CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP016417	Vibrio scophthalmi strain VS-05 plasmid pVS8, complete sequence	0 crisprs	NA	0
NZ_CP016414	Vibrio scophthalmi strain VS-05 chromosome 1, complete sequence	1 crisprs	DEDDh,DinG,cas3,RT,csx1,csa3	2
NZ_CP016416	Vibrio scophthalmi strain VS-05 plasmid pVS127, complete sequence	0 crisprs	NA	1
NZ_CP016415	Vibrio scophthalmi strain VS-05 chromosome 2, complete sequence	0 crisprs	DEDDh,WYL,cas3,csa3	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP016414_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016414_1

1687669-1687744

Orphan

Consensus_repeat	Method
AAAAGCAAAAGCGAGATTCCCTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP016414_1

>merge|NZ_CP016414|1|1687669-1687744|CRISPRCasFinder
AAAAGCAAAAGCGAGATTCCCTTCTTCAAGGGAATGACTATTTAGAGCACACTAAAAGCAAAAGCGAGATCCCCTT

>NZ_CP016414|1|1|1687669-1687744|CRISPRCasFinder
AAAAGCAAAAGCGAGATTCCCTT	CTTCAAGGGAATGACTATTTAGAGCACACT
AAAAGCAAAAGCGAGATCCCCTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016414.1\|WP_005596535.1\|1694386_1694710_-\|ferredoxin-family-protein	unknown	unknown	gnl\|CDD\|378771
NZ_CP016414.1\|WP_065545405.1\|1693525_1694260_+\|RNA-methyltransferase	unknown	unknown	gnl\|CDD\|349982
NZ_CP016414.1\|WP_065545402.1\|1688388_1689099_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016414.1\|WP_065545404.1\|1692024_1693203_-\|flavohemoglobin-expression-modulating-QEGLA-motif-protein	unknown	unknown	gnl\|CDD\|274125
NZ_CP016414.1\|WP_065545406.1\|1696749_1697250_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368044
NZ_CP016414.1\|WP_065545397.1\|1678445_1679027_-\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|225158
NZ_CP016414.1\|WP_065545401.1\|1683544_1683787_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016414.1\|WP_065545976.1\|1687108_1687447_-\|cytosolic-protein	unknown	unknown	unknown
NZ_CP016414.1\|WP_005596531.1\|1697485_1698070_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|276809
NZ_CP016414.1\|WP_065545398.1\|1681074_1681659_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016414.1\|WP_065545399.1\|1681684_1682035_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016414.1\|WP_005596549.1\|1679655_1680942_+\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|223587
NZ_CP016414.1\|WP_065545403.1\|1689224_1690115_-\|leucine-rich-repeat-domain-containing-protein	unknown	unknown	gnl\|CDD\|372554
NZ_CP016414.1\|WP_005596542.1\|1683903_1684398_+\|YcxB-family-protein	unknown	unknown	gnl\|CDD\|379553
NZ_CP016414.1\|WP_005596551.1\|1679089_1679440_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133397
NZ_CP016414.1\|WP_005596530.1\|1698277_1698781_+\|peptide-deformylase	unknown	unknown	gnl\|CDD\|237227
NZ_CP016414.1\|WP_032073033.1\|1690283_1691492_+\|IS4-family-transposase	unknown	unknown	gnl\|CDD\|376573
NZ_CP016414.1\|WP_065545396.1\|1677272_1678271_-\|FUSC-family-protein	unknown	unknown	gnl\|CDD\|379231
NZ_CP016414.1\|WP_009386958.1\|1694952_1696569_+\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|225307
NZ_CP016414.1\|WP_083163398.1\|1682332_1683358_+\|transporter-substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270218

Protein	Function_ID	Function_description	E-value
NZ_CP016414.1\|WP_005596535.1\|1694386_1694710_-\|ferredoxin-family-protein	gnl\|CDD\|378771	pfam11953, DUF3470, Domain of unknown function (DUF3470). This presumed domain is functionally uncharacterized. This domain is found in bacteria. This domain is about 50 amino acids in length. This domain is found associated with pfam00037. This domain has a single completely conserved residue N that may be functionally important.	1.1342e-20
NZ_CP016414.1\|WP_032073033.1\|1690283_1691492_+\|IS4-family-transposase	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	8.90514e-11
NZ_CP016414.1\|WP_065545404.1\|1692024_1693203_-\|flavohemoglobin-expression-modulating-QEGLA-motif-protein	gnl\|CDD\|274125	TIGR02421, conserved_hypothetical_protein, conserved hypothetical protein. Members of this family include a possible metal-binding motif HEXXXH and, nearby, a perfectly conserved motif QEGLA. All members belong to the Proteobacteria, including Agrobacterium tumefaciens and several species of Vibrio and Pseudomonas, and are found in only one copy per chromosome (Vibrio vulnificus, with two chromosomes, has two). The function is unknown.	3.28702e-124
NZ_CP016414.1\|WP_065545406.1\|1696749_1697250_+\|hypothetical-protein	gnl\|CDD\|368044	pfam04664, OGFr_N, Opioid growth factor receptor (OGFr) conserved region. Opioid peptides act as growth factors in neural and non-neural cells and tissues, in addition to serving in neurotransmission/neuromodulation in the nervous system. The Opioid growth factor receptor is an integral membrane protein associated with the nucleus. The conserved region is situated at the N-terminus of the member proteins with a series of imperfect repeats lying immediately to its C-terminus.	3.65463e-11
NZ_CP016414.1\|WP_005596542.1\|1683903_1684398_+\|YcxB-family-protein	gnl\|CDD\|379553	pfam14317, YcxB, YcxB-like protein. The YcxB-like protein family includes the B. subtilis YcxB protein, which is a functionally uncharacterized transmembrane protein. This family of proteins is found in bacteria, and is approximately 60 amino acids in length.	1.30462e-05
NZ_CP016414.1\|WP_005596531.1\|1697485_1698070_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	2.51735e-09
NZ_CP016414.1\|WP_005596551.1\|1679089_1679440_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133397	cd04769, HTH_MerR2, Helix-Turn-Helix DNA binding domain of MerR2-like transcription regulators. Helix-turn-helix (HTH) transcription regulator MerR2 and related proteins. MerR2 in Bacillus cereus RC607 regulates resistance to organomercurials. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	7.02161e-29
NZ_CP016414.1\|WP_005596549.1\|1679655_1680942_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|223587	COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis].	1.40702e-148
NZ_CP016414.1\|WP_083163398.1\|1682332_1683358_+\|transporter-substrate-binding-domain-containing-protein	gnl\|CDD\|270218	cd00997, PBP2_GluR0, Bacterial GluR0 ligand-binding domain; the type 2 periplasmic binding protein fold. Glutamate receptor domain GluR0. These domains are found in the GluR0 proteins that have been shown to function as prokaryotic L-glutamate activated potassium channels, also known ionotropic glutamate receptors or iGluRs. In addition to two ligand binding core domains, iGluRs typically have a channel-like domain inserted in the middle of the GluR-like domain. The GluR0 proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.12916e-18
NZ_CP016414.1\|WP_065545397.1\|1678445_1679027_-\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|225158	COG2249, MdaB, Putative NADPH-quinone reductase (modulator of drug activity B) [General function prediction only].	3.95781e-39
NZ_CP016414.1\|WP_065545405.1\|1693525_1694260_+\|RNA-methyltransferase	gnl\|CDD\|349982	cd18109, SpoU-like_RNA-MTase, SAM-dependent RNA methylase related to SpoU-TrmH. RNA 2'-O ribose methyltransferase catalyzes the methyltransfer from S-adenosyl-L-methionine (AdoMet) to the 2'-OH group of ribose in tRNA or rRNA. It is part of the SpoU family of MTases, a subfamily of the SPOUT methyltransferase superfamily. The SPOUT methyltransferase superfamily is a large class of S-adenosyl-L-methionine (AdoMet or SAM)-dependent RNA MTases which are structurally characterized by a deep trefoil knot.	6.31642e-76
NZ_CP016414.1\|WP_005596530.1\|1698277_1698781_+\|peptide-deformylase	gnl\|CDD\|237227	PRK12846, PRK12846, peptide deformylase; Reviewed.	1.44494e-81
NZ_CP016414.1\|WP_065545396.1\|1677272_1678271_-\|FUSC-family-protein	gnl\|CDD\|379231	pfam13515, FUSC_2, Fusaric acid resistance protein-like.	1.70712e-12
NZ_CP016414.1\|WP_009386958.1\|1694952_1696569_+\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|225307	COG2509, COG2509, Uncharacterized FAD-dependent dehydrogenases [General function prediction only].	0
NZ_CP016414.1\|WP_065545403.1\|1689224_1690115_-\|leucine-rich-repeat-domain-containing-protein	gnl\|CDD\|372554	pfam13306, LRR_5, Leucine rich repeats (6 copies). This family includes a number of leucine rich repeats. This family contains a large number of BSPA-like surface antigens from Trichomonas vaginalis.	2.07186e-36

>NZ_CP016414.1|WP_065545976.1|1687108_1687447_-|cytosolic-protein
MFIHHVNGIDWLVITAFEELKTMFIEDAGAIPSCFSSSSELSLIDQAKRSYGYLPTLSGVITDVGTFQSKNNEEDLDPQLACLVEGRGRVFIYHGGFVAFVDDEQTFITRMD
>NZ_CP016414.1|WP_005596542.1|1683903_1684398_+|YcxB-family-protein
MSKDFDFTTEYTLDKPFFAECYDQTSQPVKFPHAYLKGLLFLIFGVVLLEFELLPNGYVGWFFIVLSVIEAFSVYCKRTWWLWRQTISSSRMRKVQLQVNADGVTYKSGKINRKLGWSEIDQLEQTDLGFILHIGKQRQYVSKSCLNEEVIAFMVEQHAASQSK
>NZ_CP016414.1|WP_065545401.1|1683544_1683787_+|hypothetical-protein
MNFDIDALKHHQLVEDGQLEGCYIHQPVQGSQPNDEAVVAERQALEKMGHKVMQVQTKGGTTTFAEAMQQFAKKTGHQPR
>NZ_CP016414.1|WP_083163398.1|1682332_1683358_+|transporter-substrate-binding-domain-containing-protein
MAENNTLANINVGTYSCPPFVIIEGDGSYSGLSLFLWQEIALDLGVSYNITDHGLSELIDDVANGSLNVGVSCLSITPQREEILDFSHSFYETHLAIAVKQQGYLASIGNIFTNTKLLYIIGFVFVLAAIVGVIYYLLEHRINDKLYSMPGKKAQMVEGFILGLLFITKGPFNYFEFKTLPGRILTVFLAIFTTFFIASVTAVLASTFTLGLLNSDIKNVNDLANMSVGAKKSSTSSEYLISQAIVHRTYADIDQLLQALDGNEVDAIVADDAVLKYLIKQAKEQGQYEQLTVLPYRFEKQNYGLAIENNSPYREQINRALLKIRHSPEWRQVLHEYFAEE
>NZ_CP016414.1|WP_065545399.1|1681684_1682035_-|hypothetical-protein
MNFAHMSDERVWQIADDLMDNLMAGSTMIDHAQHTRDFTQRMRDFVTPEYLQRVCVHYQDEKGFFTQRERVALFRRPDSFALVWKQAFSKVDGEYVAEMVMVERDGRILVDHVMVF
>NZ_CP016414.1|WP_065545398.1|1681074_1681659_-|hypothetical-protein
MNELKKKSTAEKAITLLLGVTMILGLIGLFSDFVPIKSVQIFGGGVAILLMALTIIYGRKMSILKPHFNNRYLKVVESLFGGGLLLMLYWVSAAYALPSIYTQWVGTEHKKVEIVTPFHLPATKECDYKIESDYIKGTSRGFICITQAWYELDETNYLLYGEQSELGFYIRGVVPLKALRSAIDSRGSESSSSL
>NZ_CP016414.1|WP_005596549.1|1679655_1680942_+|DEAD/DEAH-box-helicase
MTTATTPANFAELNLIQPLLARLAELEYQQPTPIQAQVIPSVLAGRDLIAGANTGSGKTAAFALPMLQNIFINQHPSLYRKNNSVTGLILVPTRELAKQVADNIKSYATHFNGAMKTVCVFGGVSVNSQMLALRGGADILVATPGRLLDLISSNAVKLDRVKTLVLDEADRMLSLGFTEELSELLALLPKQKQTLLFSATFPEEVQALTQELLNNPVEVQLQSSEASTLVQRVFTVDKGKKTALLAHLIKENDWRQALIFVNSKNGCEHLADKLYKRGISVEVFHGDQSQGARTRVLEDFKAGQLDVLIATDIAARGLDVEKLPVVINYDLPRSPSDYMHRIGRSGRAGEVGLALSLIDYEDYHHFKVIEKKNKIRLEREQVPGFEVDETITAAMLEANKPMAKPAGTGKKKRKKNQAAQGDVWLKNN
>NZ_CP016414.1|WP_005596551.1|1679089_1679440_-|MerR-family-transcriptional-regulator
MYIGEIAKRSGASPKAIRLYESLGLLVDIKRQGRYRIYDERDVKFVRLIKDAQTLGVSLSDLRSLMVERNELNWHAAIDLLAEKLNRIDHDMQALARQKEKVEQYRSEIEKCLNPT
>NZ_CP016414.1|WP_065545397.1|1678445_1679027_-|NAD(P)H-dependent-oxidoreductase
MCKKILVVNGNPKPDSFCAELANSYIASSKHNEVKLISLHALEFDCDLTSGYDEIQALEPDLVDFQQAILWAEHVVFVLPVWWGGMPAKLKGLIDRTFLPGFAFKFLENKTIPERLLKGRTADVIVTMDSPPFYYRWFQGNPVVKQLERTILKFSGFKRVSATYIGPVINSTPVQRDKWTKQVVKLASKRAVG
>NZ_CP016414.1|WP_065545396.1|1677272_1678271_-|FUSC-family-protein
MLTKPSKDDWIRGVLYATAVGLPLLLQPWIESQIVVFITLGALFTLRLDPRSHVKHQAIAMIGGVALVILAGAVGTLLVGHFELAIIVLVVISYLAGQPTIEQKYFSLLGKFVAAAFVLEAVGSPVTLMTGVAFFCGGVLALILTILQARYFATQVNGWSLVDEWQQLRSGKINGPLYGMTLPITVLVSILSAQWLNAQHVSWVGLTVLFVMNVDTVTAWRKIWMRTAGTLLGVISAYIVVVFFPSALLSFIIVLSALFMPMFLRQNYMIFSWLMSMFVLLVVDLAMLQSGGDEFLIQWRFIDTLIGCGWVMVSLSLLHLGRKWWPNQPSKG
>NZ_CP016414.1|WP_065545402.1|1688388_1689099_+|hypothetical-protein
MAFVIKDTKLNVAEIDIFHDEAGYAAFPTAESVAFDREKLIPIGLLSFNMFAASVDDKILIALPNLQGIPDGDYGPITYSYIGEQQGWCLDDEYANDDTLEEQDEYLDNYQQAQDEFSANQCLMRRGKKLPLITLGGQPRFGQNWASCLYNELAKNPELDHYYEVTCSLNHPEFEHMSTRDIVYVDEKDNKEYTFIGSFKDEAYLVRDSEYLGFAGEFMVFYQPQLKKVMLVAEYD
>NZ_CP016414.1|WP_065545403.1|1689224_1690115_-|leucine-rich-repeat-domain-containing-protein
MLTGAILATLFGLAIIESSAQQTEFLPSLALKAATNTTTTKRELAVSQPHTLTLDDVSFDKKQGRIDVYKGKHKHIVIPDNFDGIPVTEIWDYAFSEVEDLSEEFEEVPQNPIASVVIPNTVTEIGEGAFQRNALTEIVIPSSVTRIGYKAFAENALTSVDIPDSVTEIAESAFANNALTQLSLPNSLTKINERVFQFNALASITIPDSVTEIGLGAFRGNALQSITIPDSVTDIDSEAFADNAITSVFIPTSVTYMGNGAFTDNPLRGRIIKGFGEKKPPRELTDEEWLEVFGDL
>NZ_CP016414.1|WP_032073033.1|1690283_1691492_+|IS4-family-transposase
MCELDILHDSLYQFCPELHLKRLNSLTLACHALLECKTLTLTELGRNLPTKARTKHNIKRIDRLLGNRHLHKERLAVYRWHASFICSGNSMPIVLVDWSDIREQKRLMVLRASVALHGRSITLYEKAFPLSEQCSKKAHDQFLADLASILPSNTTPLIVSDAGFKVPWYKSVEKLGWYWLSRVRGKVQYADLGAENWQPISNLHSISSSRSKTLGYKRLTKSNPISCQIALYKSRPKGRKNQRSTRTNCHHPSPKIYSASTKEPWVLATNLPVEIRTPKQLVRLYSKRMQIEETFRDLKSPAYGLGLRHSRTSSSERFDIMLLIALMLQLTFWLAGVHGQKQGWDKHFQANTVKNRNVLSTVRLGMEVLRHSGYTITREDLLAAATLLAQNLFKHGCALGKL
>NZ_CP016414.1|WP_065545404.1|1692024_1693203_-|flavohemoglobin-expression-modulating-QEGLA-motif-protein
MLKEVSRLNNHEFTAQHNSELRHAKALDKSLFELVNGIEILSAVGPTNYNQQKSEFFKRHFSIEPEFRYKENIHNPFQLKRQLFNLPLESVEDADLHRIYEDVILSYVDKIDQLQTIGTQDFLYNSLRYFGEPTEKDIRNATFILHLPDSDEDDQKLIDAQGIQAIMAEFAKQEDYQYDLVIDDDMIANALVNKTTVKINSAASVPEIEAHALAHHELGVHLATTINAMNQPFHVLSLGCPVNTMTQEGMAILSEYLAGHLTIKRLKILALRVLAVESMIKDKSFRTTFMMLKEQLGVEKNLAFTITARVYRGGGFTKDYLYLRGFHEVLHAYEEQEGFLNLLCGKTALMHLPQINRLVEKGIFNPPIKITPSFVNPTDNDDVRRFITHAIK
>NZ_CP016414.1|WP_065545405.1|1693525_1694260_+|RNA-methyltransferase
MISKNQLKLLRALGQKKQRKALGLFLVQGEKNVLELASSTLTVKHVFATADFLEQNQATLERFECIEASLDDLTKASTLVSNNAAIAVVEIPTFEAPVAQGMMIALDGVQDPGNLGTIIRVADWYGIKHIVASQDCADPYNPKTISATMGSFGRVQVHQLDLPNYLEQASLPVYGAFLEGESVHKTEFAAEGILLMGSESHGIRAQAAAFVTDKITIPAFGGAESLNVAMATGIILDNMRRQHS
>NZ_CP016414.1|WP_005596535.1|1694386_1694710_-|ferredoxin-family-protein
MAFVVTDNCIQCKYTDCVAVCPADAFHEGPNFMVINPIECIDCGLCVDECAAQAIFQEDELTDDQQVFIELNAELAEIWPVQTEVKPAMDDAEQWNGVPNKLDKLER
>NZ_CP016414.1|WP_009386958.1|1694952_1696569_+|NAD(P)/FAD-dependent-oxidoreductase
MIRLTEIKLPLNHEEGAILDAITKKLGIAADQVLSFNLFKRGYDARKKANIQLIYTLDVEVANQAEMLEAFISDPHVKETPDMEYKFVAQAPANQTERPVVIGFGPCGLFAGLVLAQMGFNPIIVERGKEVRERTKDTFGFWRKRALNPESNVQFGEGGAGTFSDGKLYSQIKDPNFYGRKVTTEFVAAGAPEEIMYVSKPHIGTFKLVTMIEKMRAKIIELGGEIRFSTRVDDIHMEDGQITGVTLSNGEEIKSRYVVLSVGHSARDTFEMLNERGVYMEAKPFSVGFRIEHKQSMIDEARFGKNAGHPILGAADYKLVHHCKNGRTVYSFCMCPGGTVVAATSEEGRVVTNGMSQYSRAERNANSAIVVGIDPERDYPGDALAGIRLQRELESGAYVLGGENYDAPAQKIGDFLKGRDPSAIGDVEPSFTPGIKLTDISKALPDFAIEAIREAIPAFDKKIKGFASEDGLLTGVETRTSSPVCIKRGKDYQSINLKGFYPAGEGAGYAGGILSAGIDGIKVAEAVALAMVADAENR
>NZ_CP016414.1|WP_065545406.1|1696749_1697250_+|hypothetical-protein
MSDIASFMLGEKADSLGRHIEQFLAYNHFWLEHDHKYIQVLFPIDQGTKFNRHAPLVTAADRALFSSDPRLPAAHLNVLDLMLPFWGLTRDGEQIKSDLPLSANNHVWLRHQDHNQLRITRAIRSLALLGNQNIALNLAQFVVEHSQDFDAVSETTRQYWQQAPVV
>NZ_CP016414.1|WP_005596531.1|1697485_1698070_+|tetratricopeptide-repeat-protein
MIESHPDSASAYYQRGILLAGDYMLPAQVHGRSEQNDVPQAIDDFNTAIDLDPSLVDAYYQLANLYFALSIDDRTAQELLEKALNLAPNNIDCLLLYADLICCEGVNAYAIEILDRVISEDPSAKHFFYKARTLMDNGEIAWNADNFVQGGNLFQAAIEIFQQVTLMEDNDLYFPEAQEYINHCQNVLSSHVCH
>NZ_CP016414.1|WP_005596530.1|1698277_1698781_+|peptide-deformylase
MAVLDILTAPDPRLKIPATKVSDIESVQTLIDDMLDTLYATDNGIGLASTQVGSKEAIIIIDLSEERNDPLILINPEIVSGSDKAMGQEGCLSVPEYYADVERYTSVVVTGLDRQGNPVTIENDEFLAIALQHEIDHLAGNLFIDYLSPLKRNMALKKVKKHLKQTA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1209943 : 1297505

Vibrio_phage(42.86%)

portal,lysis,tail,plate,capsid,integrase,terminase

attL 1204807:1204822|attR 1237458:1237473

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1204807:1204822	attL	NA	NA	NA	NA
WP_065545241.1\|1209943_1210966_-\|integrase	tyrosine-type recombinase/integrase	R9TMQ4	Vibrio_phage	7.0e-92	49.7
WP_156785334.1\|1210973_1211501_-	hypothetical protein	NA	NA	NA	NA
WP_065545243.1\|1211897_1213631_-	DUF2326 domain-containing protein	NA	NA	NA	NA
WP_065545245.1\|1213832_1214831_-	SMEK domain-containing protein	NA	NA	NA	NA
WP_065545246.1\|1214859_1215507_-	phage repressor protein CI	A0A166YHA0	Vibrio_phage	8.4e-67	61.1
WP_065545247.1\|1215657_1215870_+	hypothetical protein	R9TMQ7	Vibrio_phage	5.6e-20	68.6
WP_065545248.1\|1215980_1216523_+	transcriptional regulator	U3PIJ8	Vibrio_phage	2.2e-60	66.1
WP_083163355.1\|1216533_1216974_+	hypothetical protein	NA	NA	NA	NA
WP_065545249.1\|1217041_1217533_+	hypothetical protein	R9TNP8	Vibrio_phage	1.3e-19	52.0
WP_065545250.1\|1217651_1217879_+	hypothetical protein	R9TPY7	Vibrio_phage	7.3e-26	70.5
WP_065545251.1\|1217875_1218106_+	hypothetical protein	NA	NA	NA	NA
WP_065545252.1\|1218102_1218459_+	hypothetical protein	NA	NA	NA	NA
WP_083163493.1\|1221417_1221639_+	hypothetical protein	Q8HA64	Vibrio_phage	4.3e-15	61.1
WP_065545256.1\|1221686_1221926_+	ogr/Delta-like zinc finger family protein	NA	NA	NA	NA
WP_065545257.1\|1222186_1223164_+	hypothetical protein	NA	NA	NA	NA
WP_065545258.1\|1223594_1224782_+	hypothetical protein	NA	NA	NA	NA
WP_065545259.1\|1224781_1225720_+\|tail	phage tail protein	NA	NA	NA	NA
WP_083163359.1\|1225712_1226237_+\|plate	phage baseplate protein	A0A2I7RNK2	Vibrio_phage	1.1e-08	35.5
WP_065545260.1\|1226236_1226434_+	hypothetical protein	A0A2I7RNJ8	Vibrio_phage	7.8e-16	72.3
WP_065545261.1\|1226430_1226817_+	hypothetical protein	NA	NA	NA	NA
WP_065545262.1\|1226813_1227869_+	hypothetical protein	M1FQW3	Enterobacteria_phage	1.0e-16	27.8
WP_065545263.1\|1227850_1228330_+	hypothetical protein	NA	NA	NA	NA
WP_156785335.1\|1228326_1230744_+	hypothetical protein	A2I2X8	Vibrio_virus	1.6e-09	32.4
WP_065545264.1\|1230753_1231011_+	hypothetical protein	NA	NA	NA	NA
WP_065545265.1\|1231137_1231335_+	hypothetical protein	NA	NA	NA	NA
WP_065545266.1\|1231324_1231900_+	lysozyme	A0A218M4K3	Erwinia_phage	7.8e-24	41.3
WP_065545267.1\|1231883_1232408_+	hypothetical protein	NA	NA	NA	NA
WP_065545268.1\|1232418_1233390_-\|portal	phage portal protein	E5FFI9	Burkholderia_phage	6.5e-55	39.8
WP_065545269.1\|1233400_1235158_-\|terminase	terminase	E5E3X0	Burkholderia_phage	2.7e-115	41.4
WP_065545270.1\|1235292_1236117_+\|capsid	phage capsid protein	Q94MZ5	Haemophilus_virus	3.7e-19	45.0
WP_065545271.1\|1236163_1237198_+\|capsid	phage major capsid protein, P2 family	A0A0U4K5I9	Pseudomonas_phage	1.2e-62	42.9
WP_065545272.1\|1237319_1237769_+	hypothetical protein	NA	NA	NA	NA
1237458:1237473	attR	NA	NA	NA	NA
WP_065545273.1\|1237769_1238249_+\|tail	phage tail protein	NA	NA	NA	NA
WP_065545274.1\|1238239_1238806_+	virion morphogenesis protein	NA	NA	NA	NA
WP_065545275.1\|1238805_1238991_+	DUF2635 domain-containing protein	A0A0C4UR31	Shigella_phage	4.4e-05	45.1
WP_065545276.1\|1238987_1240121_+\|tail	phage tail protein	A0A0C4UQS0	Shigella_phage	1.8e-48	38.7
WP_065545277.1\|1240124_1240490_+	hypothetical protein	NA	NA	NA	NA
WP_065545278.1\|1240499_1241204_+	hypothetical protein	NA	NA	NA	NA
WP_065545279.1\|1241187_1241487_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_156785349.1\|1241531_1241636_+\|tail	GpE family phage tail protein	NA	NA	NA	NA
WP_065430294.1\|1244137_1245391_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_005597641.1\|1245476_1246331_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_065430295.1\|1246622_1248263_-	putative pyridoxal-dependent aspartate 1-decarboxylase	NA	NA	NA	NA
WP_005597637.1\|1248464_1248977_-	hypothetical protein	NA	NA	NA	NA
WP_005597634.1\|1249987_1250908_-	HDOD domain-containing protein	A0A1C3NFB0	Phage_NCTB	1.3e-09	24.9
WP_005597633.1\|1251271_1251859_+	TfoX/Sxy family DNA transformation protein	NA	NA	NA	NA
WP_065430298.1\|1251971_1252361_+	hypothetical protein	NA	NA	NA	NA
WP_065430299.1\|1252535_1252964_+	lactoylglutathione lyase	NA	NA	NA	NA
WP_083163363.1\|1253059_1253551_-	copper-binding protein	NA	NA	NA	NA
WP_065545281.1\|1253561_1256711_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_065430303.1\|1258449_1259865_-	TolC family protein	NA	NA	NA	NA
WP_065430304.1\|1259972_1260371_-	hypothetical protein	NA	NA	NA	NA
WP_065430305.1\|1260503_1261610_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_065430306.1\|1261939_1263013_+	4-hydroxyphenylpyruvate dioxygenase	NA	NA	NA	NA
WP_065430308.1\|1264164_1265172_+	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_065430309.1\|1265171_1265822_+	maleylacetoacetate isomerase	NA	NA	NA	NA
WP_005597603.1\|1265900_1266086_-	hypothetical protein	NA	NA	NA	NA
WP_065430310.1\|1266254_1267295_-	J domain-containing protein	NA	NA	NA	NA
WP_005597599.1\|1267434_1268103_-	OmpA family protein	NA	NA	NA	NA
WP_005597597.1\|1268267_1268951_-	DUF2786 domain-containing protein	NA	NA	NA	NA
WP_065431089.1\|1269152_1269836_-	DUF3334 family protein	NA	NA	NA	NA
WP_065430311.1\|1270091_1273118_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_005597590.1\|1273117_1273579_+	isoprenylcysteine carboxylmethyltransferase family protein	NA	NA	NA	NA
WP_005597589.1\|1273656_1274325_-	arginine ABC transporter permease ArtM	NA	NA	NA	NA
WP_065430312.1\|1274321_1275011_-	arginine ABC transporter permease ArtQ	NA	NA	NA	NA
WP_065430313.1\|1275012_1275744_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_065430314.1\|1275802_1276531_-	arginine ABC transporter ATP-binding protein ArtP	G9BWD6	Planktothrix_phage	1.7e-23	32.4
WP_005597585.1\|1276814_1277540_-	DUF3581 domain-containing protein	NA	NA	NA	NA
WP_065430315.1\|1277805_1278246_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_065430316.1\|1278554_1279178_+	porin family protein	NA	NA	NA	NA
WP_005597582.1\|1279252_1280785_-	histidine ammonia-lyase	A0A1V0S940	Catovirus	4.1e-88	38.5
WP_065430317.1\|1280787_1282482_-	urocanate hydratase	NA	NA	NA	NA
WP_005597580.1\|1282502_1283501_-	formimidoylglutamase	NA	NA	NA	NA
WP_065545282.1\|1283493_1284765_-	imidazolonepropionase	NA	NA	NA	NA
WP_005597578.1\|1284867_1285581_-	histidine utilization repressor	NA	NA	NA	NA
WP_065430319.1\|1285829_1286573_+	sporulation protein	NA	NA	NA	NA
WP_065430320.1\|1286583_1287558_-	DUF3187 family protein	NA	NA	NA	NA
WP_005597575.1\|1287691_1288468_-	RelA/SpoT domain-containing protein	NA	NA	NA	NA
WP_065431090.1\|1288799_1289447_+	thiopurine S-methyltransferase	NA	NA	NA	NA
WP_065430321.1\|1289523_1290699_-	formate-dependent phosphoribosylglycinamide formyltransferase	NA	NA	NA	NA
WP_065430322.1\|1290941_1292360_+	SLC13/DASS family transporter	NA	NA	NA	NA
WP_005597571.1\|1292363_1293686_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_005597570.1\|1293687_1294161_+	response regulator	NA	NA	NA	NA
WP_065430323.1\|1294432_1295644_+	HD-GYP domain-containing protein	NA	NA	NA	NA
WP_065430324.1\|1295752_1296640_-	cytidine deaminase	NA	NA	NA	NA
WP_005597565.1\|1296827_1297505_-\|lysis	CidB/LrgB family autolysis modulator	NA	NA	NA	NA

DBSCAN-SWA_2

2353681 : 2362088

environmental_halophage(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065545663.1\|2353681_2354893_+	cysteine desulfurase CsdA	Q2XUY6	environmental_halophage	7.6e-85	38.8
WP_065545664.1\|2354982_2355408_-	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	5.4e-22	39.9
WP_065429872.1\|2355477_2356764_-	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	1.5e-35	34.4
WP_005592824.1\|2356965_2357160_-	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_005592825.1\|2357258_2357597_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_005592826.1\|2357608_2359462_-	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.3e-108	40.8
WP_005592827.1\|2359482_2359998_-	co-chaperone HscB	NA	NA	NA	NA
WP_005592828.1\|2360051_2360375_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	2.6e-24	52.3
WP_005592829.1\|2360442_2360823_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	6.9e-53	78.2
WP_005592830.1\|2360873_2362088_-	IscS subfamily cysteine desulfurase	A0A1X7C038	Faustovirus	4.1e-30	30.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP016416

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

40140 : 100515

Streptococcus_phage(14.29%)

plate,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_083163837.1\|40140_40614_-\|protease	trypsin-like serine protease	NA	NA	NA	NA
WP_065432132.1\|40703_40919_-	hypothetical protein	NA	NA	NA	NA
WP_156785374.1\|40973_41387_-	hypothetical protein	NA	NA	NA	NA
WP_065546878.1\|41481_42438_-	type II secretion system protein	NA	NA	NA	NA
WP_065546879.1\|42439_42952_-	hypothetical protein	NA	NA	NA	NA
WP_065546880.1\|42951_43467_-	hypothetical protein	NA	NA	NA	NA
WP_083163840.1\|43511_44564_-	hypothetical protein	NA	NA	NA	NA
WP_065546882.1\|44487_46116_-	type II secretion protein	NA	NA	NA	NA
WP_065546883.1\|46112_46790_-	hypothetical protein	NA	NA	NA	NA
WP_065546884.1\|46786_47947_-	hypothetical protein	NA	NA	NA	NA
WP_065546885.1\|47946_49470_-	hypothetical protein	NA	NA	NA	NA
WP_065546886.1\|49466_50717_-	hypothetical protein	NA	NA	NA	NA
WP_065546887.1\|50937_51858_-	hypothetical protein	NA	NA	NA	NA
WP_065546888.1\|52209_52548_-	hypothetical protein	NA	NA	NA	NA
WP_065546889.1\|52609_53536_-	DUF1281 domain-containing protein	NA	NA	NA	NA
WP_065546890.1\|53849_54089_-	hypothetical protein	NA	NA	NA	NA
WP_065546891.1\|54179_54521_-	hypothetical protein	NA	NA	NA	NA
WP_065546892.1\|54616_54946_-	hypothetical protein	NA	NA	NA	NA
WP_065546893.1\|55019_55409_-	hypothetical protein	NA	NA	NA	NA
WP_156785375.1\|55470_55980_-	hypothetical protein	NA	NA	NA	NA
WP_065546895.1\|56124_56532_-	DUF3577 domain-containing protein	NA	NA	NA	NA
WP_065546896.1\|56826_57180_-	MazF family transcriptional regulator	NA	NA	NA	NA
WP_006711180.1\|57179_57434_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_065546897.1\|57553_57952_-	hypothetical protein	NA	NA	NA	NA
WP_065546898.1\|58264_59134_-	DUF1186 domain-containing protein	NA	NA	NA	NA
WP_065546899.1\|59454_59832_+	NirD/YgiW/YdeI family stress tolerance protein	NA	NA	NA	NA
WP_065545106.1\|60308_61352_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_156785378.1\|61467_61641_+	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
WP_083163843.1\|61951_63637_-	hypothetical protein	NA	NA	NA	NA
WP_065546901.1\|63591_64281_-	hypothetical protein	NA	NA	NA	NA
WP_065546902.1\|64277_64505_-	hypothetical protein	NA	NA	NA	NA
WP_065546903.1\|64509_65277_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_065546904.1\|65384_67538_-	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	4.1e-41	30.0
WP_065546905.1\|67537_67933_-	hypothetical protein	NA	NA	NA	NA
WP_006714203.1\|67929_68163_-	hypothetical protein	NA	NA	NA	NA
WP_065546906.1\|68178_68610_-	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_083163853.1\|70684_70843_-	type I toxin-antitoxin system Hok family toxin	NA	NA	NA	NA
WP_065546907.1\|71725_72046_-	hypothetical protein	NA	NA	NA	NA
WP_065546908.1\|72042_72405_-	hypothetical protein	NA	NA	NA	NA
WP_065546909.1\|72727_73987_+\|transposase	IS256 family transposase	A0A2P1JQX9	Mycobacterium_phage	3.0e-92	47.5
WP_065546910.1\|74304_74868_+	recombinase family protein	Q2A092	Sodalis_phage	1.7e-26	37.2
WP_065546911.1\|75035_75335_-	type VI secretion system PAAR protein	K4ICQ1	Acidithiobacillus_phage	1.3e-06	49.1
WP_065546953.1\|75344_76133_-	glycosyl hydrolase family 26	NA	NA	NA	NA
WP_156785376.1\|76350_77913_-	hypothetical protein	NA	NA	NA	NA
WP_065546913.1\|77959_78745_-	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_065546914.1\|78744_80724_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	8.4e-33	27.3
WP_065546915.1\|80825_81344_-	Hcp family type VI secretion system effector	NA	NA	NA	NA
WP_065546916.1\|81659_82925_-	type VI secretion protein	NA	NA	NA	NA
WP_065546917.1\|82979_86525_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_065546918.1\|86540_87953_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_065546919.1\|87961_88618_-	type VI secretion system-associated protein TagO	NA	NA	NA	NA
WP_065546920.1\|88614_90183_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_065546921.1\|90185_92798_-	type VI secretion system ATPase TssH	A0A223W0B1	Agrobacterium_phage	1.5e-90	29.9
WP_065546922.1\|92822_93596_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_065546923.1\|93598_94933_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_065546924.1\|94939_95416_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_065546925.1\|95418_96885_-	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
WP_065546926.1\|96887_97904_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_032073033.1\|99306_100515_-\|transposase	IS4 family transposase	Q9E8P4	Bluetongue_virus	9.1e-224	95.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP016415

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

285713 : 322730

Staphylococcus_phage(44.44%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_083163595.1\|285713_286682_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.4e-41	35.6
WP_065546160.1\|287575_288490_+	alpha/beta hydrolase	A0A167RJ59	Powai_lake_megavirus	4.9e-28	32.8
WP_065546161.1\|288664_288964_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_045101727.1\|288971_289214_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_065546162.1\|290038_290572_+	hypothetical protein	NA	NA	NA	NA
WP_065546164.1\|291866_292325_+	hypothetical protein	NA	NA	NA	NA
WP_065546806.1\|292472_293156_+	hypothetical protein	NA	NA	NA	NA
WP_065546165.1\|293921_294494_+	hypothetical protein	NA	NA	NA	NA
WP_014386666.1\|294827_295775_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-42	35.0
WP_065546166.1\|295929_296619_+	trypsin-like peptidase domain-containing protein	NA	NA	NA	NA
WP_083163595.1\|296653_297622_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.4e-41	35.6
WP_065546167.1\|297876_298179_+	hypothetical protein	NA	NA	NA	NA
WP_065546168.1\|299411_299885_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_065546169.1\|300062_300515_+	hypothetical protein	NA	NA	NA	NA
WP_083163790.1\|300713_301223_+	hypothetical protein	NA	NA	NA	NA
WP_065546171.1\|301401_301815_+	hypothetical protein	NA	NA	NA	NA
WP_065546172.1\|301967_302309_+	hypothetical protein	NA	NA	NA	NA
WP_156785358.1\|302465_302777_+	hypothetical protein	NA	NA	NA	NA
WP_065546174.1\|303502_304000_+	ATP-binding protein	A0A2H4JFX6	uncultured_Caudovirales_phage	1.3e-46	52.2
WP_065546807.1\|304145_304478_+	hypothetical protein	NA	NA	NA	NA
WP_065546175.1\|304624_305350_+	hypothetical protein	NA	NA	NA	NA
WP_065546176.1\|305485_306259_+	aminoglycoside phosphotransferase family protein	NA	NA	NA	NA
WP_065546177.1\|306414_306798_+	GFA family protein	NA	NA	NA	NA
WP_065546178.1\|306959_307406_+	GyrI-like domain-containing protein	NA	NA	NA	NA
WP_065546180.1\|308163_308889_+	hypothetical protein	NA	NA	NA	NA
WP_065546181.1\|310154_310652_+	ATP-binding protein	A0A2H4JFX6	uncultured_Caudovirales_phage	1.1e-47	53.4
WP_065545106.1\|310722_311766_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_083163627.1\|311891_312392_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_065546183.1\|312541_312925_+	hypothetical protein	NA	NA	NA	NA
WP_065546184.1\|313630_313921_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A2H4JBF4	uncultured_Caudovirales_phage	1.4e-21	58.5
WP_065546185.1\|313910_314159_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_065546186.1\|314356_314761_+	GFA family protein	NA	NA	NA	NA
WP_083163632.1\|314901_315402_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_156785359.1\|315520_315925_+	hypothetical protein	NA	NA	NA	NA
WP_065546808.1\|316109_316481_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_065546189.1\|316691_317021_+	hypothetical protein	NA	NA	NA	NA
WP_065546190.1\|317767_318121_+	hypothetical protein	NA	NA	NA	NA
WP_065546191.1\|318849_319257_+	DUF1330 domain-containing protein	NA	NA	NA	NA
WP_083163635.1\|320433_320745_+	ASCH domain-containing protein	NA	NA	NA	NA
WP_083163595.1\|321268_322237_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.4e-41	35.6
WP_156785360.1\|322358_322730_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	6.2e-30	51.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP016414

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP016416

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP016415

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection