CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP016544	Planococcus donghaensis strain DSM 22276 plasmid pPD76, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP016543	Planococcus donghaensis strain DSM 22276 chromosome, complete genome	1 crisprs	csa3,RT,cas3,DinG,DEDDh	0	0	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP016543_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016543_1

3066805-3066906

Orphan

Consensus_repeat	Method
AAAACTATGCAAAAATGCATAGTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP016543_1

>merge|NZ_CP016543|1|3066805-3066906|CRISPRCasFinder
AAAACTATGCAAAAATGCATAGTTTTTTAATATTTAAAGCTATAATACTGGTAAAAGCAATTAACATTGTAAGTAATAATAACTATGCAAAAATGCATAGTT

>NZ_CP016543|1|1|3066805-3066906|CRISPRCasFinder
AAAACTATGCAAAAATGCATAGTT	TTTTAATATTTAAAGCTATAATACTGGTAAAAGCAATTAACATTGTAAGTAATA
ATAACTATGCAAAAATGCATAGTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016543.2\|WP_065525150.1\|3075190_3076624_-\|sugar-kinase	unknown	unknown	gnl\|CDD\|212662
NZ_CP016543.2\|WP_065525154.1\|3069254_3070211_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224196
NZ_CP016543.2\|WP_065525163.1\|3057296_3058016_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|274729
NZ_CP016543.2\|WP_065525149.1\|3076643_3078131_-\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223354
NZ_CP016543.2\|WP_065525159.1\|3062928_3063285_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016543.2\|WP_065525158.1\|3063365_3064250_-\|polysaccharide-deacetylase	unknown	unknown	gnl\|CDD\|200563
NZ_CP016543.2\|WP_156851310.1\|3078181_3078976_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187605
NZ_CP016543.2\|WP_065527647.1\|3065891_3066686_-\|carbon-nitrogen-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|143587
NZ_CP016543.2\|WP_083394544.1\|3072899_3073619_-\|MurR/RpiR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224651
NZ_CP016543.2\|WP_065525157.1\|3064307_3065798_-\|cytosine-permease	unknown	unknown	gnl\|CDD\|271358
NZ_CP016543.2\|WP_065525153.1\|3070203_3071124_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP016543.2\|WP_065525151.1\|3073866_3075174_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NZ_CP016543.2\|WP_065525161.1\|3061051_3061636_-\|DJ-1/PfpI-family-protein	unknown	unknown	gnl\|CDD\|153229
NZ_CP016543.2\|WP_065525160.1\|3061912_3062932_-\|GTP-binding-protein	unknown	unknown	gnl\|CDD\|223597
NZ_CP016543.2\|WP_065525152.1\|3071353_3072883_+\|FAD-dependent-monooxygenase	unknown	unknown	gnl\|CDD\|235728
NZ_CP016543.2\|WP_065525155.1\|3068806_3069232_-\|DUF4064-domain-containing-protein	unknown	unknown	gnl\|CDD\|372544
NZ_CP016543.2\|WP_083394541.1\|3058690_3060976_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|236645
NZ_CP016543.2\|WP_065525162.1\|3058041_3058293_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016543.2\|WP_065525156.1\|3066922_3068593_-\|sigma-54-interacting-transcriptional-regulator	unknown	unknown	gnl\|CDD\|226350
NZ_CP016543.2\|WP_065525164.1\|3054562_3056941_-\|glycoside-hydrolase-family-65-protein	unknown	unknown	gnl\|CDD\|224471

Protein	Function_ID	Function_description	E-value
NZ_CP016543.2\|WP_065525150.1\|3075190_3076624_-\|sugar-kinase	gnl\|CDD\|212662	cd07779, FGGY_ygcE_like, uncharacterized ygcE-like proteins. This subfamily consists of uncharacterized hypothetical bacterial proteins with similarity to Escherichia coli sugar kinase ygcE , whose functional roles are not yet clear. Escherichia coli ygcE is recognized by this model, but is not present in the alignment as it contains a deletion relative to other members of the group. These proteins belong to the FGGY family of carbohydrate kinases, the monomers of which contain two large domains, which are separated by a deep cleft that forms the active site. This model includes both the N-terminal domain, which adopts a ribonuclease H-like fold, and the structurally related C-terminal domain.	3.7731e-107
NZ_CP016543.2\|WP_065525154.1\|3069254_3070211_-\|ABC-transporter-permease	gnl\|CDD\|224196	COG1277, NosY, ABC-type transport system involved in multi-copper enzyme maturation, permease component [General function prediction only].	1.13473e-17
NZ_CP016543.2\|WP_065525163.1\|3057296_3058016_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|274729	TIGR03695, menH_SHCHC, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase. This protein catalyzes the formation of SHCHC, or (1 R,6 R)-2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate, by elmination of pyruvate from 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate (SEPHCHC). Note that SHCHC synthase activity previously was attributed to MenD, which in fact is SEPHCHC synthase. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone].	5.50808e-22
NZ_CP016543.2\|WP_065525149.1\|3076643_3078131_-\|FAD-binding-oxidoreductase	gnl\|CDD\|223354	COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion].	1.49663e-67
NZ_CP016543.2\|WP_065525158.1\|3063365_3064250_-\|polysaccharide-deacetylase	gnl\|CDD\|200563	cd10938, CE4_HpPgdA_like, Catalytic domain of Helicobacter pylori peptidoglycan deacetylase (HpPgdA) and similar proteins. This family is represented by a peptidoglycan deacetylase (HP0310, HpPgdA) from the gram-negative pathogen Helicobacter pylori. HpPgdA has the ability to bind a metal ion at the active site and is responsible for a peptidoglycan modification that counteracts the host immune response. It functions as a homotetramer. The monomer is composed of a 7-stranded barrel with detectable sequence similarity to the 6-stranded barrel NodB homology domain of polysaccharide deacetylase (DCA)-like proteins in the CE4 superfamily, which removes N-linked or O-linked acetyl groups from cell wall polysaccharides. In contrast to typical NodB-like DCAs, HpPgdA does not exhibit a solvent-accessible polysaccharide binding groove, suggesting that the enzyme binds a small molecule at the active site.	1.10556e-138
NZ_CP016543.2\|WP_156851310.1\|3078181_3078976_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187605	cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs. Ga5DH catalyzes the NADP-dependent conversion of carbon source D-gluconate and 5-keto-D-gluconate. This SDR subgroup has a classical Gly-rich NAD(P)-binding motif and a conserved active site tetrad pattern. However, it has been proposed that Arg104 (Streptococcus suis Ga5DH numbering), as well as an active site Ca2+, play a critical role in catalysis. In addition to Ga5DHs this subgroup contains Erwinia chrysanthemi KduD which is involved in pectin degradation, and is a putative 2,5-diketo-3-deoxygluconate dehydrogenase. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107,15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	9.89616e-118
NZ_CP016543.2\|WP_065527647.1\|3065891_3066686_-\|carbon-nitrogen-hydrolase-family-protein	gnl\|CDD\|143587	cd07197, nitrilase, Nitrilase superfamily, including nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes. This superfamily (also known as the C-N hydrolase superfamily) contains hydrolases that break carbon-nitrogen bonds; it includes nitrilases, cyanide dihydratases, aliphatic amidases, N-terminal amidases, beta-ureidopropionases, biotinidases, pantotheinase, N-carbamyl-D-amino acid amidohydrolases, the glutaminase domain of glutamine-dependent NAD+ synthetase, apolipoprotein N-acyltransferases, and N-carbamoylputrescine amidohydrolases, among others. These enzymes depend on a Glu-Lys-Cys catalytic triad, and work through a thiol acylenzyme intermediate. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer. These oligomers include dimers, tetramers, hexamers, octamers, tetradecamers, octadecamers, as well as variable length helical arrangements and homo-oligomeric spirals. These proteins have roles in vitamin and co-enzyme metabolism, in detoxifying small molecules, in the synthesis of signaling molecules, and in the post-translational modification of proteins. They are used industrially, as biocatalysts in the fine chemical and pharmaceutical industry, in cyanide remediation, and in the treatment of toxic effluent. This superfamily has been classified previously in the literature, based on global and structure-based sequence analysis, into thirteen different enzyme classes (referred to as 1-13). This hierarchy includes those thirteen classes and a few additional subfamilies. A putative distant relative, the plasmid-borne TraB family, has not been included in the hierarchy.	2.33163e-90
NZ_CP016543.2\|WP_083394544.1\|3072899_3073619_-\|MurR/RpiR-family-transcriptional-regulator	gnl\|CDD\|224651	COG1737, RpiR, Transcriptional regulators [Transcription].	1.9927e-22
NZ_CP016543.2\|WP_065525157.1\|3064307_3065798_-\|cytosine-permease	gnl\|CDD\|271358	cd10323, SLC-NCS1sbd, nucleobase-cation-symport-1 (NCS1) transporters; solute-binding domain. NCS1s are essential components of salvage pathways for nucleobases and related metabolites; their known substrates include allantoin, uracil, thiamine, and nicotinamide riboside. This family includes Microbacterium liquefaciens Mhp1, a transporter that mediates the uptake of indolyl methyl- and benzyl-hydantoins as part of a metabolic salvage pathway for their conversion to amino acids. It also includes various Saccharomyces cerevisiae transporters: Fcy21p (Purine-cytosine permease), vitamin B6 transporter Tpn1, nicotinamide riboside transporter 1 (Nrt1p, also called Thi71p), Dal4p (allantoin permease), Fui1p (uridine permease), and Fur4p (uracil permease). Mhp1 has 12 transmembrane (TM) helices (an inverted topology repeat: TMs1-5 and TMs6-10, and TMs11-12; TMs numbered to conform to the solute carrier 6 family Aquifex aeolicus LeuT). NCS1s belong to a superfamily which also contains the solute carrier 5 family sodium/glucose transporters (SLC5s), and SLC6 neurotransmitter transporters.	2.57258e-131
NZ_CP016543.2\|WP_065525153.1\|3070203_3071124_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	1.58032e-92
NZ_CP016543.2\|WP_065525151.1\|3073866_3075174_-\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.50769e-19
NZ_CP016543.2\|WP_065525161.1\|3061051_3061636_-\|DJ-1/PfpI-family-protein	gnl\|CDD\|153229	cd03135, GATase1_DJ-1, Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1. Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1. DJ-1 is involved in multiple physiological processes including cancer, Parkinson's disease and male fertility. It is unclear how DJ-1 functions in these. DJ-1 has been shown to possess chaperone activity. DJ-1 is preferentially expressed in the testis and moderately in other tissues; it is induced together with genes involved in oxidative stress response. The Drosophila homologue (DJ-1A) plays an essential role in oxidative stress response and neuronal maintenance. Inhibition of DJ-1A function through RNAi, results in the cellular accumulation of reactive oxygen species, organismal hypersensitivity to oxidative stress, and dysfunction and degeneration of dopaminergic and photoreceptor neurons. DJ-1 has lacks enzymatic activity and the catalytic triad of typical GATase1 domains, however it does contain the highly conserved cysteine located at the nucelophile elbow region typical of these domains. This cysteine been proposed to be a site of regulation of DJ-1 activity by oxidation. DJ-1 is a dimeric enzyme.	6.03568e-49
NZ_CP016543.2\|WP_065525160.1\|3061912_3062932_-\|GTP-binding-protein	gnl\|CDD\|223597	COG0523, COG0523, Putative GTPases (G3E family) [General function prediction only].	9.32108e-82
NZ_CP016543.2\|WP_065525152.1\|3071353_3072883_+\|FAD-dependent-monooxygenase	gnl\|CDD\|235728	PRK06184, PRK06184, hypothetical protein; Provisional.	3.16337e-72
NZ_CP016543.2\|WP_065525155.1\|3068806_3069232_-\|DUF4064-domain-containing-protein	gnl\|CDD\|372544	pfam13273, DUF4064, Protein of unknown function (DUF4064).	3.40832e-07
NZ_CP016543.2\|WP_083394541.1\|3058690_3060976_+\|EAL-domain-containing-protein	gnl\|CDD\|236645	PRK10060, PRK10060, cyclic di-GMP phosphodiesterase.	3.52154e-118
NZ_CP016543.2\|WP_065525164.1\|3054562_3056941_-\|glycoside-hydrolase-family-65-protein	gnl\|CDD\|224471	COG1554, ATH1, Trehalose and maltose hydrolases (possible phosphorylases) [Carbohydrate transport and metabolism].	0
NZ_CP016543.2\|WP_065525156.1\|3066922_3068593_-\|sigma-54-interacting-transcriptional-regulator	gnl\|CDD\|226350	COG3829, RocR, Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms].	7.52885e-119

>NZ_CP016543.2|WP_065527647.1|3065891_3066686_-|carbon-nitrogen-hydrolase-family-protein
MNAIPYDLQGNLEEAKKLIEVAVQKNAKLVVLPELFNTGYRVEDKDVELAETIPGYTINWMEQIAKQHNIYLSTAILEKGDVQGIVYDTAILVGPEGLIGNYRKTHLWNVENIRFAKGDNLPVFKTSIGNIGLQICYEIGFPEGARILALKGADIILYPSAFGKARRYAWDIATRARALENGVFVIASNRTGIEKGETVFGGGSAIIDPFGTVLVYTEEERDVIISEIDLNQVTEQRRTLPYLRDLNKTLFTQELQQIQKSSYE
>NZ_CP016543.2|WP_065525157.1|3064307_3065798_-|cytosine-permease
MRKNSLISKDIIPTKGKNRVISGWGFFNIWVGMAVIIATFQIGANGIESMSLWQLAGAILLANLIIAIIGSLSGDIGIEHGLSFAAYMRAPFGTAGVHIPAISRGIIAAIWFGIQTYLGATAINYIVNMLTGFDSWFVWYLVFAAVQIINTAIGIKAVDRFAAIAAPAIIVISVWIFIDMVGLAADNGINVFNYVGTTQSTTWFLVMVANMGFWSALAVDIPNITRYVKAPMNERNWFKRNKNNYLPHIIALPLVQTFMGVIGAVSLLGAGLWNPIEVIQATSSGWVLIILLTMVVLAQWSTNSAANLIPASLTFVNAGAKFNLSYTSGIVIAGVVGTLFQPWSILNQLFTFLGYYGAILSAVAGIIICDYYIIRKRRLAVQDLYDPKGQFRFDKGVNWAGMIAWIAAGGLAVYFIQYMYLVGFPLGIIFYYLLMKFWYLKKHPQKEVESNYSDAYLGTTVGRDWEVEGLVEEQPNSKGDWEIDKLNPATNDVVKP
>NZ_CP016543.2|WP_065525158.1|3063365_3064250_-|polysaccharide-deacetylase
MAKKEILVAYGVDVDAVAGWLGSYGGEDSPDDISRGLFAGEIGAPRLLDLFDKYNLKTTWFIPGHSIETFPEQMKDVHTRGHEIGIHGYSHENPIAMTAQQEEAVLLKSITLVEELTGKKPTGYVAPWWEFSNITNELLHKNGIKYDHSLMHNDFSPYYVRIGDSWTKIDYSKSAEEWMKPLVRGKETSLIEIPANWYLDDLPPMMFIKKSPNSHGFVNPRDIEQMWMDQFDWVYENMDHAVFTMTIHPDVSGRPQVLKMHERIIEHINKHEGIKWVTFDEIADDFAKRNPFKG
>NZ_CP016543.2|WP_065525159.1|3062928_3063285_-|hypothetical-protein
MCILCGEFVMQIHWTDQTSNDDDEILVGDLQRSRHRTRLQRAKLSNKILHYYRLKLEDWNSSKFVLRDLKGNQEIVHDLGALWGTAEKMIGRPVNPLDPHLLQQIEEEQRQLLGAEQS
>NZ_CP016543.2|WP_065525160.1|3061912_3062932_-|GTP-binding-protein
MIKTNKKPITIITGCLGSGKTTLLRELLKEPQLQNNTAVIVNEFGKVGLDHHLLKKADEKTTLLKGGCICCNNREDLENELKSFLSMDHNKEAAINRIVIETTGMADPAPILFTILTNPLLQHHYYIDSVVVTVDTKNGMLHMKNNPELIKQVIVADKIVLTKTDISTTTEKEMLIQQLKRINPSCEILEAVHGNIDFDDLKGDYRQLSRTVAEKEIPDLESKNHYSSTIQSISFTFHNPLDWTAFGLWLSALLHANGEDILRVKGLLDVGEEGPIVLNGVQHIIHPPEHLDTWPEEEHHSHLVFILRTIQPSEIERSLKAFQYFLGTNIDVLELNAAL
>NZ_CP016543.2|WP_065525161.1|3061051_3061636_-|DJ-1/PfpI-family-protein
MTKILLLLANGFEASEASVFTDVLGWNKWEGDGSTDVVTVGKHPQLQCTWNFQVIPEQQLSDISLEEFDALAIPGGFEEAGFYEDAFSEEFQEVVRYFDAHKKPIASICVAALMVAHSGVLKNKRATTYDHPTSKRRDQLKQYGVQVMDQRIVCEDHIITSANPGTAFDVAFRLLEMVTSKENKDKVKELMGFA
>NZ_CP016543.2|WP_083394541.1|3058690_3060976_+|EAL-domain-containing-protein
MENLISWLAPIVAFVTLFIVYRKSVGRLRLFWLLLSLGCLSYAIAEGIWVYSYNISHVEPNYPGWPDPFYFLQIFFYLAAFIYHLMQKKENAYQIKFIFDMMIIIAVSTALSWHFLIQLLLPDATASPLLFVVSIGYPVGDLLLLFGAVSLYIGYSYTLSPRVLILIIAGLVFQVFADTAYLYSTVANTYSAESFYNPLWSLSLLLVAFSGLYSLDPIKKSVSGKTFMHITDRISVRMLLPYFSLLMLFIVIIVEESKHTRGLVAGAFVATALIVTRQIFTLRDNRRLLFNYDQLTSELEEKIAQRTVEVTSKNQQLEKVIHQVEHIAYHDELTGLPNRRLFLKNLESSIATADESGKKLAVVFIDLDRFKNINDTFGHEFGDLLLQDFSRKISENLRSVDTISRQGGDEFTLILNNIQDEADITPTIHRIQAAFQQALSIKDQELHVSMSIGIAIYPDNGTSTSELLKHADSAMYSAKAKGKNNYQFFSDDMSLVVSRKIALENELRRALANEEFLLHYQPQFNAHTREITGMEALVRWQTAEDEIISPAHFIPLAEETRLILPLGEWVLNTACEQAKLWHDRGHHHLKLAVNLSPLQFLDDDLLDMVERTLEKTGFPASSLELEITENVAVDDIDLALLRMQALKDLGVNLAIDDFGTGYCSLSYLKKFPLTNLKIAQSFVRDMATNPHDEALVEAMVLIGHKLNMSVIAEGVETEEQLALLKELGCDEIQGYLFSKPLTTDHFSQLLSKELASKNPIH
>NZ_CP016543.2|WP_065525162.1|3058041_3058293_-|hypothetical-protein
MKRKAAVAIGFALIVSIILSFTIGMTFGKGQNPGIANEEHRYEFISANENNLIIFDKKTGEYWNKFIPSNEGPMDWEKGDLPI
>NZ_CP016543.2|WP_065525163.1|3057296_3058016_-|alpha/beta-fold-hydrolase
MILHTEQVGSGEPIVFLHTGLQAGTTDFEYQREYFKSSFQIILPDLRGHGKSINNNLSNFFEDSAVDLSHTLDAEGVESAHIVGASLGALVGLFFAKRFPEKVKSLTLSGITPEKPEDWLEMHKQEVRFQTELLENNEAIAYFDQLHLSDWKHLLDVVRNSEWYPFGETKDLTDIKSPILLIVGEGNPNETKGAITYPLMQDNVHVSIIPFASHLVHSEQPKLYSEILNLFLRQIMESD
>NZ_CP016543.2|WP_065525164.1|3054562_3056941_-|glycoside-hydrolase-family-65-protein
MINYSVGTGDLKNWIVAETDFSADVLGKSEAIMMLGNGYMGLRSATEEPYIQEKRNLFINGTFNKSQENEVTELPNAADFTQLDIRVDGERFSLEFGETNEYIKQLNLKTAELTRSFVWESPKKKKLQFKFSRFVSLNNMHLIAMKVEVESLSHSVAISFDSGINGQMTNSGAQHFLEGERRILDERFIQLSQKTSESDVEMVFNTVHHFRFNGEPTLPVADKDMQRRKVWMAYEFYLEPNDKLEMEKLSTVHTSRDQVVEQNSMDFEQLRQLSIEELKQYEEKGYDVLFKEHVKAWHDQVWKNYNFKVESDHAFDQLALRFSLYHLTAMQPPSGYEHLGVGAKAMSGEGYKGHTFWDLEIFILPFFIYSNPTAAKSLLTYRYHGLAGARKKAEENGYAGAMYPWEMAWPEDGETTPIWGDIDIVTGAQSKIWSGFIEQHISADIAFAVYQYEQVTGDKEFMERCGYEMIFETAKFWSSRLEWNEERERYEIHNVIGPDEYKEHVSNNAFTNYMAYFNLKLAERYAEQLSAQNPQFLETFDLGDANLDWKTKAEKLYLPEPRTTDLIIPQDDTYLQLPEIDLAKYKNQSKVRMIYRDYNSEQINGIQVTKQADTLLLFYLLEQTFLQQDSRLSSAVKQENYQFYEPRTLHDSSLSLAVHAVIANDLGESDTAYSLFRKACEIDLGEQMNTSDDGIHAAAIGGIWTSAVFGFGGVRFSESTLQINPRLPKQWRRMQFAICWQGTALTLEITHQSLKVTAYDGAVTFETDGKTYHIQNGEIEIQIGREIEINSH
>NZ_CP016543.2|WP_065525156.1|3066922_3068593_-|sigma-54-interacting-transcriptional-regulator
MNNHSQLIDLIPMGLIFFDRDYKITQLNKFAERKLYCNKAEVIGRYWDGVFPRLFSEELRDEETEIFQFKFAEESFVAKKSLYFLNEDSGFSLFFQTKSSLEEFTQELDSYQDLVLDLKTIFDTSYDVIYVSDGEGKTLRVSAACEALWGYKESDLIGKTVYQLEEEGVFKPSVTRLVLEKKEKVSFIQTTKTGRRLMVVGTPVKDNEGNVIRVINASRDVTEVKELESEVDLLRQMTEGYRQEIEEFRAREEIEKEIISRSEKMKSIVSFSQKIAKVDSPVLLLGESGVGKEVIATFIHKWSNRNNHPFITLNCGSMPSAILEAELFGYENKESKMGLIEMANSGTLFLEQIEEMPMSTQIKFLKALQGKGNKVKTSNIRIITASSKNLRKKVEEGGFREDLYYLLNVVPITIPPLRERNEDIIPLIIHFTDQLNQKYGEEKKFQPRVLRKLQEYSWPGNVQEMQNIIERLFVTSEGGLIELEDLPEYINVDNISEKSISINKIMPLKEAVELLEKELLEMAEKKYGSTTKVAEVLKVNQSTISRKLQKYTKERI
>NZ_CP016543.2|WP_065525155.1|3068806_3069232_-|DUF4064-domain-containing-protein
MKRTAEMVLAIIGVLGYVFTAGIGSLMIWLQNNRGVMEESFNEMAAENPEMGMGDFDEMLDMLGTGGWFLTVSSVVAIILGIVAMVLLKGNKKPVVAGIILIATAVIVAFVSGGAGVLAGIFYLIAGVMALVRKPKTVIEG
>NZ_CP016543.2|WP_065525154.1|3069254_3070211_-|ABC-transporter-permease
MSNFMNLIWNEQIKLYAQKSTWVMFIVILAIAIGGGLLTKFMGEEADFKEYGDNWRTELQEENAQLLAEMENDEFIQSINQPMIEENNYYLENDIKPAPYDGWEYVLENSVLSSLISLFTIVVAAGIISNEFKWGTIKLLLIRPISRTKILFSKYLSVLVFALTLLLFLLVTSWMTGTVLFGLNGWNPSLVQRQIEGFVQVGVFGEIVEAYGYSLVTLVMMATFAFMISAIFRSSGMAIGLAIFLMMAGNTIVVFFAQYDWAKYILFANTNLKQYVAGGMPINEDMTLTFSVVVLLVYFVVFLGAAWTAFTKRDIAGQ
>NZ_CP016543.2|WP_065525153.1|3070203_3071124_-|ABC-transporter-ATP-binding-protein
MSKPAMQLVKLKKTIGKKPIIKGLDFEIQAGEVFGFLGPNGAGKTTTIRMMVGLIDITDGDVLIEGKSIKTDFKNAIQHVGAIVENPETYPFLSGWKNLQQYARMVDGVTEARMNEVVSLVGLGNAIHEKAGRYSLGMRQRLGIAQALLHRPSILILDEPTNGLDPSGIREIRKYIRNLAEKENVAVIVSSHLLSEIELMCDRIGIIKNGELVAIENVQSVETEESLQEVYIEAEPLAPAKTYLETQLANKIGVTAKELSLSVKREEIPAILKKLVEQGISIYGVRVLQATLEDKFFDLIGENTIE
>NZ_CP016543.2|WP_065525152.1|3071353_3072883_+|FAD-dependent-monooxygenase
MKPQILIVGAGPTGLALAHSLATQGVPFRIIEKNSGTGKASRALAVHARILEHYQQLGLSERLVSRGQPILSLDLSDGKEVKANLKFNDFGKGLSPFPFILSLPQDEQEEMLVDELKKIGVEIEWGTELSSFADNGDSVTAVLKKEGLPEESADFEYLCGCDGASSMVRKGMEFEFPGGTYEQLFFVADVETEKLEEKMEKMDMYMDDDGFMLYMSVRNARTKRILGVVPEEFNDQKGIEYRHISEYIEDKIRVKASIVNWFSTYRVHNRVSEHFSKGRIFILGDAGHLHSPAGGQGMNTGIGDAINLSWKLAAVCQGKAAPSLLDTYELERIGFARKLIATTDKAFQTIINQHLRGTLLRKVIVPHILPSMFKLAFVKKNGFKILSQIHINYRDSPISKGKAGKVYGGMRLPWIQTAGRDNFTPLQSVDWQIHVYGKASKELIDFARSHSFELHEFAWEPAMQKAGFHQNALYFIRPDGHVALANKTQDVGVLKGYIDEFEFAAFRAQ
>NZ_CP016543.2|WP_083394544.1|3072899_3073619_-|MurR/RpiR-family-transcriptional-regulator
MIKLVTDNLTKLEEEVHAKLSTTVSTNNKLKIIEAAKICEVSPSKISKMVRKLGFHNFKQYKLYCSGQEINLDQQQKSSEIERLIRFLENFDSEIIDDFVSVFQKYDKVIIFGLGPSYISAEYFAYKLATVSDKNVTVTQSEDFAERLLDENTLLIVLSVTGKFSSFDPLFEKAKENGASIMLILEEYMNTLGSIADYVFYLSEFNQDANLLPFEKTRTVFFIVIEEIITRLTNLENSN
>NZ_CP016543.2|WP_065525151.1|3073866_3075174_-|MFS-transporter
MQSTKFKRYFQFLLIVLAAGAIFPLIYLRTNYQETILEVYGMTLPQLNTIFSVLGLAFIVGYFPSGWISDRFSSKKLISISLLFVGLAGLWFAQVPSYPIVILIFVIWGIFSVLTFWSAHLKLVKLISRREEEGRFFGILDGGRGVIEAVLASVAIFIFSRILGSSTAVADKQEALVNVIYMYSGVLILVSILIMLFVSVDDKSAPPKKDKKEKNKSVANVDAIKQVFSNRFVWLLGGIIFMSYIVTWTIYYFGGFLQTNVGVNVSIVGTVTVVMLWMRPVGGIAGGFLGDKFGKSNVLMIALASASGLLILISVLPTTLPAYFFYVLVILSGLAVYTIRGLYWSLLGDCNIADERLGLSIGLISFVGYLPDILLPLVMSFMISSFGDAGGYNAYFLFSALAGVLGVTVTVIFKLGVTKKVEIPVPDQVTAQPVD
>NZ_CP016543.2|WP_065525150.1|3075190_3076624_-|sugar-kinase
MTDRYIMGIDNGSQSSKVAIFDLEGNEVAFGSCALRETLTPEPGVVIHPDNDLWDSVYIGIKNCLENFQGDPKAIEGIGLCTIRCCRVLLQENGDLAHPVLSWMDVRLFKPYEHQDDQVKFVTTTSGYLGLKLTGEYNDTAGNCELYWPLDRETWDWSTDDEVMKANGVTRDMLFNLVKPGEKLGSLRKELAAEFGLKKGVPVIATSNDKAVEALGSGLDNEQAIMISLGTFISAMVVRDEDYENANNFFPTLASVPFKFVYESIGIRRGLWTVSWFKKLIGEELVAEASKIGVSEEEYLNRKAQEVPVGSDGLITILDWLASSGQPYRKGIMIGFDQRHSRYHIYRSILEAIAFNIKNNIEDMTEEINLELDQVIVIGGGSKSDVLMQIISDLFGLPVHRRKGSSSACLGAAICVATYLSIYDDFSAAITKMVETEKTFLPDSKNHAFYTDLNNTVVKNVRTHTDNILKLTYPIFK
>NZ_CP016543.2|WP_065525149.1|3076643_3078131_-|FAD-binding-oxidoreductase
MYTLTHSQVIEDLTALLSADQIVTNAEALYDASADRYKKYAKTKNALNVPAPVAIVFPLSTDEVKSLLMYCNDNDINVIPRSGKTGTEGGLENWKETSIVIDGSKMNNIIKIDTYNMQATVQTGVKLQKLEDELRELGYTTGHSPQSKPVAQFGGLVATRSIGQFSTLYGAIEDMVVGLECVFPEGQVSKIKNVPRRAGGPDIRHIAIGNEGALCYITEVTVKIFKYTPENNEFHGYLIKDVDTGIKILREVMVNGYRPSVARVYSEEDARQHFGNFYNEKCVLIFTTEGAKGLVKATNEGINEAIEKFQEGIIEKVDSSLIETWFNNLNWDESRIQKEIQDMIDHNSHDGYTTEISADWENVVKIYHNVISRIKNEFDRADDLTMLGGHSSHSYLNGTNMYFVYNYTINCAPEDELLTYHHPIHEIIIEETLKLGGSMCHHHGIGKYRSEWTKEEHGSAYYMLEKLKEVFDPKGIMNHGTIFPQPNEVKKYIRG
>NZ_CP016543.2|WP_156851310.1|3078181_3078976_-|SDR-family-NAD(P)-dependent-oxidoreductase
MSIENNKITDFNMNFFSLKGKVAIITGGNSGLGQGFALALAKAGANIFAVSMAEDNNVTKELIEAEGVKFHLMISDITKDGACKQVVDECLETFGKIDILINNAGIGINVKDVTQFTRFQWDKMVSVNLTAPFELSHEVAKHMIPQQSGKIINTCSLFSYLGGQWSPAYAATKHGLAGFTKAYCDELAQFNIQVNGIAPGYFATDVTKETRANPESNQRVLDHIPANRWGDIQDLMGTIVFLASNASNYVNGSLVNVDGGYLVR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

868002 : 877772

Synechococcus_phage(37.5%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008432195.1\|868002_869298_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	4.2e-17	31.5
WP_065526996.1\|869314_870031_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A1D7SCX8	Cyanophage	2.0e-45	42.4
WP_065526995.1\|870027_870282_+	phosphoribosylformylglycinamidine synthase subunit PurS	M4QPE7	Synechococcus_phage	1.6e-05	35.4
WP_065526994.1\|870278_870962_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_065526993.1\|870945_873171_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.6e-165	42.1
WP_065526992.1\|873146_874568_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-52	33.5
WP_065526991.1\|874580_875642_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.3e-61	45.2
WP_065526990.1\|875631_876204_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.7e-23	34.6
WP_065526989.1\|876236_877772_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.3e-76	51.3

DBSCAN-SWA_2

1159192 : 1166056

Staphylococcus_phage(71.43%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_156851264.1\|1159192_1160540_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.5e-89	61.6
WP_065526764.1\|1160564_1160801_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	4.3e-21	65.2
WP_065526763.1\|1160908_1161355_+	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	4.1e-44	59.6
WP_065526762.1\|1161421_1161880_+	nucleoside triphosphatase YtkD	A0A2H4PQM4	Staphylococcus_phage	6.5e-21	37.7
WP_065526761.1\|1161860_1162640_+	S9 family peptidase	A0A2H4PQM6	Staphylococcus_phage	5.1e-34	35.5
WP_065526760.1\|1162683_1164273_-	phosphoenolpyruvate carboxykinase (ATP)	A0A2H4PQN1	Staphylococcus_phage	8.1e-188	62.4
WP_065526759.1\|1164859_1166056_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	2.9e-161	76.1

DBSCAN-SWA_3

2866062 : 2874408

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_083394579.1\|2866062_2867430_-	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	1.7e-21	31.5
WP_065525336.1\|2867458_2868139_-	response regulator transcription factor	W8CYM9	Bacillus_phage	2.2e-41	40.4
WP_065525335.1\|2868243_2869257_-	50S ribosome-binding GTPase	NA	NA	NA	NA
WP_065525334.1\|2869327_2871145_-	LTA synthase family protein	W6LM83	Streptococcus_phage	7.2e-15	21.5
WP_065525333.1\|2871313_2871937_+	flavodoxin family protein	NA	NA	NA	NA
WP_065525332.1\|2871987_2872518_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_065525331.1\|2872653_2873118_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.3e-45	59.2
WP_083394533.1\|2873140_2873761_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	5.6e-60	57.1
WP_065525330.1\|2873778_2874408_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.7e-40	46.4

DBSCAN-SWA_4

3151383 : 3159734

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065525092.1\|3151383_3152127_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	4.6e-16	32.4
WP_065525091.1\|3152275_3154021_-	aminodeoxychorismate synthase component I	A0A0B5J984	Pandoravirus	6.5e-45	29.3
WP_065525090.1\|3153995_3154619_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	7.4e-44	46.3
WP_065525089.1\|3154796_3155144_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_065525088.1\|3155166_3155574_-	DUF1259 domain-containing protein	NA	NA	NA	NA
WP_065525087.1\|3155965_3156409_-	flavodoxin domain-containing protein	A7KUZ7	Bacillus_phage	3.5e-16	38.3
WP_065525086.1\|3156389_3157436_-	ribonucleotide-diphosphate reductase subunit beta	A7KUZ8	Bacillus_phage	3.3e-113	60.5
WP_083394548.1\|3157448_3159734_-	ribonucleoside-diphosphate reductase subunit alpha	A7KUZ9	Bacillus_phage	3.3e-283	62.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage