CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP015203	Rhodococcus sp. 008 plasmid pR8L1, complete sequence	1 crisprs	csa3,csf3gr5,csf2gr7,PD-DExK	1	3
NZ_CP015205	Rhodococcus sp. 008 plasmid pR8C2, complete sequence	0 crisprs	NA	0	0
NZ_CP012749	Rhodococcus sp. 008 chromosome, complete genome	1 crisprs	WYL,csa3,DEDDh,RT,cas3,cas4,DinG	0	2
NZ_CP015204	Rhodococcus sp. 008 plasmid pR8C1, complete sequence	0 crisprs	NA	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015203_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015203_1

194576-194652

Orphan

Consensus_repeat	Method
CGGTGACGGCGTAGCCGTCACCGACG	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP015203_1

>merge|NZ_CP015203|1|194576-194652|CRISPRCasFinder
CGGTGACGGCGTAGCCGTCACCGACGTGGGAGCCCTTGTAGAAGCAGCAGACGGTGACGGCGTAGTCGTCACCGACG

>NZ_CP015203|1|1|194576-194652|CRISPRCasFinder
CGGTGACGGCGTAGCCGTCACCGACG	TGGGAGCCCTTGTAGAAGCAGCAGA
CGGTGACGGCGTAGTCGTCACCGACG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015203.1\|WP_030537785.1\|180551_181310_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP015203.1\|WP_047270619.1\|200166_200832_-\|phosphate-signaling-complex-protein-PhoU	unknown	unknown	gnl\|CDD\|273990
NZ_CP015203.1\|WP_047270658.1\|197051_197414_-\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP015203.1\|WP_080961189.1\|189301_190030_+\|DUF305-domain-containing-protein	unknown	unknown	gnl\|CDD\|367619
NZ_CP015203.1\|WP_047270656.1\|206919_208542_+\|divalent-metal-cation-transporter	unknown	unknown	gnl\|CDD\|224826
NZ_CP015203.1\|WP_155419211.1\|199726_199894_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015203.1\|WP_134929860.1\|195949_196273_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015203.1\|WP_030537783.1\|178459_179224_+\|acyl-[acyl-carrier-protein]-thioesterase	unknown	unknown	gnl\|CDD\|226401
NZ_CP015203.1\|WP_054827429.1\|202748_203078_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015203.1\|WP_030537784.1\|179373_180555_-\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|182539
NZ_CP015203.1\|WP_047270613.1\|205532_206876_+\|magnesium-transporter	unknown	unknown	gnl\|CDD\|225148
NZ_CP015203.1\|WP_030537787.1\|181801_183385_+\|multicopper-oxidase-family-protein	unknown	unknown	gnl\|CDD\|225043
NZ_CP015203.1\|WP_030537788.1\|183899_184127_+\|heavy-metal-associated-domain-containing-protein	unknown	unknown	gnl\|CDD\|238219
NZ_CP015203.1\|WP_030537786.1\|181450_181720_+\|membrane-protein	unknown	unknown	gnl\|CDD\|225993
NZ_CP015203.1\|WP_047270630.1\|184175_186479_+\|copper-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319783
NZ_CP015203.1\|WP_047270607.1\|209478_209787_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015203.1\|WP_058228111.1\|186842_189305_+\|heavy-metal-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319783
NZ_CP015203.1\|WP_047270626.1\|191077_191554_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015203.1\|WP_141695818.1\|197455_199531_+\|heavy-metal-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319849
NZ_CP015203.1\|WP_047270614.1\|203614_204601_-\|c-type-cytochrome-biogenesis-protein-CcsB	unknown	unknown	gnl\|CDD\|274447

Protein	Function_ID	Function_description	E-value
NZ_CP015203.1\|WP_030537785.1\|180551_181310_-\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	1.7577e-84
NZ_CP015203.1\|WP_047270619.1\|200166_200832_-\|phosphate-signaling-complex-protein-PhoU	gnl\|CDD\|273990	TIGR02135, Uncharacterized_protein, phosphate transport system regulatory protein PhoU. This model describes PhoU, a regulatory protein of unknown mechanism for high-affinity phosphate ABC transporter systems. The protein consists of two copies of the domain described by pfam01895. Deletion of PhoU activates constitutive expression of the phosphate ABC transporter and allows phosphate transport, but causes a growth defect and so likely has some second function. [Regulatory functions, Other, Transport and binding proteins, Anions].	1.60391e-41
NZ_CP015203.1\|WP_047270658.1\|197051_197414_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.09454e-17
NZ_CP015203.1\|WP_080961189.1\|189301_190030_+\|DUF305-domain-containing-protein	gnl\|CDD\|367619	pfam03713, DUF305, Domain of unknown function (DUF305). Domain found in small family of bacterial secreted proteins with no known function. Also found in Paramecium bursaria chlorella virus 1. This domain is short and found in one or two copies. The domain has a conserved HH motif that may be functionally important. This domain belongs to the ferritin superfamily. It contains two sequence similar repeats each of which is composed of two alpha helices.	3.19199e-48
NZ_CP015203.1\|WP_047270656.1\|206919_208542_+\|divalent-metal-cation-transporter	gnl\|CDD\|224826	COG1914, MntH, Mn2+ and Fe2+ transporters of the NRAMP family [Inorganic ion transport and metabolism].	5.50203e-80
NZ_CP015203.1\|WP_030537784.1\|179373_180555_-\|HAMP-domain-containing-protein	gnl\|CDD\|182539	PRK10549, PRK10549, two-component system sensor histidine kinase BaeS.	4.48977e-60
NZ_CP015203.1\|WP_030537783.1\|178459_179224_+\|acyl-[acyl-carrier-protein]-thioesterase	gnl\|CDD\|226401	COG3884, FatA, Acyl-ACP thioesterase [Lipid metabolism].	1.74282e-61
NZ_CP015203.1\|WP_047270613.1\|205532_206876_+\|magnesium-transporter	gnl\|CDD\|225148	COG2239, MgtE, Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism].	5.46996e-37
NZ_CP015203.1\|WP_030537787.1\|181801_183385_+\|multicopper-oxidase-family-protein	gnl\|CDD\|225043	COG2132, SufI, Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism].	5.79168e-86
NZ_CP015203.1\|WP_030537788.1\|183899_184127_+\|heavy-metal-associated-domain-containing-protein	gnl\|CDD\|238219	cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain contains two cysteine residues that are important in binding and transfer of metal ions, such as copper, cadmium, cobalt and zinc. In the case of copper, stoichiometry of binding is one Cu+ ion per binding domain. Repeats of the HMA domain in copper chaperone has been associated with Menkes/Wilson disease due to binding of multiple copper ions.	2.98428e-12
NZ_CP015203.1\|WP_030537786.1\|181450_181720_+\|membrane-protein	gnl\|CDD\|225993	COG3462, COG3462, Predicted membrane protein [Function unknown].	1.09628e-07
NZ_CP015203.1\|WP_047270630.1\|184175_186479_+\|copper-translocating-P-type-ATPase	gnl\|CDD\|319783	cd02094, P-type_ATPase_Cu-like, P-type heavy metal-transporting ATPase, similar to human copper-transporting ATPases, ATP7A and ATP7B. The mammalian copper-transporting P-type ATPases, ATP7A and ATP7B are key molecules required for the regulation and maintenance of copper homeostasis. Menkes and Wilson diseases are caused by mutation in ATP7A and ATP7B respectively. This subfamily includes other copper-transporting ATPases such as: Bacillus subtilis CopA , Archeaoglobus fulgidus CopA, and Saccharomyces cerevisiae Ccc2p. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP015203.1\|WP_058228111.1\|186842_189305_+\|heavy-metal-translocating-P-type-ATPase	gnl\|CDD\|319783	cd02094, P-type_ATPase_Cu-like, P-type heavy metal-transporting ATPase, similar to human copper-transporting ATPases, ATP7A and ATP7B. The mammalian copper-transporting P-type ATPases, ATP7A and ATP7B are key molecules required for the regulation and maintenance of copper homeostasis. Menkes and Wilson diseases are caused by mutation in ATP7A and ATP7B respectively. This subfamily includes other copper-transporting ATPases such as: Bacillus subtilis CopA , Archeaoglobus fulgidus CopA, and Saccharomyces cerevisiae Ccc2p. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP015203.1\|WP_141695818.1\|197455_199531_+\|heavy-metal-translocating-P-type-ATPase	gnl\|CDD\|319849	cd07551, P-type_ATPase_HM_ZosA_PfeT-like, P-type heavy metal-transporting ATPase, similar to Bacillus subtilis ZosA/PfeT which transports copper, and perhaps zinc under oxidative stress, and perhaps ferrous iron. Bacillus subtilis ZosA/PfeT (previously known as YkvW) transports copper, it may also transport zinc under oxidative stress and may also be involved in ferrous iron efflux. ZosA/PfeT is expressed under the regulation of the peroxide-sensing repressor PerR. It is involved in competence development. Disruption of the zosA/pfeT gene results in low transformability. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP015203.1\|WP_047270614.1\|203614_204601_-\|c-type-cytochrome-biogenesis-protein-CcsB	gnl\|CDD\|274447	TIGR03144, cytochrome_c_biogenesis_protein_chloroplast, cytochrome c-type biogenesis protein CcsB. Members of this protein family represent one of two essential proteins of system II for c-type cytochrome biogenesis. Additional proteins tend to be part of the system but can be replaced by chemical reductants such as dithiothreitol. This protein is designated CcsB in Bordetella pertussis and some other bacteria, resC in Bacillus (where there is additional N-terminal sequence), and CcsA in chloroplast. We use the CcsB designation here. Member sequences show regions of strong sequence conservation and variable-length, poorly conserved regions in between; sparsely filled columns were removed from the seed alignment prior to model construction. [Energy metabolism, Electron transport, Protein fate, Protein modification and repair].	3.57611e-93

>NZ_CP015203.1|WP_047270626.1|191077_191554_-|hypothetical-protein
MTNWSLWRWITASAGAVAAALIVGVPTGIVPTSFYQRMTPVLWWNYPVWIANAILSGLILATYVRTQSSSAAPSRVGIGSNALALLAVGCPVCNKLVIMTVGVTGALNLWAPIQPVLGLISLALMAGAFRQRLKGERACGVRTCVSKDSIGTAVPERS
>NZ_CP015203.1|WP_080961189.1|189301_190030_+|DUF305-domain-containing-protein
MTRQPISQRKGFPDMKKVLAISAAATAALFVLTACNSSNTDETTSTPTSMSAESSSSANASTHNQADVTFAEQMIPHHSQAVQMSDMLLSKDGIDPRVTTLAEQIKAAQAPEIEQLQAWLTSWGQSSSSSGMNMPTTSHSMEGMTPSTSMNMPMPSESMGMTPGMMEGMMSADDMTALQNAQGTDAAKLFLAQMIDHHRGAVAMAQTEVDSGQYPEAISMAQTIISAQNQEITTMEGILATL
>NZ_CP015203.1|WP_058228111.1|186842_189305_+|heavy-metal-translocating-P-type-ATPase
MNRTTVLEVQGLQWATSKAAVESTLLRRRGVVSAEANVLNQTATVTYDPAATSIPELSQWIRDCGYHCAGRSVPSHSCDPLSEPNDSTSATPSEYHVHSDHADTSTDAPVEHPGESPHGEHTAHEPHAQHSAQDMMGHGGAHAGMSMDDMVRDMRNRFLVALVLSIPIMLWSPMGRDMFGFTVPAPFGLRDDVFTLILSLPVVFYSAWIFFDGAYRALKARTLDMMVLVAVAVGAGWLYSVAVTFTGGGEVFYEAASVLTAFVLLGHWFEMRARGGANDAIRTLLELTPPLAIVLRDGEPVEVPTADVVVGDLLLIRPGGKVPVDGTVESGTSEVDESMVTGESLPVSKEPGSAVIGASINTTGTLRVRATKVGADTALSQIVALVQEAQNSKAPGQRFADRAAFWLVLVALIGGTGTFLVWWAAGAGVQTALLFAITVVVITCPDALGLATPTAIMVGTGLGAQRGVLFKNATALESSARIETVVMDKTGTLTKGEPEVTDVVVDGIGTDELLSLVAAVERESEHPLAGAIVRYATERGAPEFPLTNFRNVPGHGAAAEVDGRRVAVGNRKLMIAENVDFGTLMGTRDDLAASGRTAVLVAVDGQGVGVIALADAVRETSAAAVAALHDLGVEVVMLSGDNEATAQRIAGQLGIDTVIAEVLPGDKAAKIVELQNAGKKVAMVGDGVNDAPALAQADLGIAIGAGTDVAIETADLVLMRSDPLDVPVALQIGRGTLRKMRQNLGWAVGYNVIALPIAAGVFEPSLGLVLRPEIAALSMSGSSFIVAVNALLLKRLRLPSPPDQHRPSPSTTKSTSQNVS
>NZ_CP015203.1|WP_047270630.1|184175_186479_+|copper-translocating-P-type-ATPase
MSTLDNTTVAAESAHSVELVIGGMTCASCAARIEKKLNKIDGVTATVNYATEKAKVDFTGAVAPEDLISTVEATGYTATLPAPKGSSGEVGTTDGVDARIQDEASQLRTRLLVSLALTVPVVALSMIPPLQFTNWQWLALTLASPVVVWGALPFHRAALTNARHGAATMDTLISVGVSAAYLWSLWALFFGHAGMAGMKMEFSLFPQQEGGADHIYLEVAAAVTVFILAGRYFEARAKKQSGAALRALMDMGAKDVAVLREHTEIRIPTEQLVVGDIFVVRPGEKIATDGIVTDGTSAVDASMLTGESVPVEVRPGDAVVGATVNAGGRLLVRATRIGADTQLAQMARLVEDAQNGKAQVQRLADRISGIFVPVVIVLSLMTLGAWLLTGHSMVTAFTAAVAVLIIACPCALGLATPTALMVGTGRGAQLGILIKGPQVLESTRQVDTIVLDKTGTVTTGRMSVDSTVGADGENIDELLFVAGALEDGSEHPIAQAITLAARADGRPLPRIEGFSNHDGRGVSGVVDGRAVAIGRRTWLEQDWSLVAPKNLEVAAHDAEADGKSPVWVAWDGSIRGIVVVSDTVKDTSKEAITAFRTLGLRPILLTGDNARAAVAVAKQVGIEAADVIAEVLPADKVSAVKDLQSRGYTVAMVGDGVNDAAALAQADLGLAMGTGSDVAIEASDLTLVRGDLRSAADAIRLSRSTLKTIKGNLFWAFAYNVAALPLAALGLLNPLIAGAAMAFSSIFVVTNSLRLRRFTSHATSSDH
>NZ_CP015203.1|WP_030537788.1|183899_184127_+|heavy-metal-associated-domain-containing-protein
MSATNNTFAVTGLTCGHCVGAVTDELRALPGVSEVEIDLVAGGVSTVTVTASAPLTEEQVTAALDEAGNYHLANI
>NZ_CP015203.1|WP_030537787.1|181801_183385_+|multicopper-oxidase-family-protein
MAIAPFTGSAFSRRTFLAATAAGAGGLALTACTTSGSSNPNPPPFDKNAITSAEAARPHTGRTVDYTLNPQGADIDLGGITVRTLAYGDSVPGPLIRANVGDELAITVNNGLDHQTSVHWHGIALRNDMDGAMPASPNIESGQNFTYRFSVPHSGTYWAHPHVGLDTDYGLYLPIVVDDPREPVDYDAEWIVVLDDWTDGVGTSPQQILSDLQSGNGMGSMGGSGMGNMPGMGGMNHGSAETTLPATSGGPNSVESSALLGGDAGDVSYPYYLINGRIASAPTTFSAAPGQRVRIRIINAGADTAFRVALADHVMSVTHTDGFPVVPTEVDALLLGMGERYDVIVTVKDGVFPLVAAAEGKNAQARTLLRTGSGAAPDASFLPRELAGRVGTVESFTAAESVVLPRSDGTGVDLVADLGGDMMSYQWTINGRNYDQTEPLTVKEGDRARLTFTNMTMMWHPMHLHGHTFQVVKGDGGVGPRKDTVIVRPMESVAVDLIADNPGDWMLHCHNGYHQESGMMTRLGYIV
>NZ_CP015203.1|WP_030537786.1|181450_181720_+|membrane-protein
MMWWSENSGYGMGWVSWILMALAMIAFWGLVIAALLALFRPRRSTRSELRGTNAQHLLDERYARGEIDDDEYRSRSEALDRSSRRHESR
>NZ_CP015203.1|WP_030537785.1|180551_181310_-|response-regulator-transcription-factor
MDSTSTRSTDGYAGFRALVVDDERPLASIISSYLERESFEVSVAYNGFDALALAREVDPDVVVLDLGLPGIDGIEVCRELRTFSDAYVVMLTARSEEVDTIVGLSVGADDYMSKPFSPRELVARIRAMMRRPRSGVAHGTTARAVTRDEESPPMTFGVLRIDVAGREVSVAEKPVLLTRTEFDVLAALAARPGMAFSRRQLIEAVWGPAWTGNEHLVDVHIGHLRRKLGDDPAAPLYVNTVRGIGYRMGSGK
>NZ_CP015203.1|WP_030537784.1|179373_180555_-|HAMP-domain-containing-protein
MTTLEELSSHQGRTRRGLGVGVRLLMAQTLVLVAGAATSWVVAVTVGPSLFREHLRRAGVPPMSEEQMHAEQAYRSATAVSLSVAIGAAALCALAVTWYLSRRLQRSVTAVSTAATAVSAGNYAARVPPPQLGDDFDALATAFNEMAVRLESAESMRRRLLADLAHEIRTPVAVLEAFMEALEDGVEALDDHTIAMLRDQTRRLARFSGDVSALSDAETNRAAIEPTWTRPEVLVSSAVAAHEERYDTKAVILSVDVPGNLPSVWLDPERIGQVLSNLLDNALRHSRSQSTVKVRGRVKGDRFILTLTDEGDGVAAEHLPYLFERFYRADAARDRAHGGAGIGLSIAKALVEAHGGQITAASDGAGQGTTFVIALPVHRPKGRHIDCRGTVDA
>NZ_CP015203.1|WP_030537783.1|178459_179224_+|acyl-[acyl-carrier-protein]-thioesterase
MEADAMRNHRLVDLPTNGAVFETSRPVRTGDIDVSGTVRLDGVARYLQDIGFDDLDASGAAAAHPVWVVRRTVIDVIRPVSWPARVRMRRWCSGLSSRWCTMRVRIESDGGGLIETEGFWINLNPVNGMPSRIEESFMAGLGSTANDHRLKWKPWHTAHPGDGEETTFVLRSSDIDPFNHVNNATYWQPVEDLIRDWAGPRNPLPYRAILEYRSPITAGNDVTVRYHSSGESLSSWFLVSGSVCASAYVTAIEV
>NZ_CP015203.1|WP_134929860.1|195949_196273_-|hypothetical-protein
MPSTSVDGYTLTVAGKLTPGQSGELTVDIAGGDEQGSDVQRYEGAYVHVTAIHAQTLAFADLTPLDSDQRGPEFDVPAKLSKSGDWRLFIEFQTGGQLHTAAITIAL
>NZ_CP015203.1|WP_047270658.1|197051_197414_-|winged-helix-turn-helix-transcriptional-regulator
MGHGVEGTSTPPAQLDAESAATVAATLQALATPSRLRMLTRLRHGACSVGDLVEAVGMEQSAVSHQLRLLRAMGLVTGTRQGRNVVYSLYDNHVAMLLDEAVYHIEHLGLGIADDPIPAL
>NZ_CP015203.1|WP_141695818.1|197455_199531_+|heavy-metal-translocating-P-type-ATPase
MFSCIVAFVPTPLPPAGSRAMTTPVRSDPHTEPAAPRAATAVRTRPFALPEVRWAAIATGLFVLGLAAQFGGAPTWLWWTLYLGCYVTGGWEPALAGLQALREKTLDVDLLMIVAAIGAAAIGQVLDGGLLIVIFATSGALEAFLTQRTADSVRSLLDLAPERATVIGPDGHETMVDAASLTAGDVIVVRPGERIGGDGRIISGSSDVDQASITGEPLPVAKHRDDEVFAGTLNGTGTLRIRIDHAASETVVARIVAMVEEASATKAKSQLFIEKVEQYYSVGVVAATLAVFFIPFALGGALQPSLLRAMTFMIVASPCAVVLATMPPLLAAMANAGRNGVLVKSAVVMEQLGSVTTVAFDKTGTLTKGSPALTDIRPMSGANLAADELLTFAAAAEHPSEHPLADAVVAAARQRGLQVPPVEEFDSAPGRGVRARLNGRRIQVGSPAHLLPAASAAIADRATAQAMSAAAEMEAGGKTAIVVIVDAAPIGVLGLADQLRDGARDVVDELTTLTGHTPVLLTGDNPRAAAALAAQVGITDMRAGLLPEDKVTAVADLERSGAKVLLVGDGVNDAPALAAAHTGIAMGRAGSDLALDTADAVIVRDELATIARVIALSRRARRIVIANLAIAATFITTLVLWDLFGHLPLPLGVAGHEGSTVIVGLNGMRLLSQRAWRYETGNLGWRRARSI
>NZ_CP015203.1|WP_155419211.1|199726_199894_+|hypothetical-protein
MSLAPFLVVVLGIPAGMAAIIGLMTAGNERKSRVDRPMRRMRAEISRLNSENAAQ
>NZ_CP015203.1|WP_047270619.1|200166_200832_-|phosphate-signaling-complex-protein-PhoU
MRTHFADSLDDLSCGLASMCGLTVTAMSEATAALLDADLRTAERVLDANTDLERAASDWEHKSFSLLALQAPVAHDLRFTVGGLHIAASLQRMGALAVHIAKIARLRHPTSAVPPEARAVVADMGRTAVARATETQVILRHVDSAHAQELVAADTVMDELHRRLFTVTQAQQWPHGVQAAVDITLLGRFYERFCDHTVEIGRRIIFLETGRLPARPDALLP
>NZ_CP015203.1|WP_054827429.1|202748_203078_-|hypothetical-protein
MTNDEAPLSVYRMTGDDLVAEYQYLYDRFDRHTPNQKARFYYVNGEMKARGLEHGMPTPAARDHDDAWDGEIRDSRVTRITALHGFPVDFTVSNRCAIHTHQGPGINEH
>NZ_CP015203.1|WP_047270614.1|203614_204601_-|c-type-cytochrome-biogenesis-protein-CcsB
MPINQTIARLSDLSFQSAFAVYLLALVLLIWHYAATRTDHVHRFELGSRKLVAAGGVSAPSPEVPGRIVSAPPKPVPERLGNMGAAVLVVGLGLHLVSIVLRGFATGRFPLGNMYEFVTMATAAATATGIVFLRGQTYRAMWVFLLAPVLILMFVAATLLYADAAPVVPALQSYWLPIHVTIVSIGSGVFLVSGVASLAFLLRIRQPAGAERRGPVGSMARRLPDAQTLDRLAYRTVIVGFPLFGIGVILGAIWAEAAWGRFWGWDPKETMSFIAWVIYAAYLHARATAGWRETKAAWINIAGFVSMLFNLFIINMVVSGLHSYAGLS
>NZ_CP015203.1|WP_047270613.1|205532_206876_+|magnesium-transporter
MTESATDGAPTHPVIHLSQLLKRPVIARNGDIVGALDDLIVRLLGVDTYPTVSGLVVNVGGRRVYVSVERIEHLDGDRVMLAQNKVDLRGFERREGEVLLRSDVLGHRLIDVPAAELVHAYDIELENPGHGWVLARLDTRRPARFFGLIKSHGGHASRDWKAFEPLIGHKHSMVVRRVGGRVGTLKPAQIADLLEGADKREGGEILDRVHTDPELEADVFEELDPGKANKLLADMSDVEVAGVLGLMRADDAADAVAELRQSRRRRVLDLMPAGQRTKVITLMGFNSSSAGGLMSVDVISCAATATAAQALSAISAARSMQPEALLKVHVLTDAGRLIGVASVIRLLQSESVTPIVDIMDTDPVRVTPVADLTEVAVLMADYNLATIPVVDDADHVVGVVTVDDVLEASIPDDWRRREPAPRPIVERATDHPTTNTTSTDPGGDDRG
>NZ_CP015203.1|WP_047270656.1|206919_208542_+|divalent-metal-cation-transporter
MPEPRPSAVLDSAHLGDIEGALGRISLSDKESRRTFKARMLTMLAIVGPGLIVMVGDNDAGGVATYAQAGQNYGYSLLWVLLLLIPVLIVNQEMVVRLGAVTGVGHARLINERFGRGWGWFSVGDLFVLNFLTIVAEFIGVSLAASYFGVSRYIVVPTAAVALIAIMATGSFRRWERAMFVFIAVTAVQIPMLLLSHPDWGRAARDFAIPGVRGGITSDAVLLIIAIVGTTVAPWQLFFQQSNIIDKRITPRFISYERADTVLGALVVVAGAAALMMTADYAARSTGSVGEFVDAGDIARLLSANGSVLGPIFAIVLLDASIIGAAAVTLSTSYAFGDVFGISHSLHRGFKEAKPFYLSYGAMVLLAAGIVLIPGAPLGLITTAVQALAGLLLPSASVFLLLLCNDRQVLGPWINPRWLNLVAGLIVAVLLMLSGILMATTVFPDLNVVTASIYLGIALVVAGIVATVGVRWLDRRRGVVTALPPDVGREAKMQWRMPPLTLLEPVVWSSGTKLGMLALRGYLVIGAILLVVKAIQLGSR
>NZ_CP015203.1|WP_047270607.1|209478_209787_+|hypothetical-protein
MIQLEILQVLDCPNVPLLEQRIEQALAGVSIEWELRHLVIEDSQSAALAGMAGSPTLLVDGHDPLAESNQIPSVSCRLYRDAAGAVDGAPTVSALRRAFGMD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP015203_1	1.1\|194602\|25\|NZ_CP015203\|CRISPRCasFinder	194602-194626	25	NZ_CP015203	Rhodococcus sp. 008 plasmid pR8L1, complete sequence	194602-194626	0	1.0
NZ_CP015203_1	1.1\|194602\|25\|NZ_CP015203\|CRISPRCasFinder	194602-194626	25	NZ_CP044283	Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence	55159-55183	1	0.96
NZ_CP015203_1	1.1\|194602\|25\|NZ_CP015203\|CRISPRCasFinder	194602-194626	25	NZ_CP033036	Agrobacterium fabrum strain 12D13 plasmid pAt12D13a, complete sequence	360592-360616	4	0.84
NZ_CP015203_1	1.1\|194602\|25\|NZ_CP015203\|CRISPRCasFinder	194602-194626	25	NC_003064	Agrobacterium fabrum str. C58 plasmid At, complete sequence	527605-527629	4	0.84
NZ_CP015203_1	1.1\|194602\|25\|NZ_CP015203\|CRISPRCasFinder	194602-194626	25	NC_014633	Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence	526868-526892	6	0.76

1. spacer 1.1|194602|25|NZ_CP015203|CRISPRCasFinder matches to NZ_CP015203 (Rhodococcus sp. 008 plasmid pR8L1, complete sequence) position: , mismatch: 0, identity: 1.0

tgggagcccttgtagaagcagcaga	CRISPR spacer
tgggagcccttgtagaagcagcaga	Protospacer
*************************

2. spacer 1.1|194602|25|NZ_CP015203|CRISPRCasFinder matches to NZ_CP044283 (Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence) position: , mismatch: 1, identity: 0.96

tgggagcccttgtagaagcagcaga	CRISPR spacer
tgggagcccttgtagaagcagcagg	Protospacer
************************.

3. spacer 1.1|194602|25|NZ_CP015203|CRISPRCasFinder matches to NZ_CP033036 (Agrobacterium fabrum strain 12D13 plasmid pAt12D13a, complete sequence) position: , mismatch: 4, identity: 0.84

tgggagcccttgtagaagcagcaga	CRISPR spacer
aaggagcccttgttgatgcagcaga	Protospacer
 .*********** ** ********

4. spacer 1.1|194602|25|NZ_CP015203|CRISPRCasFinder matches to NC_003064 (Agrobacterium fabrum str. C58 plasmid At, complete sequence) position: , mismatch: 4, identity: 0.84

tgggagcccttgtagaagcagcaga	CRISPR spacer
aaggagcccttgttgatgcagcaga	Protospacer
 .*********** ** ********

5. spacer 1.1|194602|25|NZ_CP015203|CRISPRCasFinder matches to NC_014633 (Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence) position: , mismatch: 6, identity: 0.76

tgggagcccttgtagaagcagcaga	CRISPR spacer
acagagcccttgtagaagcagcctg	Protospacer
  .*******************  .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

137137 : 144725

uncultured_Caudovirales_phage(28.57%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003944597.1\|137137_138220_-	NAD(P)/FAD-dependent oxidoreductase	A0A2H4J2Q2	uncultured_Caudovirales_phage	2.9e-59	48.0
WP_003944607.1\|138273_138681_-	low molecular weight phosphatase family protein	A0A2H4PQT9	Staphylococcus_phage	9.8e-13	37.0
WP_003944628.1\|138708_139695_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	1.2e-75	51.8
WP_003944644.1\|139736_140153_-	arsenate reductase ArsC	A0A2H4PQT9	Staphylococcus_phage	2.0e-13	36.5
WP_003944591.1\|140149_141238_-	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_037131620.1\|141234_141618_-	helix-turn-helix transcriptional regulator	A0A218MNF3	uncultured_virus	1.6e-12	53.1
WP_054186447.1\|141642_141969_-	DUF3349 domain-containing protein	NA	NA	NA	NA
WP_011331629.1\|142005_142677_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	8.3e-09	38.5
WP_058228364.1\|142673_143366_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_054827611.1\|143597_144725_+	phosphate ABC transporter substrate-binding protein PstS	H6WG65	Cyanophage	1.3e-19	28.9

DBSCAN-SWA_2

346402 : 397376

Staphylococcus_phage(27.27%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_141695805.1\|346402_347101_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	2.3e-25	38.6
WP_058227894.1\|348104_348902_-	crotonase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_058227895.1\|349033_350128_+	NAD(P)-dependent alcohol dehydrogenase	NA	NA	NA	NA
WP_058227896.1\|350148_351591_+	aldehyde dehydrogenase	NA	NA	NA	NA
WP_141695806.1\|351654_353187_+	long-chain-fatty-acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	2.3e-38	25.4
WP_074447131.1\|353183_354344_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_058227898.1\|354427_356047_-	long-chain fatty acid--CoA ligase	Q75ZG1	Hepacivirus	4.9e-31	25.0
WP_058227899.1\|356228_357461_+	cytochrome P450	NA	NA	NA	NA
WP_058227900.1\|357457_357664_+	ferredoxin	NA	NA	NA	NA
WP_141695801.1\|357668_358898_+	oxidoreductase	NA	NA	NA	NA
WP_058227902.1\|358926_360090_+	thiolase family protein	NA	NA	NA	NA
WP_141695802.1\|360100_360526_+	hypothetical protein	NA	NA	NA	NA
WP_058227904.1\|360562_361276_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_058227905.1\|361907_363032_+	NDMA-dependent alcohol dehydrogenase	NA	NA	NA	NA
WP_058227906.1\|363303_364836_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_083197725.1\|365336_366371_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_058227908.1\|366513_367995_+	aldehyde dehydrogenase	NA	NA	NA	NA
WP_058227909.1\|368089_369241_+	hypothetical protein	NA	NA	NA	NA
WP_058227910.1\|369243_369612_+	hypothetical protein	NA	NA	NA	NA
WP_058227911.1\|369608_370205_+	hypothetical protein	NA	NA	NA	NA
WP_058227912.1\|370201_371290_+	hypothetical protein	NA	NA	NA	NA
WP_058227913.1\|371294_372878_+	pyruvate, phosphate dikinase	A0A2D2W2B1	Stenotrophomonas_phage	1.4e-70	38.7
WP_141695803.1\|373139_374404_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	6.1e-69	51.5
WP_058227915.1\|374472_374787_-\|transposase	transposase	A0A0P0I4A4	Acinetobacter_phage	9.2e-11	39.0
WP_156779016.1\|375004_376204_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	4.8e-31	29.9
WP_042926782.1\|376774_377077_-\|transposase	transposase	NA	NA	NA	NA
WP_058228498.1\|377273_378308_+	hypothetical protein	NA	NA	NA	NA
WP_058228500.1\|379003_380152_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_058228501.1\|380285_381881_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	7.0e-38	27.5
WP_082654968.1\|382257_383226_+	glucose 1-dehydrogenase	F2NZ40	Diadromus_pulchellus_ascovirus	7.8e-16	31.1
WP_141695873.1\|385940_387209_-	hypothetical protein	NA	NA	NA	NA
WP_141695875.1\|389052_393099_+	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	2.9e-64	30.2
WP_082654969.1\|393095_393836_+	hypothetical protein	NA	NA	NA	NA
WP_058228506.1\|393832_395089_+	DUF1624 domain-containing protein	NA	NA	NA	NA
WP_082654970.1\|395045_395819_-	hypothetical protein	NA	NA	NA	NA
WP_065352562.1\|396092_397376_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	6.9e-36	37.9

DBSCAN-SWA_3

481607 : 603512

uncultured_virus(30.43%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064073797.1\|481607_482888_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.5e-32	39.7
WP_058228551.1\|482847_483285_-	ATP-binding protein	NA	NA	NA	NA
WP_058228550.1\|483706_484171_+	hypothetical protein	NA	NA	NA	NA
WP_058228548.1\|487639_488602_+	DoxX family membrane protein	NA	NA	NA	NA
WP_058228545.1\|491268_491700_+	virulence protein	NA	NA	NA	NA
WP_058228544.1\|492369_492648_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_058228543.1\|492644_493049_-	hypothetical protein	NA	NA	NA	NA
WP_064073797.1\|493692_494973_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.5e-32	39.7
WP_058228603.1\|495507_495879_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_058228604.1\|496057_496516_+	Hsp20 family protein	NA	NA	NA	NA
WP_058228605.1\|496621_496882_+	hypothetical protein	NA	NA	NA	NA
WP_065353005.1\|497344_498241_-	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	4.9e-65	47.9
WP_156779019.1\|499009_499168_+	hypothetical protein	NA	NA	NA	NA
WP_058228593.1\|499753_499972_+	hypothetical protein	NA	NA	NA	NA
WP_058228594.1\|500207_500585_+	hypothetical protein	NA	NA	NA	NA
WP_058228595.1\|500581_501157_+	AAA family ATPase	NA	NA	NA	NA
WP_141695893.1\|501202_501439_-	hypothetical protein	NA	NA	NA	NA
WP_064073797.1\|502173_503454_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.5e-32	39.7
WP_058228420.1\|503821_504055_-	hypothetical protein	NA	NA	NA	NA
WP_058228419.1\|504356_504992_-	hypothetical protein	NA	NA	NA	NA
WP_058228423.1\|506759_507797_-	methionine synthase	NA	NA	NA	NA
WP_058228418.1\|507817_508810_-	DUF1852 domain-containing protein	NA	NA	NA	NA
WP_058228417.1\|508935_509883_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_058228416.1\|513191_513794_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_058228415.1\|513790_514462_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_058228414.1\|514516_514891_+	hypothetical protein	NA	NA	NA	NA
WP_058228413.1\|515189_516281_-	hypothetical protein	NA	NA	NA	NA
WP_141695855.1\|516506_517391_-	hypothetical protein	NA	NA	NA	NA
WP_058228411.1\|517685_518006_-	hypothetical protein	NA	NA	NA	NA
WP_141695854.1\|518530_518959_+	hypothetical protein	NA	NA	NA	NA
WP_058228409.1\|520118_521321_-	ATP-binding protein	NA	NA	NA	NA
WP_141695853.1\|521317_522109_-	response regulator	NA	NA	NA	NA
WP_058228407.1\|522219_522879_-	hypothetical protein	NA	NA	NA	NA
WP_141695856.1\|523181_523544_-	hypothetical protein	NA	NA	NA	NA
WP_082654958.1\|524388_526326_+	cutinase family protein	NA	NA	NA	NA
WP_141695852.1\|527156_527399_-	hypothetical protein	NA	NA	NA	NA
WP_058228404.1\|527902_528265_+	hypothetical protein	NA	NA	NA	NA
WP_058228403.1\|528935_529697_+	hypothetical protein	NA	NA	NA	NA
WP_058228402.1\|530386_530983_-	recombinase family protein	A0A219YA40	Aeromonas_phage	2.0e-22	36.4
WP_058228421.1\|531857_534224_-	arylsulfatase	NA	NA	NA	NA
WP_058228397.1\|535637_536186_-	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	5.0e-44	52.0
WP_058228396.1\|536496_536856_+	Lsr2 family protein	A0A160DEV0	Gordonia_phage	1.3e-16	44.5
WP_065353008.1\|537293_539933_-	hypothetical protein	NA	NA	NA	NA
WP_065353009.1\|540046_540667_-	hypothetical protein	NA	NA	NA	NA
WP_058228394.1\|541012_541864_+	hypothetical protein	NA	NA	NA	NA
WP_058228391.1\|542799_543648_-	hypothetical protein	NA	NA	NA	NA
WP_064073797.1\|543949_545230_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.5e-32	39.7
WP_003943993.1\|545948_546173_-	hypothetical protein	NA	NA	NA	NA
WP_065353011.1\|546623_547262_-	hypothetical protein	NA	NA	NA	NA
WP_156779020.1\|547858_548458_-	hypothetical protein	NA	NA	NA	NA
WP_156525058.1\|551459_552659_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.2e-31	29.9
WP_082654974.1\|552555_553230_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.9e-24	39.4
WP_054828350.1\|553235_553532_-\|transposase	transposase	NA	NA	NA	NA
WP_058228537.1\|553640_554687_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_141695882.1\|554741_555873_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-38	38.5
WP_042926698.1\|556404_557379_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003941837.1\|557576_557981_+	hypothetical protein	NA	NA	NA	NA
WP_058228533.1\|558038_558905_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_058228534.1\|558991_560440_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_058228535.1\|560544_561870_-\|transposase	ISL3-like element ISPfr2 family transposase	A0A2H4PDF8	Mycobacterium_phage	3.4e-195	76.3
WP_003941073.1\|562502_562814_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_058228536.1\|562922_563864_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003943380.1\|565052_566027_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003943355.1\|566237_567431_-	alcohol dehydrogenase catalytic domain-containing protein	NA	NA	NA	NA
WP_051649789.1\|567633_570315_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	3.0e-150	33.6
WP_065352562.1\|570474_571758_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	6.9e-36	37.9
WP_058228565.1\|572023_573298_-	hypothetical protein	NA	NA	NA	NA
WP_058228564.1\|573699_574029_-	hypothetical protein	NA	NA	NA	NA
WP_058228563.1\|574025_574589_-	hypothetical protein	NA	NA	NA	NA
WP_074447172.1\|574585_575044_-	hypothetical protein	NA	NA	NA	NA
WP_141695886.1\|575345_575657_-	hypothetical protein	NA	NA	NA	NA
WP_074447170.1\|576253_576733_+	transcriptional regulator	V5UPP6	Mycobacterium_phage	1.4e-21	41.9
WP_082654975.1\|577123_578029_-	hypothetical protein	NA	NA	NA	NA
WP_058228558.1\|578294_579116_-	SDR family NAD(P)-dependent oxidoreductase	W8CYX9	Bacillus_phage	2.1e-06	39.2
WP_064073797.1\|579211_580492_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.5e-32	39.7
WP_058228474.1\|580622_581204_-	hypothetical protein	NA	NA	NA	NA
WP_082654965.1\|581359_581716_-	hypothetical protein	NA	NA	NA	NA
WP_058228476.1\|581943_583515_-	peptidoglycan DD-metalloendopeptidase family protein	A0A088FUQ2	Mycobacterium_phage	2.7e-26	45.6
WP_065353016.1\|583511_584345_-	hypothetical protein	NA	NA	NA	NA
WP_082654964.1\|584344_586450_-	hypothetical protein	NA	NA	NA	NA
WP_058228477.1\|586446_589494_-	hypothetical protein	NA	NA	NA	NA
WP_058228478.1\|589490_589889_-	hypothetical protein	NA	NA	NA	NA
WP_058228479.1\|589930_590257_-	hypothetical protein	NA	NA	NA	NA
WP_058228480.1\|591515_593618_+	AAA family ATPase	J9PMA8	Bacillus_phage	9.6e-11	23.9
WP_058228481.1\|593676_594033_+	hypothetical protein	NA	NA	NA	NA
WP_058228482.1\|594032_595364_+	chromosome partitioning protein ParA	NA	NA	NA	NA
WP_058228483.1\|595444_596671_+	hypothetical protein	NA	NA	NA	NA
WP_058228484.1\|596777_597446_+	hypothetical protein	NA	NA	NA	NA
WP_058228485.1\|597886_598687_+	N-formylglutamate amidohydrolase	NA	NA	NA	NA
WP_058228490.1\|599330_599828_+	hypothetical protein	NA	NA	NA	NA
WP_058228486.1\|600051_600984_-\|transposase	IS481 family transposase	A8RHK4	Spiroplasma_virus	8.0e-10	28.8
WP_058228491.1\|601112_601367_-\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	4.3e-35	77.1
WP_058228492.1\|601509_601749_+	hypothetical protein	NA	NA	NA	NA
WP_074447163.1\|601658_602057_-\|transposase	transposase	A0A1B3AZF8	Gordonia_phage	1.3e-33	77.9
WP_064073797.1\|602231_603512_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.5e-32	39.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP012749

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP012749_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012749_1

2374506-2374617

Orphan

Consensus_repeat	Method
TGAACGGGTTGTCGACGAGGGCGTTGGTGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP012749_1

>merge|NZ_CP012749|1|2374506-2374617|CRISPRCasFinder
TGAACGGGTTGTCGACGAGGGCGTTGGTGCCCACACCCTGCAGGGCGTGTGCGGACGTTGCCTCGGCAACCGGCTCGAAGGTGAACGGGTTGTCGACGAGAGCGTTGGTGCC

>NZ_CP012749|1|1|2374506-2374617|CRISPRCasFinder
TGAACGGGTTGTCGACGAGGGCGTTGGTGCC	CACACCCTGCAGGGCGTGTGCGGACGTTGCCTCGGCAACCGGCTCGAAGG
TGAACGGGTTGTCGACGAGAGCGTTGGTGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012749.1\|WP_065351744.1\|2374772_2376032_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340863
NZ_CP012749.1\|WP_064442931.1\|2376116_2377184_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP012749.1\|WP_003944177.1\|2383351_2383939_+\|DinB-family-protein	unknown	unknown	gnl\|CDD\|368218
NZ_CP012749.1\|WP_065351740.1\|2367939_2368566_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP012749.1\|WP_042453284.1\|2370824_2372165_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274674
NZ_CP012749.1\|WP_064073630.1\|2364280_2365483_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|226951
NZ_CP012749.1\|WP_042453274.1\|2377180_2377975_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP012749.1\|WP_064442933.1\|2377971_2378952_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238568
NZ_CP012749.1\|WP_030535884.1\|2368797_2369589_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224662
NZ_CP012749.1\|WP_007735909.1\|2379633_2379918_-\|SHOCT-domain-containing-protein	unknown	unknown	gnl\|CDD\|378276
NZ_CP012749.1\|WP_007735884.1\|2365522_2366644_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223650
NZ_CP012749.1\|WP_064442936.1\|2379914_2380367_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012749.1\|WP_003943582.1\|2380370_2382017_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340879
NZ_CP012749.1\|WP_065351741.1\|2369535_2370828_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274674
NZ_CP012749.1\|WP_003943598.1\|2367492_2367933_+\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|379177
NZ_CP012749.1\|WP_065351743.1\|2373584_2374397_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274832
NZ_CP012749.1\|WP_065351745.1\|2378948_2379632_+\|SagB/ThcOx-family-dehydrogenase	unknown	unknown	gnl\|CDD\|188352
NZ_CP012749.1\|WP_003943539.1\|2366640_2367381_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213222
NZ_CP012749.1\|WP_063892127.1\|2382085_2383009_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012749.1\|WP_065351742.1\|2372157_2373588_-\|CocE/NonD-family-hydrolase	unknown	unknown	gnl\|CDD\|273375

Protein	Function_ID	Function_description	E-value
NZ_CP012749.1\|WP_065351744.1\|2374772_2376032_+\|MFS-transporter	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.03337e-53
NZ_CP012749.1\|WP_064442931.1\|2376116_2377184_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	1.5777e-90
NZ_CP012749.1\|WP_003944177.1\|2383351_2383939_+\|DinB-family-protein	gnl\|CDD\|368218	pfam04978, DUF664, Protein of unknown function (DUF664). This family is commonly found in Streptomyces coelicolor and is of unknown function. These proteins contain several conserved histidines at their N-terminus that may form a metal binding site.	4.21422e-42
NZ_CP012749.1\|WP_065351740.1\|2367939_2368566_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.60956e-09
NZ_CP012749.1\|WP_042453284.1\|2370824_2372165_-\|hypothetical-protein	gnl\|CDD\|274674	TIGR03604, hypothetical_protein, thiazole/oxazole-forming peptide maturase, SagD family component. Members of this protein family include enzymes related to SagD, previously referred to as a scaffold or docking protein involved in the biosynthesis of streptolysin S in Streptococcus pyogenes from the protoxin polypeptide (product of the sagA gene). Newer evidence describes an enzymatic activity, an ATP-dependent cyclodehydration reaction, previously ascribed to the SagC component. This protein family serves as a marker for widely distributed prokaryotic systems for making a general class of heterocycle-containing bacteriocins.	5.72289e-66
NZ_CP012749.1\|WP_064073630.1\|2364280_2365483_-\|sensor-histidine-kinase	gnl\|CDD\|226951	COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms].	5.07406e-51
NZ_CP012749.1\|WP_042453274.1\|2377180_2377975_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	1.47196e-101
NZ_CP012749.1\|WP_064442933.1\|2377971_2378952_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238568	cd01148, TroA_a, Metal binding protein TroA_a. These proteins are predicted to function as initial receptors in ABC transport of metal ions in eubacteria. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains.	5.62236e-45
NZ_CP012749.1\|WP_030535884.1\|2368797_2369589_+\|hypothetical-protein	gnl\|CDD\|224662	COG1748, LYS9, Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism].	0.00586013
NZ_CP012749.1\|WP_007735909.1\|2379633_2379918_-\|SHOCT-domain-containing-protein	gnl\|CDD\|378276	pfam09851, SHOCT, Short C-terminal domain.	2.92733e-06
NZ_CP012749.1\|WP_007735884.1\|2365522_2366644_+\|ABC-transporter-permease	gnl\|CDD\|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	1.73425e-11
NZ_CP012749.1\|WP_003943582.1\|2380370_2382017_-\|MFS-transporter	gnl\|CDD\|340879	cd17321, MFS_MMR_MDR_like, Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial, fungal, and archaeal multidrug resistance (MDR) transporters including several proteins from Bacilli such as methylenomycin A resistance protein (also called MMR peptide), tetracycline resistance protein (TetB), and lincomycin resistance protein LmrB, as well as fungal proteins such as vacuolar basic amino acid transporters, which are involved in the transport into vacuoles of the basic amino acids histidine, lysine, and arginine in Saccharomyces cerevisiae, and aminotriazole/azole resistance proteins. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. For example, MMR confers resistance to the epoxide antibiotic methylenomycin while TetB resistance to tetracycline by an active tetracycline efflux. MMR-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.68723e-22
NZ_CP012749.1\|WP_065351741.1\|2369535_2370828_-\|hypothetical-protein	gnl\|CDD\|274674	TIGR03604, hypothetical_protein, thiazole/oxazole-forming peptide maturase, SagD family component. Members of this protein family include enzymes related to SagD, previously referred to as a scaffold or docking protein involved in the biosynthesis of streptolysin S in Streptococcus pyogenes from the protoxin polypeptide (product of the sagA gene). Newer evidence describes an enzymatic activity, an ATP-dependent cyclodehydration reaction, previously ascribed to the SagC component. This protein family serves as a marker for widely distributed prokaryotic systems for making a general class of heterocycle-containing bacteriocins.	1.70576e-67
NZ_CP012749.1\|WP_003943598.1\|2367492_2367933_+\|PAS-domain-S-box-protein	gnl\|CDD\|379177	pfam13426, PAS_9, PAS domain.	3.26675e-11
NZ_CP012749.1\|WP_065351743.1\|2373584_2374397_-\|hypothetical-protein	gnl\|CDD\|274832	TIGR03882, hypothetical_protein, bacteriocin biosynthesis cyclodehydratase domain. This model describes a ThiF-like domain of a fusion protein found in clusters associated with the production of TOMMs (thiazole/oxazole-modified microcins), small bacteriocins with characteristic heterocycle modifications. This domain is presumed to act as a cyclodehydratase, as do members of the SagC family modeled by TIGR03603.	0.000351741
NZ_CP012749.1\|WP_065351745.1\|2378948_2379632_+\|SagB/ThcOx-family-dehydrogenase	gnl\|CDD\|188352	TIGR03605, antibiot_sagB, SagB-type dehydrogenase domain. SagB of Sterptococcus pyogenes participates in the maturation of streptolysin S from a ribosomally produced precursor polypeptide. Chemically similar systems operate on highly diverse sets of bacteriocin precursors in numerous other bacteria. This model describes a domain within SgaB and homologous regions from other proteins, many of which appear to be involved in biosynthesis of secondary metabolites. While some substrates may be intermediates in non-ribosomal peptide syntheses, others are involved in heterocycle-containing bacteriocin biosynthesis, and can be found near SgaC-like (see TIGR03603, cyclodehydratase) and SgaD-like (see TIGR03604, "docking") proteins. Members of this domain family are heterogeneous in length, as many have a partial second copy of the domain represented here. The incomplete second domain scores below the cutoffs to this model in most cases.	8.68545e-29
NZ_CP012749.1\|WP_003943539.1\|2366640_2367381_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	6.92183e-80
NZ_CP012749.1\|WP_065351742.1\|2372157_2373588_-\|CocE/NonD-family-hydrolase	gnl\|CDD\|273375	TIGR00976, Hypothetical_protein_Rv1835c/MT1883/Mb1866c., putative hydrolase, CocE/NonD family. This model represents a protein subfamily that includes the cocaine esterase CocE, several glutaryl-7-ACA acylases, and the putative diester hydrolase NonD of Streptomyces griseus (all hydrolases). This family shows extensive, low-level similarity to a family of xaa-pro dipeptidyl-peptidases, and local similarity by PSI-BLAST to many other hydrolases. [Unknown function, Enzymes of unknown specificity].	6.99134e-38

>NZ_CP012749.1|WP_065351743.1|2373584_2374397_-|hypothetical-protein
MYALADGHQLYPTPDGTWHYLTPDENAVTIGAPAEDLAELDNFLRRSGSVLGPGAIEIADALVSRGVLVVPGQAPEIPRPQRVLMDGIGPVADACIALLSKALPHLEVVSTTAPIEDDVASSDLVLSVAGAPPHDEWSELDTWCRRNQTPWQTVHAELGEICIGPFFDGIGSASYRDVCGRRLAASRVPDHLQALWNHLAGSEPRPLELEPTAAAMASALACSDVVAGVHGAPPSHLHHQIRMNPRTLMMTRHPVLPLPGGVLEPAPTLR
>NZ_CP012749.1|WP_065351742.1|2372157_2373588_-|CocE/NonD-family-hydrolase
MISLGVKIPAADGSSLATDVLLPPDSSPRGLIVIRTPYGRGWHLAEGIEWRLRGIAFISQDVRGRHDSTGSWEPYVHEREDSAALAEWLQDQPWTPECVIASGASYAAGTAWAFAAETNSADRSFRVDGVVSKVPTIGSDRVKRDPSGILLLAEHLAWWGEHGDSSSSREGFIPALMRSDSSLLEHLPVQSMIEEVGLTSDSPGWLTAILRARKREDFGGDDLVSADELSELDIAGLHIGGWDDAMIRETLRHFTSVGRGPQSLIVGPWAHDLRPGMVGETSFGRLQVEWMESIFSARPVTINRVFDRGAGDWSSEPYVTGANRVRLEPDRKDAVYTFLYDASRARNDCVFWTFDIKHDSVLSGTPSVELKVHSPEGEADWIVELSVVDAAGVTRSIARGAGVSVQPTMVTIDLDPVLHTVRAGDVLTLRIAGSDFPRLARNLGDGDRYRGTRSTALHQSFSGSLTLPILGGTAGG
>NZ_CP012749.1|WP_042453284.1|2370824_2372165_-|hypothetical-protein
MDDLLVDARSGVLTSLEPHIRSDMPTGWVGWAARVADTRNFGGSGSLFRADPYGFGASIRDDAAARGAATGEAVERYCGNVVPEDLVRSSASALELAGSRVVDPAEFALYSEDQYRLPGFPFVPFTSDLNIRWALGHTMDEKVPTYVPAALTYLGYYTGTRRCEPPIASLQYAGIAAGRSRDEAEMSALLELLERDATALWWCGDRSQPAIELSDWERLPAHRQLGDLESQTRSVRVLLLPSPFGIPVAAAWIRDDRRGLVALGTACRPTVEAAVSKALVEAYAVLAITIDLADPDGPTWRSVADGTLPAHLYKPFRADRRYRDEFDPQWKDIVDLPTVAQLYLDPVMALAAEEHLFDYTETLSVSEIPDEAPLDLASLVALLMSRGHQPISVDLTTGDISIAGLHVVRILTPGLYNNAPAAFPLLGGSRLTSASTTHLHLPVPLA
>NZ_CP012749.1|WP_065351741.1|2369535_2370828_-|hypothetical-protein
MTSSLVDRRTGIIRELVDAVVPQHFPPEFKLIHSYVSDSARFSPWSSDSAGAGYCFDLGDRARPTAAAIGEAVERYCGNIVAKPIVRGSADALIGASIDLSQLARFDAAQCARPQFPFVEPTDDLEMDWTRGADLITGSDIWVPAELVWGSYPHFVARTGPAISPVAQAGLAAGPSVKFAIDNALREIVERDAMTLSWTGRRGVRVVTGIPEVLRRLGNHGTLSTRWLSFDSDFGIPVLGALIHDGLTGYSTIGTACHEDAQTAAFKSLGEALQLQLLSADYDNPQSGIGRAAASPTSPLAHWRADRSYAGAYRSDFADVMDYGCHLQLHLDPEIQARFESELVGAVVGEVGLDSLTSAAGTESALTAAGFRPAWVDLTTTDVLHAGLHVVRVVVPGCLTNAAAGLPFLGSPRLVDSLAGRSARTIPLPH
>NZ_CP012749.1|WP_030535884.1|2368797_2369589_+|hypothetical-protein
MVNASGFEDVRLADEAVRGGAAFVDVTATSNYCEELEAVDGPVLMGVGLAPGLTSVLAAEAHRLGGGPVDIVIGLGGGELHGPAATAWTYGMLGTRFPDPDGRSIRNYTGMKTFRIPADATGYRTGPAVRADFSDQHALTRDLGVPVRTYLRLDTSTATLGLAAMTWAPALQKVVPKKLWGSDRWVAMARADTGPALWVSGRSQSVATAAIAARAVQVIRDAAISKPTWFHAVETTESLQAAVPELSVRQWDGASRSSGKTVH
>NZ_CP012749.1|WP_065351740.1|2367939_2368566_-|TetR/AcrR-family-transcriptional-regulator
MTEVLREDMSARRKIIEAAREVFVDPGYAAATIKQLAAAAGVSVQSVYFVFGNKPSVLSALLDVAVAGDEEKTATLDRPWVAAALGAPHPLGQLRIQVHHGRLILERTADILLALRAAASADEDAARLWQINRTQRRTVQEHLMVGIVEKAPTVDLETAVNVALTLLSPETYTDLVVGAGWTGQQYEEWVVNTLAATLGLDRTVKSRK
>NZ_CP012749.1|WP_003943598.1|2367492_2367933_+|PAS-domain-S-box-protein
MERRRNVAQPPQSPIADLEQMPALILLDRLPVPVMAVHRDGSIVFANPSFADMLGYPKKAVSALRLQDILYDKDADDVSAEQAHRELSSEPGSVKEFVHSDSTLVRATVSQSLLRRDDDTITLAVLHDLTERLWNNPRHIDDKPTK
>NZ_CP012749.1|WP_003943539.1|2366640_2367381_+|ABC-transporter-ATP-binding-protein
MTMTTGTTVLDIQNVDLTFPDGQSRVTALDDVSLRLHRGEIAAITGPSGSGKSSLLAVASTLIRPDSGHVYLRTPEGSTDIAALSRRAASELRRSSIGIVFQQSNLVSSLTALEQLEVMAHLGQSVFTSRARRKAVKSKAMDLLDAVGLADQSGKRPSQLSGGQRQRVNLARALMNDPQLLVVDEPTSALDQERGAAVMDLIIGVVREREAATLLVTHDRSHLSRMDTVYRVVDGSLAEDQEALAA
>NZ_CP012749.1|WP_007735884.1|2365522_2366644_+|ABC-transporter-permease
MSIRGAMERVCIRESVEASTGKEFTVFVAMRDLRAARGRFALISVVVLLVALLVSFLSGLTAGLRHQNVSAIEAMNADTVVFADTGAGASFDESALTQDQVNAWTSTSKDVDPIGIGRGKAGLADGNQKSVALFGADGGFGDVTPSASGTVVLSEGAARDLGAGAGDQVSVGTQQFTVSAVRGDDWYSHSPVVWMTLDDWQAANPRGGVATVLAVTGASDASATDKAAATTSTTVSGSLDAIGSYKSENGSLTLMTLMLFAISALVIGAFFTVWTIQRTPDIATLKALGATTGSLVRDALGQALIVLIAGVTVGIGLTAVAGSLIGDAMPFVLDASTTVVPAVALIGLGLLGAAFALRFLSTTDPLTALGSAR
>NZ_CP012749.1|WP_064073630.1|2364280_2365483_-|sensor-histidine-kinase
MDERGPNLAKLGEMHRSPLTPVFAGLQLGLHVLVMALAGVVFLRALLDESDLTATIIALAVIFVAVYLFGVAKRLRGNAARWWLAVLTLVWIATMAVSADAAYLAFGLFFLYLHILRRPWSLLAVTAATAVAVVGTGLHRGWTIAGAVGPIIGAAVAVAIGLGYQALYREAAERGRLIDELMNTREELASTSRDAGKFAERERLAAEIHDTVAQGLSSIQMLLHAAERADPDSPAIRQISLARETAADSLAETRQLIAELTPAALDGQSLADALRRICERASSPELEARSVVEGEAVRLPMPLEATLVRIAQGAVSNVLRHADATRMAVTLTYSDDTVSLDVVDNGHGFDVAVLERGPAESFGLNAIRRRVELQGGTFSIESEPGHTAVAVTFPLEVGEP
>NZ_CP012749.1|WP_065351744.1|2374772_2376032_+|MFS-transporter
MSETPTTGSVEAQPHVFRDRSFRLFFTARTIAVAGAAVTGVAMPILVFDISRSPFLTSLAAAGTVLPYLVFGLFAGAVADRVNRRTVILCAQAVAALALASIPAAQALGVLTAWHAVGVSMCIGTCFVWFDAAAFGALPALVGRQRIPAANSALWTSSTLIDVVFPAIAGVLVASIGPAYALGADALAYVLAGLAMASIGASFSITPAAPKKSGTGIARDIREGLSFLWRSPLLRALTGVGFVNSLTQGAVTALLVVYASERLGISTSSPMIGAVWTAVSVGGVVGALVLPRLPAQWPVGAITVGALTIAPVVLFVVATTGNAGAAITALVVYSGCATVTILNGIGARQRLTPDRLQGRVNTTARMVAWGGSPVGALIAGAIAGRWDIGTAYLVACIFALVGALFAWASALRTDPYPHK
>NZ_CP012749.1|WP_064442931.1|2376116_2377184_+|iron-ABC-transporter-permease
MTLTSEAAPRVPSRPHPVGERGYVPFLLATAVVLVAVSTVAVWSGAASVSFADVFAVLYAHVGGPPVDPLLDRIVWGLRVPRILIAALAGAGLSLAGAVLQALVRNPIADPYILGVGSGASFGAVLIMTTGIGTSLSIGVPVAAFLGAMVSLIAVLVLGRREGMLVPLRMVLAGVAIGYLLSAATSFVQLRADPSQLSGVLFWLLGSVSGASWSDLGVPAAVITVCAAILLTQSRQLNALAMGDESAQSVGVDVHRTRLLLLVIASLLTAVVVSVAGGIGFVGLLVPHAVRLLVGSDHGKLLPATALVGATFLVIVDLAARMLDAPNELPLGIITAGLGAPFFLWLLRRDGGAQS
>NZ_CP012749.1|WP_042453274.1|2377180_2377975_+|ABC-transporter-ATP-binding-protein
MRLSASGIHVVRGGRLVVSGVDLEAPEGSVVGLVGPNGSGKSSLLRALYRSMKPRSGIVKVDEVNVWDDLSPRSAARIIGVVGQEHSSDFSFSVREVVATGRTPHHSAFSRLGEIDRDIVSAALVRTGMQGFGSRLFAELSGGEKQRVMLARAIAQQPSVLVLDEPTNHLDIRAQLELMELVAELGTTTIVAIHELALAAAYCDYVCLLSGGVVVATGPTAEVLTEDLLSEVFGVQVHLGTHPLTGRPLLSFAPPLLHTKEAVS
>NZ_CP012749.1|WP_064442933.1|2377971_2378952_+|ABC-transporter-substrate-binding-protein
MKSSIRTAALLCSAVTATAVLTACGNSTADSAASSSEKITVTNCDREVTVPKTAERIVSLYPSMTELLIQLGAADRIVGQSNTDLSPPSPELADQFAAVPVLSTGVPAKEALLDARPDLIVSDGEYWFDGDRLQTMDELRDLGIPIFVNSGYCHKAVTEGRIDDVWSDLDGLGALTGTSDAAATLLADGKKSLAATEASVAGQEPVPTVMVQVSEGQSYALARGLYSSVLEAAGGSNLFENDLPDGKYFGQVATESVLAKSPKAVLVVYSTESARESTLDAARTAFAGTPAATSNAIFAVPEAWFAGELVSIDGAGEVSRLLHPGS
>NZ_CP012749.1|WP_065351745.1|2378948_2379632_+|SagB/ThcOx-family-dehydrogenase
MTALERIEAVVSLHAVLDRTVSPSELPFDEHALPPVTCESVELPAATPLPACGFADVLQARRSRYDPAQTALRAGELSNVLHHSLVSSPTAGGMRELTLSFVLSRPGDELGAGVYRYARGRAEAVRPGDVREHLRASLLQPEFVDVFPVLLFVVADVEAPLEKYAMRHYRTMHVDAGVLVQNLYLMTEAMGLAGCAIAGFTDARVASLLNLATTQLPVMAFALGRRS
>NZ_CP012749.1|WP_007735909.1|2379633_2379918_-|SHOCT-domain-containing-protein
MSFLRRAGRVAVASSIHGNVQRRQRTRWAAEDQARAAQAQPVPPIPDLPPLPPQAAPAASMDLKLEQLTKLGELKNAGVLTEAEFETQKARILA
>NZ_CP012749.1|WP_064442936.1|2379914_2380367_-|hypothetical-protein
MSNQDQFGPIEYVAVEFPGGAPTSAGFEQLLALVDSGVIRILDLEFVTKAADGTVSVVPASTFELADFDLAQFDGAASGLLDAGDIAAVGDELATGSVAAVLVYEELAILPVIDAWTRSGAKIVTEGHLSLDELATALDNTAPGNTEKDA
>NZ_CP012749.1|WP_003943582.1|2380370_2382017_-|MFS-transporter
MSVKPGAAATTAAVSTASWLPLIVVVLTQIQASFAVNALTVSMAGITTDLDTPATSVGTAITAGTFAMAAFILLGAKIGARYGTRLVFQIAVAIHGLAMAAVALSQSPAMLFVAQAASGAVIALIAPALTVFIATNFSGDQQAKAIGYLAAAIPAAGVLALLIAGSFATTIGWRYSFALVVALAVVNLILSFRVKPVPPQKDITIDWAGAAIAAVAVILLSFGFSGLNSWGVILATDAAPFSVIGVSPAAILIVLGTICAQGFFQWTRSRKAQNKPQLFNLDVLKTGAERATTICMATMMFVGTAANFLIPLYMQIIQGRSSLQTSFSIIPYTLSIFIASTVVARLYKTYSPRLIARAGFVVVAAGLILLAFTIRGDWHQIFVVIGLITLGLGQGAIVALVFNTLLTAAPKELAGDVGAWRGLVHNMSGSVGIAVASVFAVGILGSLVSSQLIDNPTIPASLKVESGINLDQVNFVPNDQLVVTLENTSATQAQIDEAIRINTEARLRALRTSLLVLAGLSLLAIIPAGRMPNEVPALEEPQPTKGKK
>NZ_CP012749.1|WP_063892127.1|2382085_2383009_-|hypothetical-protein
MRAAHLAVLEARVAALDAGDTDTVAAAIRGYVPLNSGNPVVRHVQDLGSRIREEARHVVSGKPRSIAFRLGLSLGMGLAYLAFIRLFQWDTKEDRLPYLALYALSGVVGSVVCTNALSFDAGRVRAALSGGTRLWHVLVAKNAVMLLLVGSAGFLLSAVLAWRSGSSADLVKACGQVLTMILLWLGVANVMSVSLPLRAEPMTARRHDGTWKQFLLSFVISYGVGLIVNLMLYWRVWAKTTLLEQMGGPWIPVLLLLASAAATWLLLTVLAVLLAEQPRFRRALHREMVVYREETNHLQATIQHNSG
>NZ_CP012749.1|WP_003944177.1|2383351_2383939_+|DinB-family-protein
MTTNSEKEDLQRYLQAARDALVWKLDGLSEYDIRRPMTRTGTNLLGLVKHMIGVELGYFGPTFGRRVPDLPAWLRSEELNVDMWARADESTADIVETYRRTWAFADATIEEHDLDAPGFVKHWPEDRRDVTLHRILVHVVTEIHRHAGHADIVRELIDGAAGMKAGDNNLAPGDEAWWAEYTDRLETAAREAHHA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4693326 : 4720943

Rhodococcus_phage(43.48%)

portal,tail,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065352898.1\|4693326_4693995_+	DNA cytosine methyltransferase	S5YQT7	Mycobacterium_phage	2.3e-91	72.5
WP_065352265.1\|4694244_4694664_+	hypothetical protein	NA	NA	NA	NA
WP_065352266.1\|4694660_4694990_+	hypothetical protein	A0A2H4J9S3	uncultured_Caudovirales_phage	2.6e-32	66.0
WP_065352267.1\|4694986_4695385_+	hypothetical protein	A0A2H4PF41	Gordonia_phage	9.6e-29	52.0
WP_065352268.1\|4695381_4695612_+	hypothetical protein	NA	NA	NA	NA
WP_065352269.1\|4695608_4696067_+	single-stranded DNA-binding protein	A0A2H4JEL4	uncultured_Caudovirales_phage	1.9e-60	79.0
WP_156778961.1\|4696080_4696401_+	hypothetical protein	A0A2H4IY74	uncultured_Caudovirales_phage	8.8e-09	60.5
WP_065352270.1\|4696397_4697051_+	hypothetical protein	NA	NA	NA	NA
WP_065352271.1\|4697047_4697323_+	hypothetical protein	NA	NA	NA	NA
WP_156778962.1\|4697879_4698383_+	hypothetical protein	NA	NA	NA	NA
WP_065352900.1\|4698391_4699651_+\|terminase	PBSX family phage terminase large subunit	G9FH82	Rhodococcus_phage	7.2e-131	57.2
WP_065352273.1\|4699647_4701174_+\|portal	phage portal protein	G9FH83	Rhodococcus_phage	6.6e-171	60.4
WP_065352274.1\|4701186_4702287_+	hypothetical protein	G9FH84	Rhodococcus_phage	6.9e-85	38.9
WP_065352275.1\|4702419_4703052_+	hypothetical protein	G9FH85	Rhodococcus_phage	3.0e-08	61.3
WP_065352276.1\|4703067_4704249_+	hypothetical protein	A0A2H5BLD0	Streptomyces_phage	2.3e-54	41.0
WP_058226532.1\|4704478_4704901_+	hypothetical protein	G9FH89	Rhodococcus_phage	8.0e-42	62.6
WP_156778963.1\|4704906_4705056_+	hypothetical protein	NA	NA	NA	NA
WP_065352277.1\|4705052_4705391_+	hypothetical protein	NA	NA	NA	NA
WP_065352278.1\|4705702_4706026_+	hypothetical protein	G9FH91	Rhodococcus_phage	2.1e-26	62.1
WP_065352279.1\|4706022_4706484_+	hypothetical protein	G9FH92	Rhodococcus_phage	4.6e-35	51.4
WP_065352280.1\|4706480_4707230_+	hypothetical protein	G9FH93	Rhodococcus_phage	3.1e-52	58.9
WP_156778964.1\|4707311_4708697_+	hypothetical protein	A0A1C9EI76	Rhodococcus_phage	4.7e-192	71.0
WP_065352282.1\|4708718_4709147_+	hypothetical protein	NA	NA	NA	NA
WP_065352283.1\|4709394_4709799_+	hypothetical protein	G9FH94	Rhodococcus_phage	1.8e-19	43.3
WP_065352284.1\|4709817_4714221_+\|tail	phage tail tape measure protein	A0A142K8Q7	Gordonia_phage	3.4e-82	26.3
WP_065352285.1\|4714217_4715027_+	hypothetical protein	A0A142K8Q8	Gordonia_phage	4.5e-49	38.9
WP_065352286.1\|4715027_4716608_+	hypothetical protein	A0A161BYK4	Gordonia_phage	6.8e-94	37.8
WP_065352287.1\|4716617_4717370_+	N-acetylmuramoyl-L-alanine amidase	Q9ZX49	Mycobacterium_phage	1.0e-68	64.8
WP_065352288.1\|4717369_4717633_+	hypothetical protein	NA	NA	NA	NA
WP_065352901.1\|4717638_4718025_+	hypothetical protein	A0A2H4PA22	Gordonia_phage	2.4e-32	50.0
WP_156778965.1\|4718021_4718387_+	hypothetical protein	A0A2H4P9V8	Gordonia_phage	2.2e-16	46.7
WP_065352290.1\|4718364_4720029_+	hypothetical protein	NA	NA	NA	NA
WP_065352291.1\|4720025_4720277_+	hypothetical protein	NA	NA	NA	NA
WP_065352292.1\|4720276_4720606_+	hypothetical protein	NA	NA	NA	NA
WP_065352293.1\|4720607_4720943_+	hypothetical protein	A0A222ZMD4	Mycobacterium_phage	3.6e-05	37.0

DBSCAN-SWA_2

4821133 : 4828695

Lactobacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_030534957.1\|4821133_4821700_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	4.3e-06	33.9
WP_065352355.1\|4821755_4822583_-	siderophore-interacting protein	NA	NA	NA	NA
WP_003944717.1\|4822874_4823105_+	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	1.1e-21	64.0
WP_003944767.1\|4823187_4823667_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A217ER62	Bacillus_phage	4.5e-09	30.1
WP_085989958.1\|4823648_4825808_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	1.5e-205	51.0
WP_003944723.1\|4825869_4826082_-	hypothetical protein	NA	NA	NA	NA
WP_085989609.1\|4826094_4826919_-	SPFH domain-containing protein	NA	NA	NA	NA
WP_003944744.1\|4827182_4828148_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A0N7CCA3	Skermania_phage	7.7e-157	86.8
WP_065352356.1\|4828221_4828695_-	NUDIX domain-containing protein	D0R7J3	Paenibacillus_phage	6.7e-13	31.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP015204

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1587 : 61198

Mycobacterium_phage(33.33%)

integrase,transposase,protease

attL 5632:5646|attR 61919:61933

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_030537258.1\|1587_1890_+\|transposase	transposase	NA	NA	NA	NA
WP_030537257.1\|1894_3520_+	peptidoglycan DD-metalloendopeptidase family protein	Q9ZX60	Mycobacterium_phage	5.6e-35	42.3
WP_030537256.1\|3596_4037_+	hypothetical protein	NA	NA	NA	NA
WP_030537255.1\|4137_4896_+	hypothetical protein	NA	NA	NA	NA
WP_065353031.1\|4897_7276_+	DNA topoisomerase III	A0A1V0SCS0	Indivirus	5.2e-05	21.3
5632:5646	attL	NA	NA	NA	NA
WP_030537253.1\|7367_8180_+	hypothetical protein	V5UQ48	Mycobacterium_phage	6.8e-05	34.0
WP_030537252.1\|8226_8811_+	nuclease	V5UN65	Mycobacterium_phage	4.1e-28	38.8
WP_051720907.1\|8810_9404_+	hypothetical protein	NA	NA	NA	NA
WP_051720905.1\|9473_11357_+	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_155277933.1\|12223_12784_-	hypothetical protein	NA	NA	NA	NA
WP_155277932.1\|12912_13335_-	hypothetical protein	NA	NA	NA	NA
WP_155277931.1\|13398_14151_-	hypothetical protein	NA	NA	NA	NA
WP_030537245.1\|14366_14570_+	hypothetical protein	NA	NA	NA	NA
WP_030537244.1\|14572_15304_+	hypothetical protein	NA	NA	NA	NA
WP_030537243.1\|15391_16180_-	hypothetical protein	NA	NA	NA	NA
WP_080712779.1\|16176_22899_-	relaxase domain-containing protein	NA	NA	NA	NA
WP_030537241.1\|22937_23399_+	hypothetical protein	NA	NA	NA	NA
WP_030537240.1\|23411_23912_+	hypothetical protein	A0A0U1UKV8	Pseudomonas_phage	3.8e-06	33.3
WP_030537239.1\|23936_24548_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_030537238.1\|24696_25116_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_030537237.1\|25214_25394_-	hypothetical protein	NA	NA	NA	NA
WP_080712783.1\|25548_25779_-	hypothetical protein	NA	NA	NA	NA
WP_051720899.1\|25820_26402_-	DNA helicase	NA	NA	NA	NA
WP_051720898.1\|26403_26715_-	hypothetical protein	NA	NA	NA	NA
WP_065353032.1\|26845_27793_-	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	7.3e-35	47.6
WP_065353033.1\|27964_29128_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	9.6e-29	33.1
WP_065353044.1\|29166_29514_+	DUF3024 domain-containing protein	NA	NA	NA	NA
WP_037127444.1\|29806_32572_-	class I SAM-dependent DNA methyltransferase	Q6NE04	Leptospira_phage	4.2e-155	40.7
WP_080712841.1\|32568_35757_-	NgoFVII family restriction endonuclease	A0A2K5B2B9	Erysipelothrix_phage	1.9e-39	26.6
WP_030538065.1\|36055_37933_+	AAA family ATPase	NA	NA	NA	NA
WP_083197730.1\|37875_39651_+	ATP-dependent helicase	A0A2H4GYC0	Pseudomonas_phage	8.7e-05	49.1
WP_156779023.1\|39712_40900_-	hypothetical protein	NA	NA	NA	NA
WP_065353036.1\|41910_42228_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_065353045.1\|42224_43304_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_065353037.1\|43428_43716_-	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	2.0e-20	65.3
WP_065353038.1\|43984_45499_-	hypothetical protein	A0A2H4PED4	Mycobacterium_phage	7.5e-58	35.2
WP_011331220.1\|45828_48864_+\|transposase	Tn3 family transposase	Q1MVP5	Enterobacteria_phage	7.0e-172	38.3
WP_011331219.1\|48990_49578_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_011331218.1\|49679_50546_+	CoA transferase	NA	NA	NA	NA
WP_065353039.1\|50542_51718_+	thiolase family protein	NA	NA	NA	NA
WP_011331216.1\|51725_53393_+	long-chain-fatty-acid--CoA ligase	NA	NA	NA	NA
WP_011331215.1\|53389_54178_+	2,3-dehydroadipyl-CoA hydratase	NA	NA	NA	NA
WP_011331214.1\|54186_55347_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_011331213.1\|55438_56197_+	3-hydroxyacyl-CoA dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	5.9e-11	32.2
WP_011331212.1\|56193_56694_+	MaoC family dehydratase	NA	NA	NA	NA
WP_011331211.1\|56715_57870_+	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_011331210.1\|57874_58636_+	enoyl-CoA hydratase	NA	NA	NA	NA
WP_011331209.1\|58664_60200_+	long-chain-fatty-acid--CoA ligase	Q75ZG1	Hepacivirus	1.8e-38	29.1
WP_011331207.1\|60571_61198_-\|integrase	site-specific integrase	NA	NA	NA	NA
61919:61933	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP015203

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP012749

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP015204

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection