CP016345.1\|WP_014233043.1\|2744732_2745005_+\|oxidative-damage-protection-protein	unknown	unknown	gnl\|CDD\|180059
NZ_CP016345.1\|WP_020334002.1\|2738225_2738657_+\|DUF4426-domain-containing-protein	unknown	unknown	gnl\|CDD\|379616
NZ_CP016345.1\|WP_020334007.1\|2747400_2749026_+\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|214599
NZ_CP016345.1\|WP_020334474.1\|2762202_2763471_+\|DUF2254-domain-containing-protein	unknown	unknown	gnl\|CDD\|378351
NZ_CP016345.1\|WP_020334472.1\|2758598_2759273_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NZ_CP016345.1\|WP_014233041.1\|2742713_2743433_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	unknown	unknown	gnl\|CDD\|234649
NZ_CP016345.1\|WP_020334473.1\|2761358_2762024_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187643
NZ_CP016345.1\|WP_014233036.1\|2737860_2738151_+\|YggU-family-protein	unknown	unknown	gnl\|CDD\|179931
NZ_CP016345.1\|WP_014233038.1\|2738790_2739393_+\|XTP/dITP-diphosphatase	unknown	unknown	gnl\|CDD\|234648
NZ_CP016345.1\|WP_020334475.1\|2765249_2766350_-\|LPS-export-ABC-transporter-permease-LptF	unknown	unknown	gnl\|CDD\|185075
NZ_CP016345.1\|WP_014233052.1\|2764175_2765246_-\|LPS-export-ABC-transporter-permease-LptG	unknown	unknown	gnl\|CDD\|237900
NZ_CP016345.1\|WP_014233051.1\|2763663_2764143_+\|RDD-family-protein	unknown	unknown	gnl\|CDD\|377640
NZ_CP016345.1\|WP_020334471.1\|2757043_2758297_-\|HD-GYP-domain-containing-protein	unknown	unknown	gnl\|CDD\|225116
NZ_CP016345.1\|WP_020334006.1\|2745097_2746240_+\|membrane-bound-lytic-murein-transglycosylase-MltC	unknown	unknown	gnl\|CDD\|183271

Protein	Function_ID	Function_description	E-value
NZ_CP016345.1\|WP_014233039.1\|2740664_2741585_-\|glutaminase-B	gnl\|CDD\|234880	PRK00971, PRK00971, glutaminase; Provisional.	0
NZ_CP016345.1\|WP_014233048.1\|2759412_2760351_-\|bile-acid:sodium-symporter-family-protein	gnl\|CDD\|223462	COG0385, COG0385, Predicted Na+-dependent transporter [General function prediction only].	2.19836e-83
NZ_CP016345.1\|WP_020334005.1\|2743636_2744713_+\|A/G-specific-adenine-glycosylase	gnl\|CDD\|182805	PRK10880, PRK10880, adenine DNA glycosylase.	0
NZ_CP016345.1\|WP_020334476.1\|2766550_2768059_+\|leucyl-aminopeptidase	gnl\|CDD\|234863	PRK00913, PRK00913, multifunctional aminopeptidase A; Provisional.	0
NZ_CP016345.1\|WP_024372823.1\|2739410_2740586_+\|radical-SAM-family-heme-chaperone-HemW	gnl\|CDD\|235550	PRK05660, PRK05660, radical SAM family heme chaperone HemW.	0
NZ_CP016345.1\|WP_020334004.1\|2741673_2742702_-\|DNA-methylase	gnl\|CDD\|223971	COG1041, COG1041, Predicted DNA modification methylase [DNA replication, recombination, and repair].	1.62286e-08
NZ_CP016345.1\|WP_014233043.1\|2744732_2745005_+\|oxidative-damage-protection-protein	gnl\|CDD\|180059	PRK05408, PRK05408, oxidative damage protection protein; Provisional.	3.33891e-59
NZ_CP016345.1\|WP_020334002.1\|2738225_2738657_+\|DUF4426-domain-containing-protein	gnl\|CDD\|379616	pfam14467, DUF4426, Domain of unknown function (DUF4426). Members of this entry are found mostly in g-proteobacteria, especially in Vibrio. Strangely enough, there seems to be one eukaryotic homolog in Nematostella vectensis (NEMVEDRAFT_v1g226006), where the PA0388-like domain is fused with a domain homogous to the Methionine biosynthesis protein MetW (see below). In several Pseudomonas species, but also in Vibrio vulnificus and Azotobacter vinelandii PA0388 homologs are genomic neighbors of Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15) and Methionine biosynthesis protein MetW. On the other hand, in most Vibrio species it appears as a part of a conserved operon involved in possible response to stress.	3.41423e-65
NZ_CP016345.1\|WP_020334007.1\|2747400_2749026_+\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	8.61393e-59
NZ_CP016345.1\|WP_020334474.1\|2762202_2763471_+\|DUF2254-domain-containing-protein	gnl\|CDD\|378351	pfam10011, DUF2254, Predicted membrane protein (DUF2254). Members of this family of bacterial proteins comprises various hypothetical and putative membrane proteins. Their exact function, has not, as yet, been defined.	9.7225e-119
NZ_CP016345.1\|WP_020334472.1\|2758598_2759273_+\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	5.60223e-60
NZ_CP016345.1\|WP_014233041.1\|2742713_2743433_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	gnl\|CDD\|234649	PRK00121, trmB, tRNA (guanine-N(7)-)-methyltransferase; Reviewed.	4.68784e-109
NZ_CP016345.1\|WP_020334473.1\|2761358_2762024_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187643	cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR. These proteins include members identified as KDSR, ribitol type dehydrogenase, and others. The group shows strong conservation of the active site tetrad and glycine rich NAD-binding motif of the classical SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	3.80707e-68
NZ_CP016345.1\|WP_014233036.1\|2737860_2738151_+\|YggU-family-protein	gnl\|CDD\|179931	PRK05090, PRK05090, hypothetical protein; Validated.	6.66239e-61
NZ_CP016345.1\|WP_014233038.1\|2738790_2739393_+\|XTP/dITP-diphosphatase	gnl\|CDD\|234648	PRK00120, PRK00120, dITP/XTP pyrophosphatase; Reviewed.	3.98284e-124
NZ_CP016345.1\|WP_020334475.1\|2765249_2766350_-\|LPS-export-ABC-transporter-permease-LptF	gnl\|CDD\|185075	PRK15120, PRK15120, lipopolysaccharide ABC transporter permease LptF; Provisional.	2.71332e-132
NZ_CP016345.1\|WP_014233052.1\|2764175_2765246_-\|LPS-export-ABC-transporter-permease-LptG	gnl\|CDD\|237900	PRK15071, PRK15071, lipopolysaccharide ABC transporter permease; Provisional.	0
NZ_CP016345.1\|WP_014233051.1\|2763663_2764143_+\|RDD-family-protein	gnl\|CDD\|377640	pfam06271, RDD, RDD family. This family of proteins contain three highly conserved amino acids: one arginine and two aspartates, hence the name of RDD family. This region contains two predicted transmembrane regions. The arginine occurs at the N-terminus of the first helix and the first aspartate occurs in the middle of this helix. The molecular function of this region is unknown. However this region may be involved in transport of an as yet unknown set of ligands (Bateman A pers. obs.).	1.51369e-15
NZ_CP016345.1\|WP_020334471.1\|2757043_2758297_-\|HD-GYP-domain-containing-protein	gnl\|CDD\|225116	COG2206, COG2206, c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms].	1.15487e-68
NZ_CP016345.1\|WP_020334006.1\|2745097_2746240_+\|membrane-bound-lytic-murein-transglycosylase-MltC	gnl\|CDD\|183271	PRK11671, mltC, membrane-bound lytic murein transglycosylase MltC.	4.82438e-147

>NZ_CP016345.1|WP_020334006.1|2745097_2746240_+|membrane-bound-lytic-murein-transglycosylase-MltC
MKKIVFIVAALLLTAGCSREVVEKFYDVEYEPTNRFANNLAELPGQFEKDTAALDSLINSFSGNIQKKWGKREVKLAGKSNYVKYIDNYLSRAEVDFQKGVITIETVSPTEPQKHLKNAIITTLLTPDDPANVDLFSSKDIKLEGQPFLYKQVVDQDNKPIQWSWRANRFADYLLNHEIKTKDVDFKKAYYVEIPMVEDHFIQRSYQYANIVRRAAEKYDIPEDLIYAIIKTESSFNPYAVSWANAYGLMQVVPKTAGRDVFALVKNRSGQPSPEYLFNPENNIDTGTAYFYILKNRYLKDVSHPTSLEYSMISAYNGGTGGVLNTFNRSDRKRAMRDLNSLQPNQVYWALTKKHPNAEARRYLEKVTNFKKEFNSVQTF
>NZ_CP016345.1|WP_014233043.1|2744732_2745005_+|oxidative-damage-protection-protein
MSRTVFCARLKKEGEGLDFQLYPGELGKRIFDNISKEAWAEWQHKQTMLINEKKLNMMDPEHRKLIETEMVNFLFEGKDVHIDGYTPPSE
>NZ_CP016345.1|WP_020334005.1|2743636_2744713_+|A/G-specific-adenine-glycosylase
MTPFASAILEWYDAYGRKDLPWQQNKTAYSVWLSEIMLQQTQVTTVIPYYQRFLERFPTVVDLANAEQDEVLHLWTGLGYYARARNLHKAAKEVAQTYNGEFPLDIEQMNALPGIGRSTAAAVLSSVHKQPHAILDGNVKRTLSRCFAVEGWPGQKKVENKLWEIAEAHTPQTDVDKYNQAMMDMGAMVCTRSKPKCTLCPVADLCVAKKQGNILDYPGKKPKKDKPVKQTRFVMLHHKNANGHEVWLEQRPQTGIWGGLFCFPQTEHVDVESDIDLLLEQRGIQTNDIKEQQTLITFRHTFSHYHLDITPILIDLSKQPDVIMEGNKGLWYNLSKPEEVGLAAPVKLLLETLPHELR
>NZ_CP016345.1|WP_014233041.1|2742713_2743433_-|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB
MSEVTTNEYNEDGKLIRKIRSFVRREGRLTKGQESAMNECWPTMGIDYKAELLDWKEVFGNDNPVVLEIGFGMGASLVEMAKNAPEKNFIGIEVHSPGVGACLADAREAGLTNLRVMCHDAVEVFEHMIPNDSLATLQLFFPDPWHKKRHHKRRIVQLEFAEMVRQKLIPNEGIFHMATDWENYAEHMIEIMNQAPGFENIAEEGDFVPRPEERPLTKFEARGHRLGHGVWDIKFKRTA
>NZ_CP016345.1|WP_020334004.1|2741673_2742702_-|DNA-methylase
MYHYAILANPGHNRIYFDSAMTIACSELKAMLAAEGVEVTEIGSKDVGLPAALVFSCAEALNDEQSRKIAASSIYYALFEVREDGLLRPIQAPAFNTFPESMSQILRYTGKTNEQFTRLMVNLGVSAANTDSAQLTLMDPMCGKGTTLFEGLIHGLNVVGVEINQKWVQEIQTFVVKFMKNGRFKHKVSKEKRTSGGKKVADGFVVEAAATKEDYNQGNLQTMKLYSADTRIADQVVKKNSVDVMVSDLPYGVQHGSKNAKDSKLNRSPLELLKEALPAWKVVLKKQGSVVLSFNEFTLKWKDVAALFEEQGWKVLSEDPYIGYLHRVDQSINRNIIVAVKP
>NZ_CP016345.1|WP_014233039.1|2740664_2741585_-|glutaminase-B
MKPTVEILTDILTEVRPLIGQGKVADYIPALAKVPSNKLGIAVYTNDGEVIKAGDADEPFSIQSISKALSLTLAMCLYKQEEIWARVGKEPSGQAFNSLIQLEMEQGIPRNPFINAGAIVVADLLQSRLSAPRQRLLEFVRQLSGDTHIVYDKVVAASEMMHGDRNAAIAYLMRSFGNFENEVIPVLQNYFHACALKMSCVDLAKTFSYLANKGTSVHTGKPIVSPTQTKQLNALLATCGLYDGAGEFAYRVGMPGKSGVGGGIIAVVPGDMTIAVWSPELDPAGNSLAGTKALELLSERIGRSIF
>NZ_CP016345.1|WP_024372823.1|2739410_2740586_+|radical-SAM-family-heme-chaperone-HemW
MLTPPALSLYVHIPWCVQKCPYCDFNSHELKAEIPEEQYINALLEDLDTDIEKYRLNDAPRPLHSIFIGGGTPSLISAQGIERLLKGIEERIPFKTDIEITMEANPGTIEAERFAGYRKAGVTRISIGVQSFEQEKLERLGRIHGKDEAVNAANLAHQIGLNSFNLDLMHGLPDQSIEQALADLDKAIELAPPHLSWYQLTIEPNTMFYYKPPTLPDDDDLWDIFELGHKKLAAAGYVQYEISGYSKPGFQCQHNLNYWRFGDYLGIGCGSHGKLSFADGRIIRTTKVKHPRGYLAAYQNMVKPYLHTEQFVEDEDRPFEFFMNRFRLMEACPKQDFIDTTGLPLSSIQDTIDWALELGYLSETETHWQITEKGKLFLNDLLEAFMAEEDE
>NZ_CP016345.1|WP_014233038.1|2738790_2739393_+|XTP/dITP-diphosphatase
MKKIVLATGNQGKVREMADLLSDFGFEVLAQSEFNVSEVAETGTTFIENAIIKARHAAQETGLPAIADDSGLEVDYLNGAPGIYSARYAGEGATDQDNLEKLLKAMEGVPEAERTARFHCVLVLMRHKDDPTPVVCHGKWEGRILTEAHGENGFGYDPVFFVPEDNCASAELEPARKKQLSHRGKALKSLFAQLSEQAAQ
>NZ_CP016345.1|WP_020334002.1|2738225_2738657_+|DUF4426-domain-containing-protein
MNKWITALLISLLSFPTFAEQFKNMKDIEVHYVAFNSTFLTPKIARSYDIKRNGYLAIINISVLDRASLGKPALEAQVAGQAKNLIGQTQQLTFREVKEGDAIYYLAELPVTHEETFTFDIDVKSGNKGSGKLQFTQKFYVEE
>NZ_CP016345.1|WP_014233036.1|2737860_2738151_+|YggU-family-protein
MSAAVWRDGEDIVLRLYIQPKASRDKIVGLHGEELKIAITAPPVDGKANAHLTKFLAKQFKVAKGLVHIEKGELGRHKQIRIESPTQIPTDIEAIL
>NZ_CP016345.1|WP_020334007.1|2747400_2749026_+|methyl-accepting-chemotaxis-protein
MKLKTQAYLLSAIILLALLALTATGLWTLRVASNLDNKARVTELFKSAYSILTEVEAMAASGELPEDEAKALATRLLRNNIYKDNEYVYVADENMIFVAAPLDPQLHGTSFHDFKDSNNNSVGQLILDILDNKTGQIVEYTWSQTQTDGSIEEKHSIAEKTPHWGWVVGTGIGFNEVNARFWATAQWQLVLCLFIAGAILTSLIIAIRKMLNVLGGEPHDVRQAVQAVSQGNIQTSFDTVAPKDSIYDAVQNMSQSLAIMVTNLDSSMLALRSELSAVESRSGTIADLTLSQQESTAMIATAMTEMASSANQVATSANDTARNTDEADKQSQQTQSLICSTVDNIQGLANQLSTASLAVANLDQDVNNIVKVLDVIGDIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAGRTQDSTKEIQNMISNLQQGSRHAIQTMEICAETSQSTVTQSQSASEALQQIVTALEAITTMSQQIATAAAEQTHVSDDIAHRINLIEESGYQLNSVVTESQSSTQSLASLANDLEGWVNKFSVKH
>NZ_CP016345.1|WP_020334471.1|2757043_2758297_-|HD-GYP-domain-containing-protein
MAAIKLTVDRIQPGLHIRLPLKWNDHPFLLNSFKIKDQGQVEMIRHLGVKFVYFNPEQSDSLPLPVNQDREDKVKSDDSLDLETKALWQEKQKRIEKLSAYRRRVIQCEKEFERSLARMRSVMMKIRNRPVAAVNEAKQLTEDIVDKLMCDDNVTLHLMNGKNEYEDIYFHSLNVAVIAMMIGRAKGYSAEQLKELSFAALFHDMGKVKIPTAILRKQEPLTVPEENYLKLHTKYGLDLANQIEDFPETAKTVIEQHHELRDGSGYPKGLQGDEINEFAQIIIVANAFDNLCHTRITSEQKIPYTALSHLYKNCKHLYKEENLKFLIKFMGVFPPGTVVQLTNNMIGLVISVNASNLLFPNVLVYDPSVPRTQAPILDLASKDLRIVNAIHPSKLPENIKEYLNPRSRISYFFDTDA
>NZ_CP016345.1|WP_020334472.1|2758598_2759273_+|SDR-family-oxidoreductase
MKILVTGASSGIGFELAKQLCADHHDVFATGRNKNKLTELHQLTGCKFASYDLTESQQVMDMFKQATEELGGLDVLINNAGMNTRKCAIDEFSLEEFEQQYAINLRAPAILCREALSLMKEQKSGYIINVTSTVAKRASETMAVYTTMKQGLAGFTGVLMKEAQPHGIKVTNLFPGGTDTNFRAASRPEYMQPESVARTILGLLKLPEDVVVHEMVFRPLVELE
>NZ_CP016345.1|WP_014233048.1|2759412_2760351_-|bile-acid:sodium-symporter-family-protein
MIGRLTQLFPVWAVIFALTAYFSPSLFVDLKSQIVPLLTIIMLAMGISLSPSDFLNVLKHKKAVGVGVFLQFLIMPLAALLISFLLGFSTELTVGMVLVGSVAGGTSSNVMVFLAKGDVALSISMTAISTLLGVILTPLLVEGLIGQSVDVPVSGMLMSLVKIVLLPVSIGVIINTFIPKAVAKVNAILPLISMLAIVVIIAIVVALNAENLNTIGPLVALAVILHNGLGLTAGYYCCRLLGFNESTCRTIAFEVGLQNSGLATALAMKFFSPASAIAGTIFSVWHNISGSLLAGYWASKKARKAKAVTNSL
>NZ_CP016345.1|WP_020334473.1|2761358_2762024_-|SDR-family-NAD(P)-dependent-oxidoreductase
MILITGASSGLGAELAKLYDCDGQPTYLTGRSEGKLSEITNRLSNNIGYQACDLSLHQDVGQLFDQLDQPPQTVIHSAGSGYFGLLEDQEPEQIQKLINNNLNSAINVLRELVKRYKDHSVNVVVIMSTASQQPKAQESTYCAVKWAVKGLIESVRLELKGKPMKIIAVYPGGMATEFWETSGKSLDLSSFMQAEDAAQMIHDAVSSIGNGYVSDITVNRL
>NZ_CP016345.1|WP_020334474.1|2762202_2763471_+|DUF2254-domain-containing-protein
MTGSKWQWLLKQVTRKLWVRTSLFALLAVATALMSIVLNEFVVLPPAINVSSELLNNILNILATSMLAVTTFSLNIMVSAYTAASAGVTPRATKLLMEDSTTQNALATFLGSFLFSLVGIIALGVGAYHEQARIYLFIVTMVVIVMIILTLLRWIQHLSVLGRVSETTSKVEQALISAIRKRGNEPWLGARPWSNPEHKPRGSKPIYSQEIGYLQHIDMHHLDSIAEDNQCTIYIERQPGNFVYSGQPIAWLCGELEEESEVSAAFTIRTERSFDQDPRFGLVVLAEIASRALSPAVNDNGTAIDVLGRAIRALSLWGELLKQRPIKTRFPRLFVPSLSCQDLFDDVFLPIAHDGAAQLQVQIRLQKSLLAISSMHPKLFASPAQKLSEKALELALSQHYTEDEKHQLSQLSHQVIDQKFHG
>NZ_CP016345.1|WP_014233051.1|2763663_2764143_+|RDD-family-protein
MTTSTTLPTAGLFRRLAALVYDSLIVIAIEMMAAGVVMAIVFALNAAGLLSYGEYVDAADMLSKHPVISPIFTLYLAVVWIYFFVFFWTRAGQTLGMRAWKLQVRNAADDAPITVTQALIRIATSGFGLANLTVPIDPQKRGFHDMWAKTKVVVLPKAQ
>NZ_CP016345.1|WP_014233052.1|2764175_2765246_-|LPS-export-ABC-transporter-permease-LptG
MFKILDLYIGRTIISTTALVLATFVGLSGIIKYVEQLRKVGRGVYDLMHALYFVLLSIPRDIEMFFPMAALLGALIGLGMLASSSELVVMQAAGFSKLDIGLSVLKTAVPLMLIVMTLGQWGAPEAQKMARDLRSFAISGGSIVSVRAGVWARDANDFIFIGKVEDDKLYALNMWRFDEDKNLQKVIFAEEVDYEQDNNWVMKDVQITDMQGETVISKQSVDQMEWQTSLAPDKLAVVTVKPEELSLSGLYDYVTYLKASEQDASRYELAFWRKLTQPLSIAVMMLMALSFVFGPLRSVTMGARVLSGVVAGFTFYISSEFFGPLTLVYGIPPVFGALAPSLVFLAIAVSLLRRKL
>NZ_CP016345.1|WP_020334475.1|2765249_2766350_-|LPS-export-ABC-transporter-permease-LptF
MIIVRYLIRETLKSQFAIFFVLFLVFLSQKFISVLADASDGDIPAGLIFSIVGLNMPAMGLLMLPLSLYIGILITFGRLYAESEIVVMNATGIGNKFLVQAALYLALITSAVAAFNALWLSPWSQERVEQLYEQVAAENSVDLLQKGQFQGTPDGSSVVFIDDIKDNTLSNVFVAQMRPRDSVLPSVMFSSSGEVKELSDGRQIITMKEGTRYEGVPTRVEYMITKFDQYEGVIGQREVKKKGRDWEAYPTADLIGHPDPEAQAELQWRISLFVCIPLLTMLVIPLSAVNPRQGRFAKMGPAILIYLAYFLAISATKSALEDGSIPTTVGMWPINAMLLIVAILANMMDSVPARRMKEKFRKKRLA
>NZ_CP016345.1|WP_020334476.1|2766550_2768059_+|leucyl-aminopeptidase
MEFSVKSGSPEKQRSACIVVGVFEPRRLSPVAEQLDKISDGYISSLLRRGDLEGKPGQMLLLHQVPGVLSERVLLVGCGKERELGERQYKEIIQKTISTLNETGSMEAVCFLTELHVKGRDTYWKVRQAVEATKDGLYTFNQFKSVKPETRRPLRKLVFNVPTRRELSLGEKAITHGLAIASGVKASKDLGNMPPNVANPAYLASQARRLADDYETVTTKIIGEQEMEKLGMTSYLAVGRGSKNESMMSIIEYKGNPDSDAKPIVLVGKGLTFDSGGISLKPGEGMDEMKYDMCGAASVFGTMKALAKLNLPINVIGVLAGCENMPGSNAYRPGDILTTMSGQTVEVLNTDAEGRLVLCDALTYVERFEPDCVVDVATLTGACVIALGHHISGVLSNHNPLAHELVNASEQASDRAWRLPMADEYHEQLKSPFADMQNIGGRPAGTITAGCFLSKFAKKYNWAHLDIAGTAWKSGAAKGSTGRPVSMLVQFLLNRSGQETEE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	NZ_CP016345.1	2746513-2746551	0	1.0

1. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to position: 2746513-2746551, mismatch: 0, identity: 1.0

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccattctt	Protospacer
***************************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	NZ_CP041417	Escherichia coli strain STEC711 plasmid pSTEC711_1, complete sequence	296499-296537	4	0.897
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	NZ_LN868946	Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384 plasmid 4, complete sequence	103821-103859	4	0.897
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	KU052038	Escherichia phage SerU-LTIIb, partial genome	1164-1202	4	0.897
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	KU052038	Escherichia phage SerU-LTIIb, partial genome	3070-3108	4	0.897
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	LN997803	Escherichia coli phage phi467	15124-15162	4	0.897
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	NZ_CP023526	Cedecea neteri strain FDAARGOS_392 plasmid unnamed, complete sequence	1927-1965	4	0.897
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	NZ_CP022660	Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-2, complete sequence	52076-52114	4	0.897
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	NZ_CP045061	Salmonella enterica subsp. enterica serovar Muenchen strain LG26 plasmid pLG26p2, complete sequence	52082-52120	4	0.897
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	NZ_CP045054	Salmonella enterica subsp. enterica serovar Muenchen strain LG24 plasmid pLG24p2, complete sequence	52087-52125	4	0.897
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	NZ_CP045058	Salmonella enterica subsp. enterica serovar Muenchen strain LG25 plasmid pLG25p2, complete sequence	52086-52124	4	0.897
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	NC_021742	Serratia liquefaciens ATCC 27592 plasmid unnamed, complete sequence	35426-35464	4	0.897
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	MH791411	UNVERIFIED: Escherichia phage Ecwhy_1, complete genome	13643-13681	4	0.897
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	MH494197	Escherichia phage CMSTMSU, complete genome	196770-196808	4	0.897
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	NZ_CP054057	Scandinavium goeteborgense strain CCUG 66741 plasmid pSg66741_1, complete sequence	85815-85853	5	0.872
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	KY653118	Morganella phage IME1369_01, complete genome	696-734	5	0.872
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	LC494302	Escherichia phage SP27 DNA, complete genome	76611-76649	7	0.821
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	LT603033	Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I	17117-17155	7	0.821
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	NC_027364	Escherichia phage PBECO 4, complete genome	207830-207868	7	0.821
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	NC_049942	Escherichia phage JLK-2012, complete sequence	23524-23562	7	0.821
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	MK817115	Escherichia phage vB_EcoM_phAPEC6, complete genome	52943-52981	8	0.795
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	MH383160	Escherichia phage UB, complete genome	272122-272160	8	0.795
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	MK327931	Escherichia phage vB_EcoM_G17, complete genome	77927-77965	8	0.795
NZ_CP016345_1	1.1\|2746889\|39\|NZ_CP016345\|PILER-CR	2746889-2746927	39	KM507819	Escherichia phage 121Q, complete genome	77938-77976	9	0.769

1. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to NZ_CP041417 (Escherichia coli strain STEC711 plasmid pSTEC711_1, complete sequence) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatatgc	Protospacer
*********************************** . .

2. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to NZ_LN868946 (Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384 plasmid 4, complete sequence) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatcaag	Protospacer
***********************************.

3. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to KU052038 (Escherichia phage SerU-LTIIb, partial genome) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatatgc	Protospacer
*********************************** . .

4. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to KU052038 (Escherichia phage SerU-LTIIb, partial genome) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatatgc	Protospacer
*********************************** . .

5. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to LN997803 (Escherichia coli phage phi467) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatatgc	Protospacer
*********************************** . .

6. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to NZ_CP023526 (Cedecea neteri strain FDAARGOS_392 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccagaatg	Protospacer
**********************************   *

7. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to NZ_CP022660 (Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-2, complete sequence) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccacttac	Protospacer
**********************************.*. .

8. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to NZ_CP045061 (Salmonella enterica subsp. enterica serovar Muenchen strain LG26 plasmid pLG26p2, complete sequence) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccacttac	Protospacer
**********************************.*. .

9. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to NZ_CP045054 (Salmonella enterica subsp. enterica serovar Muenchen strain LG24 plasmid pLG24p2, complete sequence) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccacttac	Protospacer
**********************************.*. .

10. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to NZ_CP045058 (Salmonella enterica subsp. enterica serovar Muenchen strain LG25 plasmid pLG25p2, complete sequence) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccacttac	Protospacer
**********************************.*. .

11. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to NC_021742 (Serratia liquefaciens ATCC 27592 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagccggcaccaatcaa	Protospacer
*************************.******** **

12. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to MH791411 (UNVERIFIED: Escherichia phage Ecwhy_1, complete genome) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcacaaatcag	Protospacer
******************************** * **

13. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to MH494197 (Escherichia phage CMSTMSU, complete genome) position: , mismatch: 4, identity: 0.897

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcacaaatcag	Protospacer
******************************** * **

14. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to NZ_CP054057 (Scandinavium goeteborgense strain CCUG 66741 plasmid pSg66741_1, complete sequence) position: , mismatch: 5, identity: 0.872

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccaaatgc	Protospacer
**********************************  . .

15. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to KY653118 (Morganella phage IME1369_01, complete genome) position: , mismatch: 5, identity: 0.872

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
taggtcaccagttcgactccggtagccggcaccatatta	Protospacer
****************.********.********* .*

16. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to LC494302 (Escherichia phage SP27 DNA, complete genome) position: , mismatch: 7, identity: 0.821

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
aaggtcaccagttcgattccggtagtcggcacaaaataa	Protospacer
 ******************************* *  .

17. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to LT603033 (Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I) position: , mismatch: 7, identity: 0.821

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
aaggtcaccagttcgattccggtagtcggcacaaaataa	Protospacer
 ******************************* *  .

18. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to NC_027364 (Escherichia phage PBECO 4, complete genome) position: , mismatch: 7, identity: 0.821

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
aaggtcaccagttcgattccggtagtcggcacaaaataa	Protospacer
 ******************************* *  .

19. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to NC_049942 (Escherichia phage JLK-2012, complete sequence) position: , mismatch: 7, identity: 0.821

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
caggtcgccagttcgattccggtagccggcaccatatgc	Protospacer
.*****.******************.********* . .

20. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to MK817115 (Escherichia phage vB_EcoM_phAPEC6, complete genome) position: , mismatch: 8, identity: 0.795

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
aatgtcaccagttcgattccggtagtcggcacaaaataa	Protospacer
 * ***************************** *  .

21. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to MH383160 (Escherichia phage UB, complete genome) position: , mismatch: 8, identity: 0.795

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
aatgtcaccagttcgattccggtagtcggcacaaaataa	Protospacer
 * ***************************** *  .

22. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to MK327931 (Escherichia phage vB_EcoM_G17, complete genome) position: , mismatch: 8, identity: 0.795

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
aatgtcaccagttcgattccggtagtcggcacaaaataa	Protospacer
 * ***************************** *  .

23. spacer 1.1|2746889|39|NZ_CP016345|PILER-CR matches to KM507819 (Escherichia phage 121Q, complete genome) position: , mismatch: 9, identity: 0.769

taggtcaccagttcgattccggtagtcggcaccattctt	CRISPR spacer
aatgtcaccagttcaattccggtagtcggcacaaaataa	Protospacer
 * ***********.***************** *  .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

712101 : 718755

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014231006.1\|712101_713241_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.7e-62	41.7
WP_020333697.1\|713258_714509_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.4e-97	47.4
WP_014231008.1\|714625_715075_+	transcriptional regulator NrdR	NA	NA	NA	NA
WP_020333698.1\|715081_716200_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	2.9e-46	37.2
WP_020333699.1\|716217_716871_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	3.1e-32	37.0
WP_014231011.1\|717006_718116_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.7e-65	39.3
WP_014231012.1\|718284_718755_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	3.7e-32	48.0

DBSCAN-SWA_2

1355999 : 1412517

Vibrio_phage(22.73%)

portal,capsid,integrase,tail,terminase,tRNA

attL 1356153:1356168|attR 1403514:1403529

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014231611.1\|1355999_1357928_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	8.8e-128	37.6
1356153:1356168	attL	NA	NA	NA	NA
WP_076633413.1\|1357931_1358483_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	2.7e-13	34.4
WP_005377932.1\|1358604_1358799_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_004727974.1\|1358839_1359193_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_020333032.1\|1359834_1360644_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_014231614.1\|1361023_1362007_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	5.6e-38	39.9
WP_020333033.1\|1362025_1364428_+\|tRNA	phenylalanine--tRNA ligase subunit beta	A0A1L3IZU3	BeAn_58058_virus	5.1e-08	26.5
WP_020333034.1\|1364707_1366339_+	glycoside hydrolase family 32 protein	NA	NA	NA	NA
WP_020333035.1\|1366402_1367320_-	aminoimidazole riboside kinase	NA	NA	NA	NA
WP_020333037.1\|1367564_1368560_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_020333039.1\|1368577_1369456_-	AEC family transporter	NA	NA	NA	NA
WP_005462650.1\|1369998_1370295_+	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	2.7e-12	38.9
WP_020333040.1\|1370412_1371189_-	phosphoribosylglycinamide formyltransferase	NA	NA	NA	NA
WP_020333041.1\|1371504_1372155_+	thiopurine S-methyltransferase	NA	NA	NA	NA
WP_020333042.1\|1372246_1373422_-	formate-dependent phosphoribosylglycinamide formyltransferase	NA	NA	NA	NA
WP_020333043.1\|1373569_1374457_-	cytidine deaminase	NA	NA	NA	NA
WP_014231625.1\|1374786_1375464_-	LrgB family protein	NA	NA	NA	NA
WP_020333045.1\|1375465_1375840_-	CidA/LrgA family protein	NA	NA	NA	NA
WP_020333046.1\|1375898_1377320_-	exodeoxyribonuclease I	NA	NA	NA	NA
WP_020333047.1\|1377502_1378699_+\|integrase	site-specific integrase	K7P7J2	Enterobacteria_phage	1.9e-104	47.6
WP_152490528.1\|1378839_1379691_+	hypothetical protein	NA	NA	NA	NA
WP_020333049.1\|1379803_1380847_+	hypothetical protein	NA	NA	NA	NA
WP_020333050.1\|1380936_1381260_+	hypothetical protein	NA	NA	NA	NA
WP_061778632.1\|1381616_1382126_+	hypothetical protein	NA	NA	NA	NA
WP_031779178.1\|1382365_1382641_-	hypothetical protein	NA	NA	NA	NA
WP_020333055.1\|1382711_1382870_-	hypothetical protein	NA	NA	NA	NA
WP_020333056.1\|1382844_1383246_-	hypothetical protein	NA	NA	NA	NA
WP_020333057.1\|1383242_1383485_-	hypothetical protein	NA	NA	NA	NA
WP_020333058.1\|1383646_1383919_-	hypothetical protein	NA	NA	NA	NA
WP_020333059.1\|1384244_1384673_-	hypothetical protein	NA	NA	NA	NA
WP_020333060.1\|1384893_1385562_-	LexA family transcriptional regulator	K7PH71	Enterobacterial_phage	1.1e-58	53.4
WP_020333061.1\|1385652_1385886_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_020333062.1\|1385932_1386481_+	hypothetical protein	NA	NA	NA	NA
WP_020333063.1\|1386693_1387467_+	helix-turn-helix domain-containing protein	R9TPU9	Vibrio_phage	1.4e-12	32.6
WP_020333064.1\|1387463_1388195_+	ATP-binding protein	A0A1W6JP39	Morganella_phage	3.8e-39	42.9
WP_020333065.1\|1388195_1388777_+	hypothetical protein	NA	NA	NA	NA
WP_020333066.1\|1388952_1389573_+	hypothetical protein	NA	NA	NA	NA
WP_020333068.1\|1389704_1390388_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_020333069.1\|1390745_1391183_+	hypothetical protein	NA	NA	NA	NA
WP_020333071.1\|1391236_1391914_+	hypothetical protein	NA	NA	NA	NA
WP_020333072.1\|1392043_1392325_+	hypothetical protein	NA	NA	NA	NA
WP_020333073.1\|1392290_1392749_+	hypothetical protein	A0A2I7R3H9	Vibrio_phage	4.3e-17	35.4
WP_020333074.1\|1392790_1392976_+	hypothetical protein	M4M9I7	Vibrio_phage	2.4e-06	48.2
WP_152490535.1\|1393236_1394310_+\|integrase	tyrosine-type recombinase/integrase	A0A067ZJC5	Vibrio_phage	3.5e-49	33.0
WP_020333076.1\|1394748_1395318_+	hypothetical protein	B0ZSE9	Halomonas_phage	9.2e-25	37.5
WP_076633411.1\|1395328_1397266_+\|terminase	terminase	A2I2W6	Vibrio_virus	1.7e-211	58.2
WP_020333078.1\|1397259_1397787_+	hypothetical protein	A0A193GYL8	Enterobacter_phage	8.5e-25	41.7
WP_020333079.1\|1397786_1399340_+\|portal	phage portal protein	A0A1W6JT60	Escherichia_phage	1.6e-119	43.3
WP_020333080.1\|1399311_1401282_+\|capsid	phage major capsid protein	A0A1W6JT82	Escherichia_phage	1.9e-165	49.7
WP_020333081.1\|1401342_1401534_+	hypothetical protein	NA	NA	NA	NA
WP_020333082.1\|1401526_1401805_+	hypothetical protein	NA	NA	NA	NA
WP_020333083.1\|1401801_1402434_+	hypothetical protein	A0A2R9YJK4	Escherichia_phage	7.5e-28	37.4
WP_020333084.1\|1402423_1402870_+	hypothetical protein	NA	NA	NA	NA
WP_020333085.1\|1402872_1403373_+\|tail	tail protein	Q687F6	Enterobacteria_phage	1.3e-38	50.6
WP_020333086.1\|1403378_1403819_+	hypothetical protein	NA	NA	NA	NA
1403514:1403529	attR	NA	NA	NA	NA
WP_020333088.1\|1403884_1404169_+	hypothetical protein	NA	NA	NA	NA
WP_020333090.1\|1404149_1406381_+	hypothetical protein	A0A2I7R469	Vibrio_phage	1.6e-27	28.8
WP_020333091.1\|1406380_1406977_+	hypothetical protein	NA	NA	NA	NA
WP_020333092.1\|1406973_1407525_+	DUF2163 domain-containing protein	A0A1I9SF23	Klebsiella_phage	1.6e-05	27.7
WP_020333093.1\|1407528_1412517_+	hypothetical protein	A0A2P1CKJ4	Pantoea_phage	9.6e-17	22.9

DBSCAN-SWA_3

1939935 : 1964788

Vibrio_phage(86.36%)

portal,capsid,integrase,tail,terminase

attL 1952049:1952063|attR 1971181:1971195

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081113449.1\|1939935_1941072_+\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A1V0E8G8	Vibrio_phage	1.2e-52	34.3
WP_081113450.1\|1941033_1941288_-	hypothetical protein	NA	NA	NA	NA
WP_152490577.1\|1941350_1941779_-	hypothetical protein	NA	NA	NA	NA
WP_020335469.1\|1941827_1942352_-\|tail	tail fiber protein	NA	NA	NA	NA
WP_020335470.1\|1942355_1942778_-	hypothetical protein	NA	NA	NA	NA
WP_020335471.1\|1942796_1943096_-	hypothetical protein	NA	NA	NA	NA
WP_020335472.1\|1943101_1943278_-	hypothetical protein	R9TRM3	Vibrio_phage	1.7e-17	78.9
WP_020335473.1\|1943349_1945173_-\|capsid	phage major capsid protein	R9TPU0	Vibrio_phage	4.7e-288	84.2
WP_020335474.1\|1945150_1946593_-\|portal	phage portal protein	R9TNK3	Vibrio_phage	1.2e-235	82.9
WP_020335478.1\|1946843_1948739_-\|terminase	phage terminase large subunit family protein	R9TMM4	Vibrio_phage	0.0e+00	90.3
WP_152490605.1\|1948710_1949196_-	hypothetical protein	R9TRM5	Vibrio_phage	4.8e-59	72.0
WP_020335481.1\|1949354_1950089_-	hypothetical protein	NA	NA	NA	NA
WP_020335482.1\|1950124_1950304_-	hypothetical protein	M4M9I7	Vibrio_phage	2.1e-07	53.7
WP_020335483.1\|1950303_1950798_-	hypothetical protein	A0A2I7RPF4	Vibrio_phage	3.5e-20	38.2
WP_020335484.1\|1950797_1951064_-	hypothetical protein	NA	NA	NA	NA
WP_020335485.1\|1951134_1951824_-	hypothetical protein	R9TRM8	Vibrio_phage	1.3e-57	50.0
WP_020335486.1\|1952019_1952292_+	hypothetical protein	NA	NA	NA	NA
1952049:1952063	attL	NA	NA	NA	NA
WP_020335487.1\|1952484_1952862_+	hypothetical protein	A0A2H4J9F9	uncultured_Caudovirales_phage	5.3e-13	45.2
WP_152490601.1\|1952979_1953612_+	hypothetical protein	NA	NA	NA	NA
WP_020335489.1\|1953693_1954665_-	DUF968 domain-containing protein	R9TRM9	Vibrio_phage	5.2e-60	40.4
WP_020335490.1\|1954676_1954982_-	DUF4406 domain-containing protein	A0A1V0E824	Vibrio_phage	1.0e-22	53.9
WP_020335491.1\|1954978_1955287_-	hypothetical protein	R9TNL4	Vibrio_phage	9.0e-35	66.7
WP_020335492.1\|1955283_1955478_-	hypothetical protein	R9TR49	Vibrio_phage	8.5e-15	72.2
WP_020335494.1\|1955637_1956657_-	hypothetical protein	A0A1U9GR44	Vibrio_phage	8.5e-21	36.4
WP_020335495.1\|1956656_1956872_-	hypothetical protein	NA	NA	NA	NA
WP_020335496.1\|1956871_1957045_-	hypothetical protein	NA	NA	NA	NA
WP_020335499.1\|1957224_1957416_-	hypothetical protein	NA	NA	NA	NA
WP_020335500.1\|1957412_1957922_-	hypothetical protein	NA	NA	NA	NA
WP_020335501.1\|1957953_1958166_-	hypothetical protein	A0A1I9KFF6	Aeromonas_phage	2.0e-09	56.1
WP_020335502.1\|1958201_1959002_+	helix-turn-helix transcriptional regulator	R9TNM0	Vibrio_phage	3.6e-59	53.2
WP_020335503.1\|1959031_1959895_+	hypothetical protein	NA	NA	NA	NA
WP_020335504.1\|1959910_1960156_+	hypothetical protein	NA	NA	NA	NA
WP_020335505.1\|1960148_1960538_+	hypothetical protein	NA	NA	NA	NA
WP_020335506.1\|1960860_1961253_+	hypothetical protein	R9TMP0	Vibrio_phage	7.1e-61	90.6
WP_020335507.1\|1961293_1962112_+	DUF2303 family protein	R9TRN9	Vibrio_phage	4.1e-127	84.2
WP_020335508.1\|1962162_1962540_+	hypothetical protein	NA	NA	NA	NA
WP_020335509.1\|1962541_1962754_+	hypothetical protein	NA	NA	NA	NA
WP_020335510.1\|1962746_1963004_+	hypothetical protein	M4MCS9	Vibrio_phage	6.6e-07	41.0
WP_020335511.1\|1963003_1963219_+	hypothetical protein	A0A1V0E8D5	Vibrio_phage	5.5e-07	37.3
WP_020335512.1\|1963322_1963553_+	DUF1233 family excisionase	NA	NA	NA	NA
WP_020335513.1\|1963552_1964788_+\|integrase	tyrosine-type recombinase/integrase	A0A0U2JGI6	Escherichia_phage	1.2e-74	40.6
1971181:1971195	attR	NA	NA	NA	NA

DBSCAN-SWA_4

2669526 : 2682975

uncultured_Mediterranean_phage(22.22%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020333961.1\|2669526_2672109_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	6.6e-78	37.7
WP_020333962.1\|2672251_2672719_-	recombination regulator RecX	NA	NA	NA	NA
WP_014232974.1\|2672833_2673880_-	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	1.4e-111	60.7
WP_020333963.1\|2674070_2674562_-	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	1.4e-26	46.8
WP_014232976.1\|2674646_2677208_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	1.2e-31	23.3
WP_061778639.1\|2677282_2678269_-	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	1.2e-35	35.2
WP_020333966.1\|2678349_2679237_-	peptidoglycan DD-metalloendopeptidase family protein	D7RWE0	Brochothrix_phage	1.8e-06	36.4
WP_014232979.1\|2679286_2679913_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	6.7e-37	52.7
WP_014232980.1\|2679912_2680689_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.7e-66	50.6
WP_020333968.1\|2680688_2681732_-\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_014232982.1\|2681774_2682254_-	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_020333970.1\|2682267_2682975_-	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	A0A2H4UTB4	Bodo_saltans_virus	3.1e-06	26.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP016346

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP016345

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection