CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP016433	Rhizobium sp. S41 chromosome 2, complete sequence	1 crisprs	PrimPol,csa3,DEDDh	0	0	8	0
NZ_CP016320	Rhizobium sp. S41 chromosome 1, complete sequence	0 crisprs	csa3,cas3,DEDDh,WYL	0	0	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP016433_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016433_1

823831-823952

Orphan

Consensus_repeat	Method
GACTGGAGCTATGACAGCAAGTCGTACAGCGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP016433_1

>merge|NZ_CP016433|1|823831-823952|CRISPRCasFinder
GACTGGAGCTATGACAGCAAGTCGTACAGCGATAACGACACGACGACCAAGACGAGCACCGAAACCAGCACCGAAATCAAGACCGATTACGACTGGAGCTATGAAAGCAAGTCGTACAGCGA

>NZ_CP016433|1|1|823831-823952|CRISPRCasFinder
GACTGGAGCTATGACAGCAAGTCGTACAGCGA	TAACGACACGACGACCAAGACGAGCACCGAAACCAGCACCGAAATCAAGACCGATTAC
GACTGGAGCTATGAAAGCAAGTCGTACAGCGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016433.1\|WP_004438583.1\|833669_834350_-\|exopolysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|274395
NZ_CP016433.1\|WP_006698572.1\|819123_820107_-\|UDP-glucose-4-epimerase-GalE	unknown	unknown	gnl\|CDD\|224012
NZ_CP016433.1\|WP_052114221.1\|813139_814093_-\|cellulose-biosynthesis-protein-BcsN	unknown	unknown	gnl\|CDD\|374958
NZ_CP016433.1\|WP_004438642.1\|810882_813072_-\|UDP-forming-cellulose-synthase-catalytic-subunit	unknown	unknown	gnl\|CDD\|274400
NZ_CP016433.1\|WP_037091120.1\|835663_836998_+\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|181707
NZ_CP016433.1\|WP_037091127.1\|817195_819127_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133043
NZ_CP016433.1\|WP_037091124.1\|821911_822682_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP016433.1\|WP_006698574.1\|821521_821869_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016433.1\|WP_004438580.1\|834968_835517_-\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|182158
NZ_CP016433.1\|WP_037091125.1\|820108_821131_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187541
NZ_CP016433.1\|WP_022563649.1\|832228_833485_-\|exopolysaccharide-production-protein-exoF	unknown	unknown	gnl\|CDD\|224512
NZ_CP016433.1\|WP_037091220.1\|816677_817181_-\|DUF995-domain-containing-protein	unknown	unknown	gnl\|CDD\|336337
NZ_CP016433.1\|WP_037091121.1\|830952_832221_-\|O-antigen-ligase-family-protein	unknown	unknown	gnl\|CDD\|225844
NZ_CP016433.1\|WP_022563652.1\|826801_829009_+\|type-I-secretion-system-permease/ATPase	unknown	unknown	gnl\|CDD\|226969
NZ_CP016433.1\|WP_037091122.1\|829017_830376_+\|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|130902
NZ_CP016433.1\|WP_037091123.1\|824711_826733_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016433.1\|WP_037091128.1\|815701_816664_-\|glycosyl-hydrolase-family-5	unknown	unknown	gnl\|CDD\|226609
NZ_CP016433.1\|WP_037091119.1\|837208_838135_-\|homocysteine-S-methyltransferase-family-protein	unknown	unknown	gnl\|CDD\|224951
NZ_CP016433.1\|WP_004438593.1\|830461_830956_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016433.1\|WP_037091131.1\|814466_815648_+\|AGE-family-epimerase/isomerase	unknown	unknown	gnl\|CDD\|225493

Protein	Function_ID	Function_description	E-value
NZ_CP016433.1\|WP_004438583.1\|833669_834350_-\|exopolysaccharide-biosynthesis-protein	gnl\|CDD\|274395	TIGR03022, WbaP_sugtrans, Undecaprenyl-phosphate galactose phosphotransferase, WbaP. The WbaP (formerly RfbP) protein has been characterized as the first enzyme in O-antigen biosynthesis in Salmonella typhimurium. The enzyme transfers galactose from UDP-galactose to a polyprenyl carrier (utilizing the highly conserved C-terminal sugar transferase domain, pfam02397) a reaction which takes place at the cytoplasmic face of the inner membrane. The N-terminal hydrophobic domain is then believed to facilitate the "flippase" function of transferring the liposaccharide unit from the cytoplasmic face to the periplasmic face of the inner membrane. This model includes the enterobacterial enzymes, where the function is presumed to be identical to the S. typhimurium enzyme as well as a somewhat broader group which are likely to catalyze the same or highly similar reactions based on a phylogenetic tree-building analysis of the broader sugar transferase family. Most of these genes are found within large operons dedicated to the production of complex exopolysaccharides such as the enterobacterial O-antigen. The most likely heterogeneity would be in the precise nature of the sugar molecule transferred.	7.19492e-98
NZ_CP016433.1\|WP_037091220.1\|816677_817181_-\|DUF995-domain-containing-protein	gnl\|CDD\|336337	pfam06191, DUF995, Protein of unknown function (DUF995). Family of uncharacterized Proteobacteria proteins.	7.29138e-67
NZ_CP016433.1\|WP_052114221.1\|813139_814093_-\|cellulose-biosynthesis-protein-BcsN	gnl\|CDD\|374958	pfam17038, CBP_BcsN, Cellulose biosynthesis protein BcsN. This is a family of bacterial cellulose biosynthesis proteins. Cellulose is necessary for biofilm formation in bacteria. (Roemling U. and Galperin M.Y. "Bacterial cellulose biosynthesis. Diversity of operons and subunits" (manuscript in preparation)).	3.61369e-87
NZ_CP016433.1\|WP_004438642.1\|810882_813072_-\|UDP-forming-cellulose-synthase-catalytic-subunit	gnl\|CDD\|274400	TIGR03030, Cellulose_synthase_UDP-forming, cellulose synthase catalytic subunit (UDP-forming). Cellulose synthase catalyzes the beta-1,4 polymerization of glucose residues in the formation of cellulose. In bacteria, the substrate is UDP-glucose. The synthase consists of two subunits (or domains in the frequent cases where it is encoded as a single polypeptide), the catalytic domain modelled here and the regulatory domain (pfam03170). The regulatory domain binds the allosteric activator cyclic di-GMP. The protein is membrane-associated and probably assembles into multimers such that the individual cellulose strands can self-assemble into multi-strand fibrils.	0
NZ_CP016433.1\|WP_037091120.1\|835663_836998_+\|aspartate-aminotransferase-family-protein	gnl\|CDD\|181707	PRK09221, PRK09221, beta alanine--pyruvate transaminase; Provisional.	0
NZ_CP016433.1\|WP_037091127.1\|817195_819127_-\|glycosyltransferase	gnl\|CDD\|133043	cd06421, CESA_CelA_like, CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.	1.45033e-69
NZ_CP016433.1\|WP_037091124.1\|821911_822682_-\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	2.37891e-39
NZ_CP016433.1\|WP_004438580.1\|834968_835517_-\|cupin-domain-containing-protein	gnl\|CDD\|182158	PRK09943, PRK09943, HTH-type transcriptional regulator PuuR.	2.14578e-37
NZ_CP016433.1\|WP_037091125.1\|820108_821131_-\|SDR-family-oxidoreductase	gnl\|CDD\|187541	cd05230, UGD_SDR_e, UDP-glucuronate decarboxylase (UGD) and related proteins, extended (e) SDRs. UGD catalyzes the formation of UDP-xylose from UDP-glucuronate; it is an extended-SDR, and has the characteristic glycine-rich NAD-binding pattern, TGXXGXXG, and active site tetrad. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	0
NZ_CP016433.1\|WP_022563649.1\|832228_833485_-\|exopolysaccharide-production-protein-exoF	gnl\|CDD\|224512	COG1596, Wza, Periplasmic protein involved in polysaccharide export, contains SLBB domain of b-grasp fold [Cell wall/membrane/envelope biogenesis].	4.84422e-35
NZ_CP016433.1\|WP_006698572.1\|819123_820107_-\|UDP-glucose-4-epimerase-GalE	gnl\|CDD\|224012	COG1087, GalE, UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane].	0
NZ_CP016433.1\|WP_037091121.1\|830952_832221_-\|O-antigen-ligase-family-protein	gnl\|CDD\|225844	COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane].	4.59801e-45
NZ_CP016433.1\|WP_022563652.1\|826801_829009_+\|type-I-secretion-system-permease/ATPase	gnl\|CDD\|226969	COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only].	0
NZ_CP016433.1\|WP_037091122.1\|829017_830376_+\|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit	gnl\|CDD\|130902	TIGR01843, Hemolysin_secretion_protein_D_plasmid, type I secretion membrane fusion protein, HlyD family. Type I secretion is an ABC transport process that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C-terminus of the transported protein. This model represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This model selects a subfamily closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins. [Protein fate, Protein and peptide secretion and trafficking].	1.44279e-132
NZ_CP016433.1\|WP_037091128.1\|815701_816664_-\|glycosyl-hydrolase-family-5	gnl\|CDD\|226609	COG4124, ManB, Beta-mannanase [Carbohydrate transport and metabolism].	2.10511e-131
NZ_CP016433.1\|WP_037091119.1\|837208_838135_-\|homocysteine-S-methyltransferase-family-protein	gnl\|CDD\|224951	COG2040, MHT1, Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) [Amino acid transport and metabolism].	3.32739e-99
NZ_CP016433.1\|WP_037091131.1\|814466_815648_+\|AGE-family-epimerase/isomerase	gnl\|CDD\|225493	COG2942, COG2942, N-acyl-D-glucosamine 2-epimerase [Carbohydrate transport and metabolism].	2.98741e-159

>NZ_CP016433.1|WP_037091124.1|821911_822682_-|response-regulator-transcription-factor
MFMGTSDYAAKQKNAVTHINGTLLIVADPDLFSECLMEALGKKFPTFSVVSVTSSATIDDDYGADVRLVLPYRLAGERLNSVLSAIREKHPEAPIALVVETIDKIEEPLKRLVGMRIIDGVLPLNLRLDVFMAAVELLMKGGEHFPAALLGKLTPYPTAVGGKSVQNSPVIANRADALAESRSDMATLTTREVQILDLLCKGTQNKIIADRLHLSENTVKVHVRNIYKKMNVRNRTEAASRFFSKDEGATFSGWKN
>NZ_CP016433.1|WP_006698574.1|821521_821869_+|hypothetical-protein
MMNEMPYFRGGKTVRQCRLALVAGALLTFTFATASCSVVEDAVLTTASASPTTIKSRVTPAKAAYGYQKTGNAAVTLVADASDTPAVSRPSYSGSSPYICSPSGFGQKSRCFLRP
>NZ_CP016433.1|WP_037091125.1|820108_821131_-|SDR-family-oxidoreductase
MRNFVPNEHDNGVTIYSDWKPGQRVLVNGGAGFLGSHLCERLLSSGHEVICLDDLSTGRTANVEHLRNNKRFLMVEHDVRKPYDIDVSLIFNFASPASPPDYQRDPVGTLLTNVLGAVNVLEVARRCGATVVQSSTSEVYGDPRVNPQPETYFGNVNTIGPRACYDEGKRSAETLFFDYHRTFGVDIKVGRIFNTYGPRMRPDDGRVVSNFIVQALKGDDITIYGDGSQTRSFCYVDDLIDGFLRFSAKPKDCTGPINLGNPAEIPVRQLADIVIRMTGSRSRIVHLPAAIDDPQQRRPDISRANELLKWQPRVPLEIGLERTIVYFDALLAGQKVAEAV
>NZ_CP016433.1|WP_006698572.1|819123_820107_-|UDP-glucose-4-epimerase-GalE
MPRTILVTGGAGFIGSHICKALAQSGFKPIAYDNLSTGHADSVRWGPFIEGDILDRGLLKATLQEFSPAFVIHCAANAYVGESVEDPRKYYRNNVGGSLSLLDACLDQNIGGLVFSSSCATYGVPPQLPIREETAQTPVNPYGRTKLIFEMALDDYAAAYGLRFVALRYFNAAGADPDGELCERHEPETHLIPRALMAAAARLPQLDVFGADYDTSDGTCIRDYIHVSDLADAHVAAVNYLADGGETLRVNLGSGHGTSVGDIIRAIHRVTGQEVPVHFGARRAGDPPALFADIERARQTLGFAPRRSDIDTIIRTAGPGFGLEVLS
>NZ_CP016433.1|WP_037091127.1|817195_819127_-|glycosyltransferase
MTMRSTPSVASPRAAAGVLRMLPVFTGWNRLAYLLGIGGWLVTLAYFWIWWLDRDRVIDWPYYSVVTLALAWITLLPSYFIFIFLNARVVDPRSPLPQGRVAMVVTKAPSEPFAVVEKTLLAMLEQKGLEFDVWLADEAPDAETLKWCGAHGVFISTRQGIAEYHRKTWPRRTRCKEGNLAYFYDRYGYERYDFVAQFDADHVPEPDYLSEVIRPFADPRIGYVSAPSICDANANESWAARGRLYAEASLHGALQLGYNNGWAPLCIGSHYAVRTKALREVGGLGPELAEDHSTTLLMNAGGWRGVHAVNAIAHGDGPVTFADLIVQEFQWSRSLMTILLQYSRHYVPKLPARLKFQFLFSQLWYPLFSGFMALMFVLPAVALVRGHVLVNASYPAFLAHFLPVSLIMIVFAFFWRATGAFRPHDAKLFSWEAMVFLFLRWPWSLMGVLAAIRDTIRGDFVDFRITPKGTQAKPPLPLRVVAPYTVLAALSLLAMVLAPRQNGAEGFFIFAAINVAIYAGLSVFLLIRHAVENGLPKLPALRGGASAAACSLLLVAGSAAELSSHAIGGLEALSHGQPYVSFTETRFTVAGAGAEGARSVRLKLRIALPGLRGSQEMQAEPIVAPPPAVATGEIMLADNRVGQ
>NZ_CP016433.1|WP_037091220.1|816677_817181_-|DUF995-domain-containing-protein
MKTTISTCGFSAFVLCLAVVAPSVVHAAGGTKTPKPLRTSEVVAMYFDKTWKWDTGGGRFIADGRKFIAATEEKGKKSIGEGRWTVDANGTLCMRATWKAEAGSGKADTCFDHGRIGNVLYQRKQGGQWYVFRHNPPRPGDEFLKLVRKDDVTPQIAAYDKAMTATR
>NZ_CP016433.1|WP_037091128.1|815701_816664_-|glycosyl-hydrolase-family-5
MQITRRTLLFASGAAAAFTAGMYPVLKLDAQGVASMTSTGMKTLADKRPTLHADGIRFGAYDPHGDFTGQSGVATEHLFLPWEDVDLDSLALADAYALERKRNVMITVEPWSWDVNWRLSSDELRRKVLSGDYDKNMQAIAARMSAMKSPLILRWGQEMEDTTGRFSWSGWNPRDYITAYKRVVDMTRKAVPGVKVMWSPKGLDGLRAYYPGDNYADLVGLSVFGLEDYDKIEYGAPKTFTDLLRKGYGLVETFDKPVWVAELGYEGSDSYVGPWMNDVTLKQADFPKLEEVVYFNDKDVHPWPHNLGRPDWRVVRPAKV
>NZ_CP016433.1|WP_037091131.1|814466_815648_+|AGE-family-epimerase/isomerase
MTVQFPSIAQTLAEEIGTLRKWLDEDALPLWWEAGSARPDGGFYERLGQDAKPVFSDDRRARVQPRQAYCYAAAGQHGWHGPWKDAVLHGLSWFEKVYRLENGLYGNLAEQTGKLIDPSFDLYNQAFALFAAAQTAAILPERRNEMRSRALEILAILERDYRHPIAGFEEANPPRTPLCSNPHMHLFEAMLAWEEQDRDGPWSALADEIAGLALSRFIDDGNGGLREFFAHDWTPYEGEKGRIMEPGHQFEWAWLLVRWGSLRGNEEAISKAKRLFEIGEQHGICPRRKVAVMSLYDDFSMRDGLARLWPQTEWLKAAVRLASVTDGEERQRYLASGLSAIGALQPFLDTPVKGLWFDKWPADRPMLDEPAPASTFYHIVCAIYEAEAVLAAG
>NZ_CP016433.1|WP_052114221.1|813139_814093_-|cellulose-biosynthesis-protein-BcsN
MAVLSGCNTPAGVRSFGGTQLLSPSEALIFPPPGGPEIVTVVSRTYSNAVAQQVILRSEAATPGQNYLKAEFFGPQQAGDTDFDSLAFTGFRASSLAREIRAEFPGETIAMSANYLQNSYGAFSYAAGKGRGEDTCLYGWQDIRSPESMRQDFRNLGRIKVRLRLCQSGASVERLLAVMYNYTITGTYASPSWNPYGTPQAVDKNLGRPGNPVYPIKSEEVPMRPGGEVTASVPVRPVRRAAATAPVQPEQQPLPPVAAVNIPSPVSAGASGQPAVTAPRAVGGGAVTGQQQSSRVPQVSIPSPSCLSGSGAGQGCR
>NZ_CP016433.1|WP_004438642.1|810882_813072_-|UDP-forming-cellulose-synthase-catalytic-subunit
MNKAITIIVWLLVSLCVLAIITMPVSLQTHLVATAISLILLATIKGFNGQGVWRLVALGFGTAIVLRYVYWRTTSTLPPVNQLENFIPGFLLYLAEMYSVVMLALSLVIVSMPLPSRKTRPGSPTYRPTVDVFVPSYNEDAELLANTLAAAKNMDYPADRFTVWLLDDGGSVQKRNAANIVEAQAAQRRHEELKKLCEDLDVRYLTRERNVHAKAGNLNNGLAHSTGELVTVFDADHAPARDFLLETVGYFEEDPRLFLVQTPHFFVNPDPIERNLRTFETMPSENEMFYGIIQRGLDKWNGAFFCGSAAVLRREALQDTEGFSGVSITEDCETALALHSRGWNSIYVDKPLIAGLQPATFASFIGQRSRWAQGMMQILIFRQPLFKRGLTFTQRLCYMSSTLFWLFPFPRTIFLFAPLFYLFFDLQIFVASGGEFLAYTAAYMLVNLMMQNYLYGSFRWPWISELYEYVQTVHLLPAVVSVIFNPGKPTFKVTAKDESIAEARLSEISRPFFVIFGLLVVAMIFAVWRIYSEPYKADVTLVVGGWNLLNLIFAGCALGVVSERGDKSASRRITVKRRCEVKLEGSDTWVPASIDNVSVHGLLINLFDNATTVEKGETAIVRVKPHSEGVPETMPLNIVRTVRGEGFISIGCTFSPQRAVDHRLIADLIFANSEQWSEFQRVRRRNPGLIRGTATFLAISLFQTQRGLFYLARALRPGSKAVKPAGAVK
>NZ_CP016433.1|WP_037091123.1|824711_826733_+|hypothetical-protein
MHIDKISDMIAHFIGLFDTMAEEARLRNNYSEGPARSGPEQLPEEEAARLLDKNYDVALQDYDPGVKYHAGYYDFDYLPPHFARTVEHDMQQFANSIPVDISAANFRFPGRLSFEDERELVIHTGPGSVVAHIAQVNILQDDDYLNMTDGPNVARDTSFVTERTVEFYNEASVFTPFSGFQRTDSYDALQALAKTAHDYIEHARDNDVTSLGTGADQDFVLAGNDINGLYINGVAAAEKPALDDYMPDRGIAKPPEEPERSDVALHEESPAGNSLDVAAGANVVANVATLVNTAVMTSVTAVMGDYHQIDAITQAYIYSDRDEIASVFTRSEDQADTAAYNIANFERSVFPGAENTATESPETGEMPIFPTAWRVSVLEGDVSFVHWIEQYQFVSDNDTMMITTSGASVSLLTGGNAALNIANFLGIGMQYDLIIVGGNVLDMNLISQIAVLYDNDWARANPDAPGGATIQSGNNLLWNDASIYNVGSNDRFETMPDYMAQTVSAINERDPNMPDALAHDSNFAGYQGLNVLYITGNLYDVSIIKQVSVLGDSDDVTQAAAKVLENNENTDVHIDTGSNAVINLAQIIDYDSFGSTTYVAGGVYSDAILIQGGIIENDTSQPAQPGQLANEVIAFLHDDPATIENESDGVINAGHDLSWSNAHSSDVMQAVTA
>NZ_CP016433.1|WP_022563652.1|826801_829009_+|type-I-secretion-system-permease/ATPase
MDHISRRTIADGRSLDLPLDQDAEDSKLTDACISAINEAVENLRQLSGAEQIARATPPSPEVAPPPSPTTPQSGTLRDMPAGNPAPQQEPHPASRPAPKAKIDNAELKSAPDLPFVKTIDNNDGPIRETERRPATGGGGDGKEPTGNGGGGGGGGSSQSGFHKRSEPINFAASLAKGIAAVRRNMIVVMLFTVAINVLLLAIPLYLFQISDRVLTSRSMDTLVMLTVAVLGAVLLQAFMDAIRRFILMRTAVELEVQLGAPILSAAARASLHGSGKDYQILQDLQQLRSFLTSGTLIAFLDAPLMPLFIVVVYLVHPHLGIIIMVCCAVLFTIAWLNQRFTARQFSEASGYLSRANFHLDSMSRNSQIINALAMIPEAVKMWGRETAGSLKSHVAAQDRNIMFSGVSKAARMITQVALLGWGAHLSLSGELTGGMVIAASIVSGRALAPIEGAIEGWHQFNKSAASYGRIKQLLISSPLNFPRLRLPNPEGRLDVERILFVPPPQKKVILNGISFSLKKGESLAIIGNSGSGKTTLGKMLVGSILPTSGNVRLDLMDLRNWDQRQFGESIGYLPQDVQLFPGTIKANICRMRDDIEDRQIYEAAVLADVHELIAGFPQGYETVVAADGAPLSGGQKQRIALARAFFGDPKFVVLDEPNSNLDTQGEQALAKALLHAKRQGITTVTITQRPALLQCVDKIMVLKDGSVAMFGERMDVLKALSGNGRQASQSPQIEG
>NZ_CP016433.1|WP_037091122.1|829017_830376_+|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit
MFRKKNAIAEVKPQGQLEWYSEVPRSIRLHSSIGLAVLLASFGGFGYWAGTAPLSSAIIAQGSFVATGNNKVVQHLEGGIIKEMMVSEGDTVKVGDVLLTLDKTTALANERMLQLRRLRLETIVTRLRAEAQGAKSFKVPDIVMKEAGDPDINAIIQSQNIVFHSKLIKLEEQLNLIEKNIRSLEFRYAGYDGQKQSFDRQLALLTQERDSKERLAKDGVIRKTDMLALERAIADAMGDIARLSGEMNQSEAEIAKFKQEAIIAVNANKQAALDALETAESDLDSVREQVRGAAEVLERTVIRSPVNGTVVRAYYHTPGGVITTGKPIMEILPAHVPLILEAQVLRTSIDQLHEGQTAAIRLSALNRRTTPVLNGKVFYVSADSIEENAGLQVKDVYIVRVQVPDEEIAKVHNFHPVPGMPADVLIQTSERTFFEYLTKPIADSMSRAFKER
>NZ_CP016433.1|WP_004438593.1|830461_830956_+|hypothetical-protein
MAAMSDVLLLVGRLNYVWTNTESLMIYLIVHLLKVDKEAAIVVFLTLNTTRARMDLIERLAKLPSTDAKDRKTVLSIMARLKREAKTRNKYNHCIYSFDEKGDIASTQLMRLVEDDSQVRYGKVERMDEKEIGQLEKSIADIVEVSKDMWSFIHASPHVSADYL
>NZ_CP016433.1|WP_037091121.1|830952_832221_-|O-antigen-ligase-family-protein
MRIAKSALIDPERNEIYGMTAVALSFFVFAYSSRFGQISVLAYYGMWLPLVVVDYRRVLGNYPRYLWIFAFGILTVLSSFWSEAVSVTMRASIQYLTHIVCALVAMRVISIRTLTRGALIGIGVVLLYSLLFGIYLFDALDGTYSFVGAFSSKNQLGFYASLGVIFAASSVLVLKQRGIWLPIAGVTGLLSAYSLVASQSATSAITTAAVVALIIGFIPIGMLSPANRKMMFFALGGLGALLAVASLQFGLLDAILGIFGKDSTLTGRTYLWQQGIEAAKQAPILGVGYQGFWVAGFADAERLWNDFFITGRSGFHFHNTYIETVVENGFVGMTLLGMVLYGTLLGHLRSVLMRRSDPQGVVLFAICALFVVRSFVEIDIIFPYQIGSFLLYFAAGKLCLPVKAARNGETHPAIGMRLQTRP
>NZ_CP016433.1|WP_022563649.1|832228_833485_-|exopolysaccharide-production-protein-exoF
MNGFSAAHRPFVALVLAATVAFSAPLSAMAADGAQYKLGTADKLRIRVAEWQPADGSIRNWDVINGDYSVGPSGTLSLPFIGQLDVAGKTPSEVSDQIGAQLQSKFALRNLPSASVEIAQFRPIFLSGDVQTPGEYPYAPNITVLKAVSLAGGLRRSDAGQRFARDFINARGDAAVYDNQRARLLARQARLIAEVKGDQTITKTPEMEKIAEIDTLLASESALMKSRTERYTLQLKALTDLHALLQSEVESLKKKSETQNRQLQLANEDRDRVNRLNEQGLALSQRRISAEERAAEVESTLLDIDTQSLRAKQDINKATQDEINLRNDWVAQRSKELQDTEAELDKLNLQLTTSRELMSEALAQSAEAIRFDPSGKSATISYVVVREENGKPKELKVDENALLQPGDVIKVSSEILMQ
>NZ_CP016433.1|WP_004438583.1|833669_834350_-|exopolysaccharide-biosynthesis-protein
MKSATQSAEQTLSSSEDFDVSFPIGGIAKRSFDMTSAALALLIFSPIFLLIAVLVKMSDPGPIFYGHRRVGHNGRYFHCLKFRTMAMNGDEILRQYLAANPEAAEEWRATRKLKNDPRVTAVGAVLRKLSLDELPQLINILRGEMSVVGPRPVVDEELSYYESAAAYYLSTRPGLTGLWQISGRNDVSYKTRVAFDTQYVQNWSMRQDVFIIVKTIPAVCLSRGSY
>NZ_CP016433.1|WP_004438580.1|834968_835517_-|cupin-domain-containing-protein
MSVDIGGRLRHLRLRHNISQRELARRAGVTNSTISLIESNTSNPSVGALKRILDGIPIGLAEFFAFEPETSRKAFYRADELVEIGKGPISFRQVGENVFGRSLQILKECYQPGADTGKVPLVHDGEEGGIILSGRLEVTVDEERRVLGPGDAYYFESRRPHRFRCVGPVACEVISACTPPTF
>NZ_CP016433.1|WP_037091120.1|835663_836998_+|aspartate-aminotransferase-family-protein
MDNPSRSNSTSLDSYWMPFTANRQFKANPRLLASAEGMYYTSDDGRQVLDGTAGLWCVNAGHGRQQIASAVKHQLSTMDYAPSFQIGHPVAFEFAERLAEIAPGPDGGKLDRVFYTGSGSESVDTALKIAIAYQRAIGQGTRNRLIGRERGYHGVGFGGISVGGLVNNRRVFPQIPADHLRHTHDLAKNSFVKGQPEHGAELADDLERLVALHGAETIAACIVEPVAGSTGVLVPPKGYLERLRAICDKHGILLIFDEVITGFGRMGSSFASNYFGVTPDIVTTAKGLTNGAIPMGAVFTSRKVHDALMHGPESQIELFHGYTYSGHPVACAAGIATLDIYRDEGLFTRASELQDAWHDAIHSFRGSPNVIDIRTIGFIAGIELQPRDGAIGARAYDVFVDCFERGLLIRVTGDIIALSPPLIAEKSHFDDIVSILGDALKRAE
>NZ_CP016433.1|WP_037091119.1|837208_838135_-|homocysteine-S-methyltransferase-family-protein
MSDIRILDGGMSRELQRLGAELKQPEWSALALINAPDIVRQVHAEFIEAGADVVTTNSYALVPFHIGEDRFNKEGASLIALSGRLAREAADASKRNVAVAGSLPPIFGSYEPENFDPSRVQDYLKVLVENLQPHVDVWLGETLSLVAEGEAVRQAVAETGKPFWISFTLNDEPAQVNGAEPKLRSGETVRSAAEWAAGSGATALLFNCSKPEVMRAAVETAVAVFKEKGVALDIGVYANAFEGEQGDSAANEGLHGTRADLTDDVYSRFACSWADAGATLIGGCCGIGAAHIHTVADTLRRRGTGRTI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

38141 : 109750

uncultured_virus(12.5%)

transposase,integrase

attL 66185:66201|attR 120243:120259

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065653644.1\|38141_39734_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	3.4e-53	32.9
WP_035228718.1\|40826_41243_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_035228721.1\|41366_41876_+	hypothetical protein	NA	NA	NA	NA
WP_035228726.1\|41926_42415_-	signal peptidase II	NA	NA	NA	NA
WP_107341867.1\|42705_43221_-	transglutaminase-like cysteine peptidase	NA	NA	NA	NA
WP_037094252.1\|43384_43633_-	hypothetical protein	NA	NA	NA	NA
WP_037094253.1\|44273_44807_+	hypothetical protein	NA	NA	NA	NA
WP_052114332.1\|45078_46107_+	murein L,D-transpeptidase	NA	NA	NA	NA
WP_156779256.1\|46110_46281_+	hypothetical protein	NA	NA	NA	NA
WP_037094255.1\|46307_47366_+	NAD(P)-binding protein	NA	NA	NA	NA
WP_037094257.1\|47368_48292_-	cation transporter	NA	NA	NA	NA
WP_037094259.1\|48315_48978_-	thioredoxin domain-containing protein	NA	NA	NA	NA
WP_052114333.1\|48974_49346_-	disulfide bond formation protein B	NA	NA	NA	NA
WP_037094264.1\|49636_50254_+	SCO family protein	NA	NA	NA	NA
WP_037094266.1\|50285_50987_+	L,D-transpeptidase	NA	NA	NA	NA
WP_037094268.1\|51296_51893_+	DedA family protein	NA	NA	NA	NA
WP_037094270.1\|52242_53226_+	arsenic resistance protein	NA	NA	NA	NA
WP_065653655.1\|53834_56810_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	3.0e-183	36.6
WP_143150180.1\|57006_57174_+\|transposase	transposase	NA	NA	NA	NA
WP_037093310.1\|57490_58054_+	acyloxyacyl hydrolase	NA	NA	NA	NA
WP_143150181.1\|58453_59056_+	hypothetical protein	NA	NA	NA	NA
WP_037093314.1\|59703_60876_+	HlyD family secretion protein	NA	NA	NA	NA
WP_156779257.1\|60821_61925_+	FUSC family protein	NA	NA	NA	NA
WP_037093315.1\|62403_62973_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_037093345.1\|63136_64201_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_037093316.1\|64197_66966_+	ribosome-associated ATPase/putative transporter RbbA	A0A2H4PQG7	Staphylococcus_phage	2.5e-19	27.5
66185:66201	attL	NA	NA	NA	NA
WP_081950721.1\|66962_68081_+	ABC transporter permease	NA	NA	NA	NA
WP_037093318.1\|68113_69190_+	NAD(P)-dependent alcohol dehydrogenase	E3SJ82	Synechococcus_phage	1.3e-11	24.7
WP_037093320.1\|69440_70910_+	arginine-ornithine antiporter	NA	NA	NA	NA
WP_037093322.1\|70947_72180_+	arginine deiminase	NA	NA	NA	NA
WP_037093323.1\|72198_73200_+	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_037093325.1\|73201_74131_+	carbamate kinase	NA	NA	NA	NA
WP_037093327.1\|74821_76018_-	sodium/glutamate symporter	NA	NA	NA	NA
WP_037093346.1\|76265_76871_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_037093328.1\|76867_78643_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_037093329.1\|78650_80060_+	bifunctional enoyl-CoA hydratase/phosphate acetyltransferase	NA	NA	NA	NA
WP_037093331.1\|80056_81241_+	acetate/propionate family kinase	NA	NA	NA	NA
WP_052114273.1\|81471_82590_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_081950722.1\|82969_83824_+	universal stress protein	NA	NA	NA	NA
WP_037093333.1\|83912_84443_+	DUF1269 domain-containing protein	NA	NA	NA	NA
WP_037093335.1\|84499_86866_+	phosphoketolase family protein	NA	NA	NA	NA
WP_037093349.1\|89272_89878_+	DUF1419 domain-containing protein	NA	NA	NA	NA
WP_037093340.1\|89889_90291_+	DUF3085 domain-containing protein	NA	NA	NA	NA
WP_065653706.1\|90406_95509_+	N-6 DNA methylase	I6WLR1	Burkholderia_virus	0.0e+00	42.6
WP_037094507.1\|96041_97787_+	plasmid partitioning protein	NA	NA	NA	NA
WP_037094510.1\|97880_98357_+	hypothetical protein	NA	NA	NA	NA
WP_037094512.1\|98353_99241_+	hypothetical protein	NA	NA	NA	NA
WP_052114345.1\|99779_100052_+	hypothetical protein	NA	NA	NA	NA
WP_037094514.1\|100531_101119_+	hypothetical protein	NA	NA	NA	NA
WP_037094517.1\|101416_102343_+	DUF1738 domain-containing protein	A0A1V0EEV1	Caulobacter_phage	6.6e-73	47.5
WP_037094520.1\|103302_105744_+	DEAD/DEAH box helicase	A0A2H5BGG3	Vibrio_virus	9.4e-18	27.3
WP_024318408.1\|105780_106080_-	DUF736 domain-containing protein	NA	NA	NA	NA
WP_037095048.1\|106581_107790_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_037095042.1\|107783_108701_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_037095038.1\|108697_109750_+\|integrase	tyrosine-type recombinase/integrase	A0A160DHK1	Gordonia_phage	2.5e-07	27.4
120243:120259	attR	NA	NA	NA	NA

DBSCAN-SWA_2

143828 : 194086

Streptococcus_phage(33.33%)

transposase,integrase

attL 146468:146527|attR 202058:204511

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_037095196.1\|143828_144542_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.3e-23	34.1
WP_081950783.1\|145241_146429_+\|transposase	IS110 family transposase	NA	NA	NA	NA
146468:146527	attL	NA	NA	NA	NA
WP_052821263.1\|146538_148038_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_003501246.1\|148039_148774_+	ATPase	A0A2L1IVB6	Escherichia_phage	1.5e-32	31.2
WP_027677343.1\|150514_151267_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	5.0e-63	47.1
WP_052821462.1\|151285_152839_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	1.3e-110	44.5
WP_156779258.1\|155426_155789_-	hypothetical protein	NA	NA	NA	NA
WP_111794972.1\|157961_158396_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003501168.1\|158392_158746_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_139009121.1\|159451_160024_-	hypothetical protein	NA	NA	NA	NA
WP_037093092.1\|160020_160614_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_081950706.1\|161245_161815_+	transglutaminase-like cysteine peptidase	NA	NA	NA	NA
WP_003501174.1\|161853_162216_-	hypothetical protein	NA	NA	NA	NA
WP_035228678.1\|162393_162780_-	cytochrome o ubiquinol oxidase subunit IV	NA	NA	NA	NA
WP_003501178.1\|162776_163397_-	cytochrome o ubiquinol oxidase subunit III	NA	NA	NA	NA
WP_003501180.1\|163398_165399_-	cytochrome o ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_107341912.1\|165416_166535_-	ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_003501186.1\|167375_168077_+	L,D-transpeptidase	NA	NA	NA	NA
WP_003501188.1\|168073_168586_+	signal peptidase II	NA	NA	NA	NA
WP_003501190.1\|168755_169172_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003501192.1\|169461_170790_-	divalent metal cation transporter	NA	NA	NA	NA
WP_107342001.1\|171072_171549_-	copper chaperone PCu(A)C	NA	NA	NA	NA
WP_080723265.1\|171734_174389_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.9e-134	38.8
WP_003501205.1\|174616_175573_+	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_003501207.1\|175664_176363_-	L,D-transpeptidase	NA	NA	NA	NA
WP_035226354.1\|176386_178033_-	phosphoethanolamine--lipid A transferase	NA	NA	NA	NA
WP_107341923.1\|178096_179095_-	murein L,D-transpeptidase	NA	NA	NA	NA
WP_037093096.1\|179194_180070_-	hypothetical protein	NA	NA	NA	NA
WP_035226356.1\|180066_180705_-	DsbA family protein	NA	NA	NA	NA
WP_003501216.1\|180833_181772_-	cation transporter	NA	NA	NA	NA
WP_107341922.1\|181927_182794_-	AAA family ATPase	NA	NA	NA	NA
WP_035226358.1\|182783_183026_-	hypothetical protein	NA	NA	NA	NA
WP_035226534.1\|183018_183975_-	SMEK domain-containing protein	NA	NA	NA	NA
WP_035226360.1\|184136_185285_-	DUF1612 and helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_037093101.1\|185492_185924_-	mRNA interferase PemK	NA	NA	NA	NA
WP_037093103.1\|185910_186189_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_081950707.1\|186386_187430_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_052114262.1\|187529_187769_+	hypothetical protein	NA	NA	NA	NA
WP_052114264.1\|188708_189704_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_037093106.1\|189700_190888_+	ABC transporter permease	NA	NA	NA	NA
WP_052114263.1\|190884_192057_+	ABC transporter permease	NA	NA	NA	NA
WP_037093109.1\|193147_194086_-\|transposase	IS110 family transposase	Q75QL1	Wolbachia_phage	1.2e-32	35.3
202058:204511	attR	NA	NA	NA	NA

DBSCAN-SWA_3

200546 : 227820

Planktothrix_phage(20.0%)

transposase,integrase

attL 223503:223533|attR 226813:226843

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_052821263.1\|200546_202046_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_137040350.1\|202184_202944_+\|transposase	IS5-like element ISKpn12 family transposase	NA	NA	NA	NA
WP_037094428.1\|203037_203793_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_037094429.1\|203785_204670_-	polysaccharide deacetylase	NA	NA	NA	NA
WP_065653662.1\|204692_206405_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.8e-22	29.9
WP_037094440.1\|206401_207277_-	ABC transporter permease	NA	NA	NA	NA
WP_037094442.1\|207276_208248_-	ABC transporter permease	NA	NA	NA	NA
WP_037094456.1\|208318_209020_-	creatininase family protein	NA	NA	NA	NA
WP_065653707.1\|209249_209789_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_037094446.1\|209785_211378_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_037094459.1\|211436_212390_+	isoaspartyl peptidase/L-asparaginase	NA	NA	NA	NA
WP_037094450.1\|213152_213920_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_037094454.1\|214942_215395_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_065653663.1\|216801_217503_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.5e-40	43.8
WP_084796579.1\|217547_217784_-	hypothetical protein	NA	NA	NA	NA
WP_037095081.1\|217945_218536_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_034499453.1\|218528_219758_+	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_156779259.1\|220070_220815_+\|transposase	IS5-like element ISKpn12 family transposase	NA	NA	NA	NA
WP_156779260.1\|220863_221623_+\|transposase	IS5-like element ISKpn12 family transposase	NA	NA	NA	NA
WP_081950782.1\|221953_222709_-	DNA-processing protein DprA	S6BFL3	Thermus_phage	9.6e-38	41.6
223503:223533	attL	NA	NA	NA	NA
WP_037094818.1\|223622_224831_+\|integrase	tyrosine-type recombinase/integrase	W8EHC2	Mycobacterium_phage	1.4e-09	26.2
WP_037094814.1\|224830_225772_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_037094807.1\|225768_226758_+\|integrase	site-specific integrase	A0A142F1N9	Bacillus_phage	4.3e-22	27.3
WP_037094821.1\|226986_227820_-\|transposase	IS5 family transposase	NA	NA	NA	NA
226813:226843	attR	NA	NA	NA	NA

DBSCAN-SWA_4

314651 : 371988

Stx2-converting_phage(10.0%)

transposase,integrase

attL 315975:316034|attR 364423:373141

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_113731869.1\|314651_315790_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.8e-19	32.6
WP_080600525.1\|315973_316267_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	2.8e-17	56.1
315975:316034	attL	NA	NA	NA	NA
WP_006473175.1\|316475_317285_+	phosphonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.4e-13	26.4
WP_037094700.1\|317281_318130_+	phosphate/phosphite/phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_006473411.1\|318200_319007_+	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_003501101.1\|319020_320019_+	2-hydroxyacid dehydrogenase	M1GWB3	Acanthocystis_turfacea_Chlorella_virus	3.3e-17	27.6
WP_003501100.1\|320031_320952_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_024710158.1\|321298_321895_+	recombinase family protein	E5FFF9	Burkholderia_phage	2.4e-39	49.5
WP_003501095.1\|321887_323540_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_024710159.1\|323539_324517_+	AAA family ATPase	NA	NA	NA	NA
WP_052114287.1\|324672_325920_-	ATP-binding protein	NA	NA	NA	NA
WP_052114288.1\|325919_327131_-	SIR2 family protein	NA	NA	NA	NA
WP_143524116.1\|327461_328598_-	hypothetical protein	NA	NA	NA	NA
WP_143524117.1\|328657_329473_-	hypothetical protein	NA	NA	NA	NA
WP_037093587.1\|329548_330361_-	streptomycin kinase	NA	NA	NA	NA
WP_037093559.1\|330465_331020_-	recombinase family protein	A0A219YA40	Aeromonas_phage	6.6e-28	43.6
WP_037093560.1\|331214_332036_-	hypothetical protein	NA	NA	NA	NA
WP_037093561.1\|332235_333198_-	XcyI family restriction endonuclease	NA	NA	NA	NA
WP_037093562.1\|333194_334055_-	site-specific DNA-methyltransferase	S4VZJ3	Pandoravirus	1.8e-93	60.6
WP_037093565.1\|334738_337711_+	AAA family ATPase	A0A1B1IUG5	uncultured_Mediterranean_phage	3.8e-05	29.1
WP_037093566.1\|337754_338438_+	SOS response-associated peptidase	B7SYF4	Stenotrophomonas_phage	2.9e-25	43.3
WP_037093567.1\|338463_338760_+	hypothetical protein	NA	NA	NA	NA
WP_156779261.1\|338918_339089_-	hypothetical protein	NA	NA	NA	NA
WP_037093569.1\|340041_341313_-	Y-family DNA polymerase	A0A1W6JNT0	Morganella_phage	2.4e-89	44.4
WP_152596161.1\|341309_341696_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A218MND2	uncultured_virus	4.6e-20	44.9
WP_037093571.1\|341916_342264_+	hypothetical protein	NA	NA	NA	NA
WP_037093572.1\|342279_343029_+	hypothetical protein	NA	NA	NA	NA
WP_052114374.1\|343343_343862_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_037094739.1\|344586_345042_+	protein psiB	NA	NA	NA	NA
WP_037094741.1\|345182_346037_+	hypothetical protein	A0A2K9V3V9	Faecalibacterium_phage	7.8e-20	29.2
WP_037094737.1\|346065_346512_+	hypothetical protein	NA	NA	NA	NA
WP_037094735.1\|346522_346759_+	hypothetical protein	NA	NA	NA	NA
WP_037094732.1\|346805_347111_+	hypothetical protein	NA	NA	NA	NA
WP_081950768.1\|347293_347572_-	hypothetical protein	NA	NA	NA	NA
WP_037094726.1\|347757_349368_+	hypothetical protein	NA	NA	NA	NA
WP_037094723.1\|349357_350380_+	dienelactone hydrolase-related enzyme	NA	NA	NA	NA
WP_037094721.1\|350839_351037_+	hypothetical protein	NA	NA	NA	NA
WP_037094717.1\|351134_351386_+	hypothetical protein	NA	NA	NA	NA
WP_037094714.1\|351382_352438_-	ATP-dependent DNA ligase	A0A068CDF3	Rhizobium_phage	5.9e-110	59.2
WP_037094711.1\|352548_352755_+	hypothetical protein	NA	NA	NA	NA
WP_037093573.1\|353438_355367_+	ParB/RepB/Spo0J family partition protein	G8DH78	Emiliania_huxleyi_virus	1.5e-34	32.4
WP_037093574.1\|355435_355615_+	hypothetical protein	NA	NA	NA	NA
WP_037093576.1\|356197_357478_+	replication protein C	NA	NA	NA	NA
WP_081950730.1\|357492_357981_+	thermonuclease family protein	NA	NA	NA	NA
WP_037093578.1\|358376_358709_+	DUF736 family protein	NA	NA	NA	NA
WP_037093580.1\|358828_359035_+	antitoxin VbhA family protein	NA	NA	NA	NA
WP_037093581.1\|359088_360165_+	cell filamentation protein Fic	NA	NA	NA	NA
WP_037094818.1\|361102_362311_+\|integrase	tyrosine-type recombinase/integrase	W8EHC2	Mycobacterium_phage	1.4e-09	26.2
WP_037094814.1\|362310_363252_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_037094807.1\|363248_364238_+\|integrase	site-specific integrase	A0A142F1N9	Bacillus_phage	4.3e-22	27.3
WP_006473174.1\|364520_364715_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	1.7e-15	54.8
WP_006473175.1\|364923_365733_+	phosphonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.4e-13	26.4
WP_037094700.1\|365729_366578_+	phosphate/phosphite/phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_006473411.1\|366648_367455_+	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_003501101.1\|367468_368467_+	2-hydroxyacid dehydrogenase	M1GWB3	Acanthocystis_turfacea_Chlorella_virus	3.3e-17	27.6
WP_003501100.1\|368479_369400_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_024710158.1\|369746_370343_+	recombinase family protein	E5FFF9	Burkholderia_phage	2.4e-39	49.5
WP_003501095.1\|370335_371988_+\|transposase	IS481 family transposase	NA	NA	NA	NA
364423:373141	attR	NA	NA	NA	NA

DBSCAN-SWA_5

611089 : 685953

Enterobacteria_phage(20.0%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022563826.1\|611089_612604_-\|holin	choline-sulfatase	A0A1V0SA98	Catovirus	4.3e-21	24.7
WP_037092564.1\|612618_613572_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004444701.1\|613666_614563_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_037092565.1\|614592_616044_-	aldehyde dehydrogenase	NA	NA	NA	NA
WP_004444705.1\|616060_616783_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.1e-10	26.5
WP_037092566.1\|616775_617504_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_037092567.1\|617500_618409_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_037092568.1\|618405_619278_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_037092569.1\|619348_620563_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004444714.1\|621589_621889_-	HigA family addiction module antidote protein	B0VK57	Azospirillum_phage	3.8e-06	32.2
WP_006697304.1\|621944_622226_-	plasmid maintenance system killer	NA	NA	NA	NA
WP_037092570.1\|622300_623110_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.4e-13	24.1
WP_037092571.1\|623106_624075_-	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_037092572.1\|624077_625121_-	iron ABC transporter permease	NA	NA	NA	NA
WP_037092598.1\|625117_626125_-	iron-siderophore ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_037092573.1\|626346_628467_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_004444723.1\|628594_629470_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_081950676.1\|629712_629889_+	hypothetical protein	NA	NA	NA	NA
WP_037092574.1\|630015_632187_-	catalase/peroxidase HPI	NA	NA	NA	NA
WP_037092575.1\|632392_633301_+	hydrogen peroxide-inducible genes activator	NA	NA	NA	NA
WP_037092576.1\|633320_633863_-	NUDIX hydrolase	A0A1C3NEZ8	Phage_NCTB	6.3e-07	32.3
WP_022563805.1\|633976_634621_+	DUF47 domain-containing protein	NA	NA	NA	NA
WP_004444749.1\|634620_635625_+	inorganic phosphate transporter	E5ESL8	Bathycoccus_sp._RCC1105_virus	5.4e-12	27.6
WP_037092577.1\|635712_636504_+	Ku protein	NA	NA	NA	NA
WP_052114249.1\|636513_637401_-	DNA polymerase domain-containing protein	NA	NA	NA	NA
WP_034497990.1\|637507_638335_-	Ku protein	NA	NA	NA	NA
WP_004444758.1\|638331_638619_-	hypothetical protein	NA	NA	NA	NA
WP_004444761.1\|638660_639554_-	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	2.1e-68	48.2
WP_037092578.1\|639799_642139_-	EAL domain-containing protein	NA	NA	NA	NA
WP_037092579.1\|642325_643429_-	hypothetical protein	NA	NA	NA	NA
WP_052114252.1\|643691_645230_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_022563796.1\|645355_646336_-	TIM barrel protein	NA	NA	NA	NA
WP_004444769.1\|646403_647117_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_037092581.1\|647323_648352_+	ABC transporter permease	NA	NA	NA	NA
WP_037092583.1\|648348_649248_+	ABC transporter permease	NA	NA	NA	NA
WP_037092584.1\|649234_650080_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.6e-11	29.8
WP_037092600.1\|651068_651875_-	hypothetical protein	NA	NA	NA	NA
WP_037092585.1\|652017_653094_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	1.0e-24	34.5
WP_006697331.1\|653111_653954_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_037092586.1\|653943_654876_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_037092587.1\|654886_656158_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_037092588.1\|656207_657809_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_037092589.1\|657814_658885_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_037092590.1\|659083_659821_-	prolyl oligopeptidase family serine peptidase	NA	NA	NA	NA
WP_037092591.1\|660234_662301_+	ATP-dependent helicase	A7KV33	Bacillus_phage	5.4e-67	29.5
WP_037092592.1\|662655_663225_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	1.2e-35	42.8
WP_037092593.1\|663227_664283_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	6.3e-96	52.2
WP_037092594.1\|664287_665181_+	dTDP-4-dehydrorhamnose reductase	I7HXC9	Enterobacteria_phage	5.3e-35	37.0
WP_052114250.1\|665177_666089_+	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	2.8e-92	58.1
WP_037092595.1\|666133_667282_+	acyltransferase	NA	NA	NA	NA
WP_113731869.1\|668881_670019_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.8e-19	32.6
WP_037094903.1\|670449_671799_-	FkbM family methyltransferase	M4QNU8	Ostreococcus_lucimarinus_virus	2.7e-06	27.6
WP_081950774.1\|671842_674599_-	hypothetical protein	NA	NA	NA	NA
WP_034498049.1\|674855_675128_-	hypothetical protein	NA	NA	NA	NA
WP_037095010.1\|678430_679324_-	ATPase AAA	U5N3V8	Enterobacteria_phage	6.9e-35	33.8
WP_037095007.1\|679320_680820_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_113731869.1\|682278_683416_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.8e-19	32.6
WP_034499355.1\|683562_683946_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_037095105.1\|683942_684287_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	8.6e-10	31.6
WP_065653644.1\|684360_685953_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	3.4e-53	32.9

DBSCAN-SWA_6

1122803 : 1158955

uncultured_Caudovirales_phage(50.0%)

transposase,integrase

attL 1113896:1113910|attR 1166329:1166343

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1113896:1113910	attL	NA	NA	NA	NA
WP_052821263.1\|1122803_1124303_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_003501246.1\|1124304_1125039_+	ATPase	A0A2L1IVB6	Escherichia_phage	1.5e-32	31.2
WP_113731869.1\|1125266_1126404_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.8e-19	32.6
WP_156779265.1\|1126488_1126830_-	hypothetical protein	NA	NA	NA	NA
WP_152596160.1\|1126921_1127290_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_052114285.1\|1127296_1129081_-	PAS domain S-box protein	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-14	36.0
WP_037093519.1\|1129352_1132133_-	EAL domain-containing protein	NA	NA	NA	NA
WP_037093520.1\|1132405_1132801_-	DUF2513 domain-containing protein	A0A1Q1PVT8	Staphylococcus_phage	1.6e-07	27.6
WP_037093521.1\|1132835_1133042_-	hypothetical protein	NA	NA	NA	NA
WP_037093522.1\|1133429_1133924_-	hypothetical protein	NA	NA	NA	NA
WP_037093523.1\|1133927_1134992_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_037093524.1\|1135196_1136141_+	nucleotidyltransferase	NA	NA	NA	NA
WP_037093525.1\|1136142_1136637_+	hypothetical protein	NA	NA	NA	NA
WP_037093526.1\|1136633_1137530_+	AAA family ATPase	NA	NA	NA	NA
WP_037093527.1\|1137529_1138696_+	hypothetical protein	NA	NA	NA	NA
WP_052114286.1\|1138692_1139280_+	3'-5' exonuclease	NA	NA	NA	NA
WP_037093528.1\|1139408_1140362_+	hypothetical protein	NA	NA	NA	NA
WP_152596159.1\|1140425_1141547_-	DUF1612 domain-containing protein	NA	NA	NA	NA
WP_037093530.1\|1142076_1142994_+	DNA invertase	A0A0F7LA37	Escherichia_phage	1.6e-31	51.7
WP_084796572.1\|1142953_1144054_-	hypothetical protein	NA	NA	NA	NA
WP_037093535.1\|1144050_1144974_-	AAA family ATPase	NA	NA	NA	NA
WP_037093536.1\|1144964_1146602_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_037093537.1\|1146725_1147931_-	arsenite efflux MFS transporter ArsK	NA	NA	NA	NA
WP_081950729.1\|1147927_1148635_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	2.9e-89	70.8
WP_037093539.1\|1148627_1149050_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	5.3e-46	62.8
WP_065653681.1\|1149055_1150096_-	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_037093541.1\|1150100_1150544_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_037093542.1\|1150540_1151071_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	1.1e-27	42.0
WP_037093543.1\|1151067_1151424_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_037093544.1\|1151465_1151987_+	hypothetical protein	NA	NA	NA	NA
WP_037093545.1\|1152191_1152695_+	low molecular weight phosphatase family protein	A0A2H4J437	uncultured_Caudovirales_phage	2.9e-06	32.4
WP_037093547.1\|1152691_1153330_-	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
WP_037093549.1\|1153361_1153571_-	hypothetical protein	NA	NA	NA	NA
WP_037093551.1\|1153702_1154014_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_037093553.1\|1153985_1155215_+	chromate efflux transporter	NA	NA	NA	NA
WP_037093554.1\|1155231_1156026_+	rhodanese family protein	NA	NA	NA	NA
WP_065653682.1\|1157040_1157787_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	2.0e-40	43.8
WP_081950783.1\|1157767_1158955_-\|transposase	IS110 family transposase	NA	NA	NA	NA
1166329:1166343	attR	NA	NA	NA	NA

DBSCAN-SWA_7

1563254 : 1595021

Escherichia_phage(20.0%)

transposase,integrase

attL 1570812:1570841|attR 1574121:1574150

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065653688.1\|1563254_1564007_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.6e-40	43.8
WP_037094892.1\|1564803_1565187_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_037094899.1\|1565183_1565384_-	DUF2191 domain-containing protein	NA	NA	NA	NA
WP_052114357.1\|1565539_1566586_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.2e-11	28.1
WP_037094889.1\|1566585_1567563_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-17	29.0
WP_037094887.1\|1567559_1568474_-	ABC transporter permease	NA	NA	NA	NA
WP_052114356.1\|1568477_1569398_-	ABC transporter permease	NA	NA	NA	NA
WP_037094877.1\|1569483_1570170_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.9e-41	44.3
1570812:1570841	attL	NA	NA	NA	NA
WP_037094807.1\|1570895_1571885_-\|integrase	site-specific integrase	A0A142F1N9	Bacillus_phage	4.3e-22	27.3
WP_037094814.1\|1571881_1572823_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_037094818.1\|1572822_1574031_-\|integrase	tyrosine-type recombinase/integrase	W8EHC2	Mycobacterium_phage	1.4e-09	26.2
WP_037094052.1\|1574486_1574858_+	DUF2958 domain-containing protein	A0A1W6DX76	Sphingobium_phage	4.4e-20	47.1
1574121:1574150	attR	NA	NA	NA	NA
WP_052114322.1\|1574857_1575637_+	hypothetical protein	NA	NA	NA	NA
WP_052114321.1\|1575633_1576068_+	hypothetical protein	NA	NA	NA	NA
WP_037094050.1\|1576394_1578536_+	chromosome partitioning protein ParB	G8DH78	Emiliania_huxleyi_virus	2.0e-27	28.7
WP_037094056.1\|1578636_1578903_+	hypothetical protein	NA	NA	NA	NA
WP_037094048.1\|1578899_1579196_+	hypothetical protein	NA	NA	NA	NA
WP_122521009.1\|1579619_1579784_+	hypothetical protein	NA	NA	NA	NA
WP_037094047.1\|1579959_1580325_+	nuclease	NA	NA	NA	NA
WP_037094044.1\|1580456_1581014_+	hypothetical protein	NA	NA	NA	NA
WP_037094041.1\|1581082_1581484_+	hypothetical protein	NA	NA	NA	NA
WP_037094038.1\|1581493_1581688_+	hypothetical protein	NA	NA	NA	NA
WP_037094036.1\|1581759_1582176_+	hypothetical protein	NA	NA	NA	NA
WP_037094034.1\|1582970_1587326_+	methylase	A0A076FMQ0	Aureococcus_anophage	4.9e-17	31.2
WP_037094032.1\|1587325_1588369_+	DNA primase	A0A2I7R8M6	Vibrio_phage	3.8e-08	31.7
WP_037094055.1\|1588700_1589636_+	DUF2493 domain-containing protein	NA	NA	NA	NA
WP_037094029.1\|1589776_1590193_+	hypothetical protein	NA	NA	NA	NA
WP_037094027.1\|1590915_1591317_+	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_037094024.1\|1591809_1592184_+	hypothetical protein	NA	NA	NA	NA
WP_151691280.1\|1592738_1593137_-	transcriptional regulator	NA	NA	NA	NA
WP_037092225.1\|1593254_1594100_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_037092224.1\|1594107_1594515_+	DoxX family protein	NA	NA	NA	NA
WP_081950654.1\|1594514_1595021_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_8

1896287 : 1910726

Sinorhizobium_phage(41.67%)

terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081950725.1\|1896287_1897469_+	DNA cytosine methyltransferase	A0A1C9LW16	Vibrio_phage	1.4e-19	37.7
WP_037093397.1\|1897465_1897807_+	hypothetical protein	NA	NA	NA	NA
WP_037093396.1\|1897803_1898637_+	phosphoadenosine phosphosulfate reductase family protein	NA	NA	NA	NA
WP_037093394.1\|1898633_1899416_+	hypothetical protein	NA	NA	NA	NA
WP_037093392.1\|1899412_1899874_+	hypothetical protein	NA	NA	NA	NA
WP_037093391.1\|1899870_1900749_+	hypothetical protein	A0A141GF38	Brucella_phage	2.7e-23	33.1
WP_152596150.1\|1901294_1901621_-	hypothetical protein	A0A2D2W6B5	Pectobacterium_phage	1.1e-06	46.9
WP_037093387.1\|1901642_1902209_+\|terminase	terminase	A0A076GD11	Sinorhizobium_phage	2.8e-42	49.7
WP_037093386.1\|1902212_1903547_+	DNA-packaging protein	Q1WDG8	Streptomyces_phage	4.9e-37	42.1
WP_037093384.1\|1903546_1905400_+	DUF1073 domain-containing protein	A0A2H4J4I9	uncultured_Caudovirales_phage	4.6e-126	42.5
WP_037093383.1\|1905405_1906557_+	DUF2213 domain-containing protein	A0A059VF71	Pseudomonas_phage	5.2e-43	36.7
WP_037093381.1\|1906560_1907034_+	hypothetical protein	A0A2D2W1Z4	Sinorhizobium_phage	4.0e-18	41.2
WP_037093379.1\|1907037_1908024_+	DUF2184 domain-containing protein	A0A2D2W280	Sinorhizobium_phage	3.4e-91	53.4
WP_037093378.1\|1908085_1908370_+	hypothetical protein	NA	NA	NA	NA
WP_037093377.1\|1908374_1908869_+	hypothetical protein	A0A076G6I4	Sinorhizobium_phage	2.3e-24	48.1
WP_037093376.1\|1908869_1909226_+	hypothetical protein	NA	NA	NA	NA
WP_037093375.1\|1909234_1909609_+	hypothetical protein	NA	NA	NA	NA
WP_152596149.1\|1909632_1910304_+	hypothetical protein	M4R217	Salicola_phage	2.4e-32	40.4
WP_052114277.1\|1910303_1910726_+	HK97 gp10 family phage protein	A0A076G8G8	Sinorhizobium_phage	3.0e-12	35.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP016320

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

374739 : 430702

Escherichia_phage(16.67%)

tail,transposase,head,terminase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_037089165.1\|374739_375756_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_004441645.1\|375752_376901_+	nitrogen regulation protein NR(II)	W8CYF6	Bacillus_phage	2.4e-08	24.7
WP_004441656.1\|376897_378349_+	nitrogen regulation protein NR(I)	NA	NA	NA	NA
WP_035208859.1\|378499_380761_+	PAS domain-containing sensor histidine kinase	NA	NA	NA	NA
WP_004441661.1\|380750_382115_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_037089168.1\|382164_383541_+	Trk system potassium transporter TrkA	NA	NA	NA	NA
WP_004441666.1\|383725_384208_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_037089259.1\|384391_385723_+	GTPase HflX	NA	NA	NA	NA
WP_037089260.1\|385795_386152_-	VOC family protein	NA	NA	NA	NA
WP_035208858.1\|386163_386568_-	polyketide cyclase	NA	NA	NA	NA
WP_037089170.1\|386689_388273_+	cytochrome c oxidase accessory protein CcoG	NA	NA	NA	NA
WP_037089172.1\|388269_388770_+	FixH family protein	NA	NA	NA	NA
WP_081950386.1\|388766_391058_+	cadmium-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.3e-72	29.6
WP_037089176.1\|391054_391228_+	cbb3-type cytochrome oxidase assembly protein CcoS	NA	NA	NA	NA
WP_006697538.1\|391355_392786_+	NADP-dependent phosphogluconate dehydrogenase	E3SJC4	Synechococcus_phage	1.7e-27	29.6
WP_004441687.1\|392851_393175_-	membrane protein	NA	NA	NA	NA
WP_037089179.1\|393354_394386_-	L-glyceraldehyde 3-phosphate reductase	NA	NA	NA	NA
WP_037089183.1\|397461_398514_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_037089185.1\|398574_399594_-	zinc ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_037089187.1\|399698_400646_+	metal ABC transporter ATP-binding protein	A0A2H4UUX5	Bodo_saltans_virus	4.3e-11	27.4
WP_004441703.1\|400638_401457_+	zinc ABC transporter permease subunit ZnuB	NA	NA	NA	NA
WP_004441705.1\|401453_401867_+	transcriptional repressor	NA	NA	NA	NA
WP_037089188.1\|401906_402440_-	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_037089190.1\|402467_403157_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_037089192.1\|403294_404305_+\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_037089194.1\|404311_405112_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_037089196.1\|405168_408090_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	62.1
WP_004441725.1\|408396_408933_+	single-stranded DNA-binding protein	R9TP78	Rhizobium_phage	1.8e-46	74.2
WP_037089197.1\|408972_409230_+	hypothetical protein	NA	NA	NA	NA
WP_022556124.1\|409284_410433_-	HPP family protein	NA	NA	NA	NA
WP_035208833.1\|410560_411190_-	MarC family protein	NA	NA	NA	NA
WP_004441736.1\|411406_414199_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	3.6e-98	33.4
WP_004441743.1\|414291_414552_-	hypothetical protein	NA	NA	NA	NA
WP_077987111.1\|414634_416128_-	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_004441745.1\|416267_416987_-	hypothetical protein	NA	NA	NA	NA
WP_004441746.1\|417118_417382_+	hypothetical protein	NA	NA	NA	NA
WP_037089202.1\|417397_417625_+	hypothetical protein	NA	NA	NA	NA
WP_077987112.1\|417954_418119_+	hypothetical protein	NA	NA	NA	NA
WP_037089204.1\|418414_418609_+	hypothetical protein	NA	NA	NA	NA
WP_037089206.1\|418605_418839_+	hypothetical protein	NA	NA	NA	NA
WP_065653606.1\|419844_420207_-	hypothetical protein	NA	NA	NA	NA
WP_156779242.1\|420218_421520_-	hypothetical protein	A0A1W6JP49	Morganella_phage	5.7e-14	64.8
WP_003501246.1\|421784_422519_-	ATPase	A0A2L1IVB6	Escherichia_phage	1.5e-32	31.2
WP_052821263.1\|422520_424020_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_003501246.1\|424234_424969_-	ATPase	A0A2L1IVB6	Escherichia_phage	1.5e-32	31.2
WP_052821263.1\|424970_426470_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_037094234.1\|426576_427194_-	hypothetical protein	A0A291AUM6	Sinorhizobium_phage	1.6e-35	67.7
WP_052114331.1\|427190_428849_-\|terminase	terminase large subunit	A0A2K5B285	Erysipelothrix_phage	7.9e-77	35.4
WP_052114330.1\|428832_429261_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_037094230.1\|429257_429575_-\|head	phage head closure protein	NA	NA	NA	NA
WP_037094227.1\|429571_429985_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_037094224.1\|429981_430401_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_037094221.1\|430393_430702_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA

DBSCAN-SWA_2

606498 : 614691

uncultured_Mediterranean_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_037093473.1\|606498_608031_+	AMP-binding protein	A0A2K9KZV5	Tupanvirus	2.2e-20	23.0
WP_081950726.1\|608110_609292_+	type III PLP-dependent enzyme	NA	NA	NA	NA
WP_037093477.1\|609292_610450_-	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	5.2e-43	43.1
WP_004442089.1\|610641_611772_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	2.1e-105	53.0
WP_037093470.1\|611771_612854_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_037093468.1\|613052_613562_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	1.1e-45	58.1
WP_004442095.1\|613598_614168_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	8.5e-47	53.8
WP_004442098.1\|614196_614691_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	1.9e-26	37.7

DBSCAN-SWA_3

631069 : 639472

uncultured_Mediterranean_phage(75.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080822811.1\|631069_632680_-	LysM peptidoglycan-binding domain-containing M23 family metallopeptidase	I3PV24	Clostridium_phage	1.1e-11	30.4
WP_080822813.1\|632980_633622_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1J0MC37	Streptomyces_phage	1.0e-11	35.1
WP_004442133.1\|633630_634401_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.8e-23	29.8
WP_037093446.1\|634574_635858_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	8.2e-98	45.8
WP_022556270.1\|635959_636763_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	2.4e-42	40.7
WP_037093445.1\|636759_637506_-	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_003509722.1\|637562_637769_-	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	2.1e-08	69.8
WP_004442146.1\|637899_638634_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	3.4e-40	47.1
WP_034498970.1\|638626_639472_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.5e-34	34.7

DBSCAN-SWA_4

2256171 : 2265759

Sinorhizobium_phage(44.44%)

integrase

attL 2254857:2254903|attR 2269225:2269271

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2254857:2254903	attL	NA	NA	NA	NA
WP_037089334.1\|2256171_2257203_-\|integrase	tyrosine-type recombinase/integrase	F8TUV0	EBPR_podovirus	1.9e-36	33.6
WP_037089333.1\|2257189_2257417_-	hypothetical protein	NA	NA	NA	NA
WP_065653627.1\|2257675_2258161_-	hypothetical protein	H2BD37	Pseudomonas_phage	3.4e-20	45.9
WP_052114178.1\|2258157_2258604_-	ASCH domain-containing protein	A0A291AUQ6	Sinorhizobium_phage	1.2e-40	57.1
WP_037089332.1\|2258600_2259056_-	hypothetical protein	NA	NA	NA	NA
WP_037089331.1\|2259070_2259514_-	hypothetical protein	NA	NA	NA	NA
WP_037089330.1\|2259503_2259692_-	hypothetical protein	NA	NA	NA	NA
WP_037089329.1\|2259750_2260656_-	DUF2303 family protein	A0A291AUR3	Sinorhizobium_phage	3.1e-107	62.3
WP_037089328.1\|2260715_2261048_-	hypothetical protein	A0A291AUR5	Sinorhizobium_phage	3.6e-37	74.3
WP_125270256.1\|2261078_2261279_-	hypothetical protein	NA	NA	NA	NA
WP_152596117.1\|2261338_2261602_-	hypothetical protein	NA	NA	NA	NA
WP_037089325.1\|2261659_2261842_-	hypothetical protein	NA	NA	NA	NA
WP_155276033.1\|2261905_2262052_-	hypothetical protein	NA	NA	NA	NA
WP_037089324.1\|2262054_2262477_-	tellurite resistance TerB family protein	A0A1Y0T181	Sinorhizobium_phage	1.5e-24	48.8
WP_037089323.1\|2262751_2263099_-	helix-turn-helix transcriptional regulator	A0A068C9F0	Rhizobium_phage	2.3e-39	67.0
WP_037089322.1\|2263194_2263425_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_037089321.1\|2263634_2264126_+	hypothetical protein	R9TQJ7	Rhizobium_phage	9.6e-47	63.0
WP_037089320.1\|2264122_2264374_+	hypothetical protein	NA	NA	NA	NA
WP_081950449.1\|2264613_2265759_+	SAM-dependent methyltransferase	A0A068C9F4	Rhizobium_phage	1.6e-124	62.5
2269225:2269271	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2337237 : 2379617

Rhizobium_phage(45.45%)

tail,transposase,capsid,head,integrase,terminase,portal

attL 2337023:2337074|attR 2380606:2380657

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2337023:2337074	attL	NA	NA	NA	NA
WP_037092357.1\|2337237_2338404_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_037092358.1\|2338591_2338855_-	hypothetical protein	NA	NA	NA	NA
WP_037092359.1\|2338854_2339142_-	hypothetical protein	NA	NA	NA	NA
WP_152596134.1\|2339145_2339547_-	hypothetical protein	NA	NA	NA	NA
WP_152596135.1\|2339550_2340396_-	hypothetical protein	NA	NA	NA	NA
WP_037092363.1\|2340398_2340611_-	hypothetical protein	NA	NA	NA	NA
WP_081950660.1\|2340770_2341139_-	hypothetical protein	NA	NA	NA	NA
WP_037092364.1\|2341233_2341971_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_037092367.1\|2342602_2343205_-	hypothetical protein	B4UTV8	Rhizobium_phage	1.5e-41	44.4
WP_037092368.1\|2343310_2343718_+	hypothetical protein	B4UTW7	Rhizobium_phage	2.0e-42	69.3
WP_037092369.1\|2343756_2344116_+	hypothetical protein	B4UTW0	Rhizobium_phage	1.4e-07	40.5
WP_037092370.1\|2344112_2344394_+	hypothetical protein	B4UTW1	Rhizobium_phage	2.6e-28	60.4
WP_037092430.1\|2344707_2344908_+	hypothetical protein	NA	NA	NA	NA
WP_037092371.1\|2344907_2345135_+	hypothetical protein	NA	NA	NA	NA
WP_037092373.1\|2345224_2345992_+	ATP-binding protein	B4UTW5	Rhizobium_phage	3.9e-119	79.0
WP_037092375.1\|2345991_2346630_+	HNH endonuclease	B4UTX2	Rhizobium_phage	1.8e-37	41.5
WP_037092376.1\|2346666_2347224_+	DUF669 domain-containing protein	NA	NA	NA	NA
WP_037092378.1\|2347286_2348039_+	hypothetical protein	A0A2I7SC26	Paenibacillus_phage	3.2e-33	32.4
WP_037092379.1\|2348099_2349152_+	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	3.4e-97	56.3
WP_037092380.1\|2349155_2349353_+	hypothetical protein	NA	NA	NA	NA
WP_081950661.1\|2349312_2349549_+	hypothetical protein	A0A0F6SJ45	Sinorhizobium_phage	3.7e-28	83.8
WP_037092383.1\|2349548_2350478_+	hypothetical protein	B4UTX3	Rhizobium_phage	2.4e-155	83.1
WP_037092384.1\|2350500_2351037_+	sigma-70 family RNA polymerase sigma factor	B4UTX4	Rhizobium_phage	4.2e-11	33.6
WP_037092385.1\|2351037_2351394_+	hypothetical protein	B4UTY2	Rhizobium_phage	6.5e-53	83.6
WP_037092386.1\|2351394_2353149_+	DEAD/DEAH box helicase	B4UTX6	Rhizobium_phage	9.4e-137	43.5
WP_152596136.1\|2353237_2353450_+	hypothetical protein	NA	NA	NA	NA
WP_037092388.1\|2353446_2353980_+	hypothetical protein	NA	NA	NA	NA
WP_037092389.1\|2353979_2354189_+	hypothetical protein	NA	NA	NA	NA
WP_037092390.1\|2354185_2354434_+	hypothetical protein	NA	NA	NA	NA
WP_037092391.1\|2354496_2355042_+	MT-A70 family protein	A0A1V0DX34	Synechococcus_virus	1.3e-44	50.3
WP_037092392.1\|2355041_2356430_+	DUF4942 domain-containing protein	A0A2I7RNS1	Vibrio_phage	1.0e-08	29.2
WP_037092394.1\|2356426_2356801_+	hypothetical protein	B4UTY6	Rhizobium_phage	5.6e-31	52.8
WP_052114240.1\|2356800_2358882_+	hypothetical protein	Q6V7R9	Burkholderia_virus	8.2e-63	31.7
WP_152596139.1\|2358721_2359201_-	hypothetical protein	A0A2I7R0N5	Vibrio_phage	6.6e-08	44.8
WP_052114242.1\|2359556_2361818_+	AAA family ATPase	B4UTY9	Rhizobium_phage	1.4e-63	45.0
WP_081950663.1\|2362124_2363039_+	hypothetical protein	A0A1B0VME2	Pseudomonas_phage	9.8e-45	53.9
WP_037092395.1\|2363038_2363515_+	hypothetical protein	NA	NA	NA	NA
WP_037092396.1\|2363643_2364132_+	VRR-NUC domain-containing protein	B4UTZ1	Rhizobium_phage	8.6e-48	68.4
WP_037092397.1\|2364172_2365126_+	hypothetical protein	NA	NA	NA	NA
WP_152596137.1\|2365599_2366277_+	hypothetical protein	A0A2K9VGY0	Gordonia_phage	1.3e-12	43.6
WP_037092401.1\|2366689_2367073_+	hypothetical protein	NA	NA	NA	NA
WP_081950665.1\|2366990_2368970_+\|terminase	terminase	A0A0U2C138	Paracoccus_phage	6.6e-155	49.3
WP_037092402.1\|2368994_2370224_+\|portal	phage portal protein	A0A0U4IIV7	Pseudomonas_phage	6.5e-68	38.0
WP_037092404.1\|2370233_2371355_+	S49 family peptidase	K4HZZ6	Acidithiobacillus_phage	5.6e-34	34.7
WP_037092405.1\|2371363_2372569_+\|capsid	phage major capsid protein	Q6JIM7	Burkholderia_virus	3.2e-112	57.3
WP_152596138.1\|2372671_2373382_+	hypothetical protein	B4UTY8	Rhizobium_phage	3.7e-23	45.7
WP_037092407.1\|2373416_2373683_+	hypothetical protein	NA	NA	NA	NA
WP_037092408.1\|2373660_2374002_+	hypothetical protein	A0A0H4INV0	Stenotrophomonas_phage	1.1e-06	51.3
WP_037092409.1\|2374003_2374351_+\|head,tail	phage gp6-like head-tail connector protein	A0A2H4J711	uncultured_Caudovirales_phage	1.8e-07	38.4
WP_037092411.1\|2374476_2374833_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_037092412.1\|2374829_2375324_+	phage protein, HK97 gp10 family	NA	NA	NA	NA
WP_037092413.1\|2375323_2375734_+	DUF3168 domain-containing protein	I3UM06	Rhodobacter_phage	9.3e-11	39.0
WP_013636135.1\|2375768_2376200_+\|tail	phage tail protein	NA	NA	NA	NA
WP_113731869.1\|2376612_2377750_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.8e-19	32.6
WP_065653631.1\|2377768_2379199_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	8.7e-40	28.3
WP_037095105.1\|2379272_2379617_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	8.6e-10	31.6
2380606:2380657	attR	NA	NA	NA	NA

DBSCAN-SWA_6

2680286 : 2714654

Rhizobium_phage(37.5%)

protease,tail,capsid,integrase,head,terminase,portal

attL 2680133:2680181|attR 2721494:2721542

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2680133:2680181	attL	NA	NA	NA	NA
WP_037090930.1\|2680286_2681138_-\|integrase	tyrosine-type recombinase/integrase	A0A291AUQ3	Sinorhizobium_phage	4.3e-119	71.7
WP_052114203.1\|2681595_2682135_-	hypothetical protein	A0A068C9C1	Rhizobium_phage	5.8e-21	37.7
WP_037090756.1\|2682131_2682317_-	hypothetical protein	NA	NA	NA	NA
WP_037090755.1\|2682309_2682648_-	hypothetical protein	NA	NA	NA	NA
WP_052114202.1\|2682647_2682881_-	hypothetical protein	NA	NA	NA	NA
WP_152596127.1\|2682877_2683501_-	hypothetical protein	NA	NA	NA	NA
WP_052114201.1\|2683493_2683877_-	hypothetical protein	A0A240F4V4	Ochrobactrum_phage	4.3e-34	60.2
WP_037090751.1\|2683876_2684422_-	hypothetical protein	NA	NA	NA	NA
WP_037090750.1\|2684421_2684895_-	hypothetical protein	R9TRR2	Rhizobium_phage	5.3e-18	39.0
WP_037090749.1\|2684897_2686070_-	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	6.3e-36	30.8
WP_052114200.1\|2686094_2687060_-	DUF5131 family protein	A0A240F4U9	Ochrobactrum_phage	6.1e-61	50.4
WP_037090748.1\|2687052_2687343_-	hypothetical protein	NA	NA	NA	NA
WP_037090747.1\|2687441_2687792_-	hypothetical protein	NA	NA	NA	NA
WP_037090744.1\|2688160_2688754_+	hypothetical protein	NA	NA	NA	NA
WP_152596125.1\|2688774_2688975_-	hypothetical protein	NA	NA	NA	NA
WP_037090742.1\|2689034_2689217_-	hypothetical protein	R9TP82	Rhizobium_phage	2.6e-05	42.9
WP_037090926.1\|2689485_2690175_-	hypothetical protein	R9TRS6	Rhizobium_phage	3.5e-111	86.5
WP_037090740.1\|2690932_2691409_+	hypothetical protein	A0A291AUS4	Sinorhizobium_phage	1.4e-21	44.4
WP_156779249.1\|2691417_2691573_+	hypothetical protein	NA	NA	NA	NA
WP_037090739.1\|2691569_2691806_+	hypothetical protein	NA	NA	NA	NA
WP_081950562.1\|2691805_2692129_+	DUF2312 domain-containing protein	A0A2L0V115	Agrobacterium_phage	6.4e-15	48.5
WP_081950561.1\|2692125_2693643_+	hypothetical protein	NA	NA	NA	NA
WP_037090737.1\|2693639_2695559_+	DNA methyltransferase	A0A291AUL2	Sinorhizobium_phage	6.0e-286	79.1
WP_037090735.1\|2695555_2695849_+	hypothetical protein	NA	NA	NA	NA
WP_037090733.1\|2695862_2697107_+	helix-turn-helix domain-containing protein	A0A291AUK7	Sinorhizobium_phage	1.4e-73	41.7
WP_037090731.1\|2697093_2697744_+	hypothetical protein	NA	NA	NA	NA
WP_037090730.1\|2697907_2698270_+	HNH endonuclease	I3ULZ4	Rhodobacter_phage	5.1e-29	50.4
WP_037090729.1\|2698596_2699076_+	resolvase	I3ULZ5	Rhodobacter_phage	2.4e-26	54.9
WP_037090728.1\|2699075_2700788_+\|terminase	terminase large subunit	A0A0P0ZEI4	Stx2-converting_phage	3.3e-126	44.6
WP_052114210.1\|2700896_2702108_+\|portal	phage portal protein	A0A141GEV9	Brucella_phage	1.7e-121	55.6
WP_037090726.1\|2702073_2702928_+\|protease	Clp protease ClpP	A0A141GEW1	Brucella_phage	5.5e-114	73.4
WP_052114209.1\|2703073_2704321_+\|capsid	phage major capsid protein	Q3HQT0	Burkholderia_phage	1.1e-136	60.0
WP_037090725.1\|2704382_2704703_+	hypothetical protein	NA	NA	NA	NA
WP_037090724.1\|2704760_2705369_+	hypothetical protein	A0A141GEW4	Brucella_phage	4.1e-15	33.5
WP_037090723.1\|2705365_2705701_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_037090722.1\|2705700_2706135_+	hypothetical protein	NA	NA	NA	NA
WP_037090721.1\|2706145_2706517_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_037090720.1\|2706513_2706951_+\|tail	tail protein	NA	NA	NA	NA
WP_037090718.1\|2706950_2707304_+	hypothetical protein	NA	NA	NA	NA
WP_152596124.1\|2707597_2708077_-	hypothetical protein	NA	NA	NA	NA
WP_052114199.1\|2708140_2710447_+	hypothetical protein	A0A0H4ADF4	Pseudoalteromonas_phage	2.2e-40	43.8
WP_037090715.1\|2710439_2711153_+	hypothetical protein	B4UTQ7	Rhizobium_phage	1.3e-65	55.6
WP_037090713.1\|2711152_2711719_+	hypothetical protein	B4UTQ9	Rhizobium_phage	4.9e-63	60.8
WP_037090712.1\|2711773_2712109_-	hypothetical protein	NA	NA	NA	NA
WP_152596129.1\|2712189_2712564_+	hypothetical protein	B4UTR0	Rhizobium_phage	2.1e-30	54.0
WP_037090921.1\|2712590_2714654_+	hypothetical protein	B4UTR1	Rhizobium_phage	6.3e-249	62.5
2721494:2721542	attR	NA	NA	NA	NA

DBSCAN-SWA_7

2853080 : 2861079

Geobacillus_phage(33.33%)

tail,head,protease,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_037091720.1\|2853080_2854247_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	1.0e-62	38.7
WP_003509186.1\|2854434_2854755_+	hypothetical protein	NA	NA	NA	NA
WP_037091542.1\|2854783_2855374_+\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	4.1e-28	44.1
WP_037091540.1\|2856842_2857412_+	hypothetical protein	NA	NA	NA	NA
WP_006700095.1\|2857415_2857757_+\|head	phage head closure protein	NA	NA	NA	NA
WP_004440751.1\|2857753_2858149_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_080823032.1\|2858155_2859265_-	MFS transporter	NA	NA	NA	NA
WP_004440755.1\|2859444_2859852_+\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_004440758.1\|2859851_2860211_+	gene transfer agent family protein	NA	NA	NA	NA
WP_081950612.1\|2860207_2860453_+\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_037091537.1\|2860497_2861079_+\|tail	phage tail tape measure protein	C0LP53	Escherichia_virus	1.0e-10	42.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP016433

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP016320

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection