CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP010886	Vibrio parahaemolyticus strain CHN25 plasmid P2, complete sequence	0 crisprs	NA	0
NZ_CP010885	Vibrio parahaemolyticus strain CHN25 plasmid P1, complete sequence	0 crisprs	NA	1
NZ_CP010883	Vibrio parahaemolyticus strain CHN25 chromosome 1, complete sequence	0 crisprs	cas3,DinG,csa3,csx1,DEDDh,WYL	5
NZ_CP010887	Vibrio parahaemolyticus strain CHN25 plasmid P3, complete sequence	0 crisprs	NA	0
NZ_CP010884	Vibrio parahaemolyticus strain CHN25 chromosome 2, complete sequence	1 crisprs	DEDDh,RT,WYL,csa3,cas3	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

740638 : 747340

Staphylococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005483011.1\|740638_741778_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.3e-62	41.7
WP_005496257.1\|741795_743046_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	3.6e-98	47.9
WP_005482986.1\|743173_743623_+	transcriptional regulator NrdR	NA	NA	NA	NA
WP_025625922.1\|743630_744755_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	4.0e-48	36.0
WP_005483039.1\|744767_745421_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.6e-33	37.5
WP_020840184.1\|745590_746700_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.0e-63	39.6
WP_005440184.1\|746869_747340_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-32	49.3

DBSCAN-SWA_2

804961 : 846755

Vibrio_phage(91.11%)

plate,tRNA,tail,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005496173.1\|804961_805552_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_005496171.1\|805703_806648_-	ribose-phosphate pyrophosphokinase	A0A2K9L2G2	Tupanvirus	1.1e-43	36.9
WP_021484829.1\|806676_807549_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_015296355.1\|807545_808184_-	lipoprotein localization protein LolB	NA	NA	NA	NA
WP_005496164.1\|808318_809575_+\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_005456867.1\|809604_810693_+	peptide chain release factor 1	NA	NA	NA	NA
WP_020904133.1\|810696_811554_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_005468486.1\|811595_811979_+	SirB2 family protein	NA	NA	NA	NA
WP_005481357.1\|811984_812794_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_005457350.1\|812848_813700_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	4.4e-47	41.1
WP_062853710.1\|815212_815659_-	S24 family peptidase	A0A2I7S9A5	Vibrio_phage	6.6e-71	87.9
WP_062853662.1\|816120_816378_+	transcriptional regulator	A0A2I7S995	Vibrio_phage	7.5e-19	61.4
WP_062853661.1\|816389_818381_+	DDE endonuclease	A0A2I7S9A8	Vibrio_phage	2.0e-300	76.1
WP_065870363.1\|818416_819364_+	AAA family ATPase	M4M9P4	Vibrio_phage	1.4e-150	86.3
WP_065870364.1\|819372_819612_+	hypothetical protein	NA	NA	NA	NA
WP_153993905.1\|819615_819768_+	hypothetical protein	NA	NA	NA	NA
WP_065870365.1\|819776_820166_+	hypothetical protein	NA	NA	NA	NA
WP_065870366.1\|820158_820482_+	hypothetical protein	A0A2I7S9B1	Vibrio_phage	6.6e-20	48.6
WP_065870367.1\|820492_820696_+	hypothetical protein	NA	NA	NA	NA
WP_065870368.1\|820697_821333_+	DUF3164 family protein	A0A2D1GNM4	Pseudomonas_phage	2.2e-43	42.0
WP_062853654.1\|821345_821618_+	hypothetical protein	M1PJ71	Vibrio_phage	1.7e-24	63.6
WP_065870369.1\|821610_821829_+	ANR family transcriptional regulator	NA	NA	NA	NA
WP_065870370.1\|821821_822055_+	hypothetical protein	M4MCS5	Vibrio_phage	4.3e-21	66.2
WP_065870371.1\|822208_822688_+	hypothetical protein	M4MHH2	Vibrio_phage	1.5e-52	69.4
WP_065870372.1\|822684_823221_+	hypothetical protein	F6MIJ5	Haemophilus_phage	2.3e-25	39.5
WP_062853649.1\|823419_823656_+	hypothetical protein	M4M9N5	Vibrio_phage	1.8e-19	57.7
WP_065871023.1\|823661_824009_+	hypothetical protein	A0A2I7RZB2	Vibrio_phage	7.5e-46	76.4
WP_065870373.1\|824013_824547_+	regulatory protein GemA	M4MB83	Vibrio_phage	8.8e-62	68.0
WP_065870374.1\|824615_825017_+	transcriptional regulator	M4MHG9	Vibrio_phage	2.3e-54	77.9
WP_065870375.1\|825103_825670_+	N-acetylmuramidase	A0A2I7S9B9	Vibrio_phage	1.1e-73	72.6
WP_062853644.1\|825669_825942_+	hypothetical protein	A0A2I7S9C2	Vibrio_phage	1.1e-20	56.5
WP_062853643.1\|825926_826523_+	hypothetical protein	M1NVP4	Vibrio_phage	1.5e-41	54.1
WP_062853642.1\|826522_826738_+	TraR/DksA family transcriptional regulator	M4MHG5	Vibrio_phage	6.1e-22	68.6
WP_062853641.1\|826737_827043_+	DUF2730 family protein	M4M9P7	Vibrio_phage	3.6e-12	42.3
WP_065870376.1\|827051_827345_+	hypothetical protein	A0A2I7S9D8	Vibrio_phage	1.5e-39	83.3
WP_065870377.1\|827354_827933_+	DUF3486 family protein	A0A2I7S9D1	Vibrio_phage	6.0e-72	74.3
WP_062853638.1\|827932_828124_+	hypothetical protein	M4MB75	Vibrio_phage	6.0e-13	57.6
WP_065870378.1\|828244_829807_+	hypothetical protein	M4MHG0	Vibrio_phage	9.0e-232	77.3
WP_065870379.1\|829803_831366_+	DUF935 domain-containing protein	M4M9P3	Vibrio_phage	5.8e-239	78.8
WP_065870380.1\|831358_832138_+	hypothetical protein	A0A2I7S9F9	Vibrio_phage	8.7e-127	80.5
WP_065870381.1\|832440_833400_+	peptidase	A0A2I7S9C6	Vibrio_phage	6.0e-93	53.5
WP_062853633.1\|833399_834299_+\|head	phage head protein	A0A2I7S9D0	Vibrio_phage	5.2e-139	79.9
WP_065870382.1\|834377_834635_+	hypothetical protein	NA	NA	NA	NA
WP_065870383.1\|834637_835177_+	hypothetical protein	M1Q569	Vibrio_phage	3.6e-55	63.6
WP_065870384.1\|835204_835795_+	hypothetical protein	M4M9M3	Vibrio_phage	3.2e-20	57.0
WP_065870385.1\|835813_836248_+	DUF1320 domain-containing protein	A0A2I7S9E9	Vibrio_phage	1.9e-67	88.2
WP_065870386.1\|836247_836790_+	phage virion morphogenesis protein	A0A2I7S9D7	Vibrio_phage	1.6e-79	79.9
WP_065870387.1\|836786_837383_+	hypothetical protein	A0A2I7S9D4	Vibrio_phage	1.8e-84	75.3
WP_079879898.1\|837414_837633_+	DUF2635 domain-containing protein	A0A2I7S9K4	Vibrio_phage	6.0e-09	47.4
WP_065870389.1\|837635_839114_+\|tail	phage tail protein	M1Q565	Vibrio_phage	1.8e-253	88.4
WP_065870390.1\|839129_839483_+\|tail	phage tail protein	A0A2I7S9D5	Vibrio_phage	3.9e-42	74.1
WP_065870391.1\|839482_839842_+	hypothetical protein	A0A2I7S9E0	Vibrio_phage	5.7e-41	72.0
WP_079879899.1\|840051_841647_+	tape measure protein	A0A2I7S9D9	Vibrio_phage	2.7e-183	66.9
WP_065870392.1\|841658_842978_+	multidrug DMT transporter permease	A0A2I7S9E8	Vibrio_phage	7.7e-192	75.8
WP_065870393.1\|842970_844065_+\|tail	phage tail protein	A0A2I7S9G1	Vibrio_phage	5.8e-169	80.4
WP_065870394.1\|844065_844671_+\|plate	phage baseplate assembly protein V	A0A2I7S9F6	Vibrio_phage	2.3e-90	82.2
WP_062853623.1\|844673_845126_+	hypothetical protein	M4MB61	Vibrio_phage	1.5e-65	84.5
WP_062853622.1\|845115_846183_+\|plate	baseplate J/gp47 family protein	M4MHE1	Vibrio_phage	1.3e-168	82.8
WP_062853621.1\|846167_846755_+	YmfQ family protein	M4M9M8	Vibrio_phage	3.8e-90	76.9

DBSCAN-SWA_3

1130783 : 1214557

Vibrio_phage(70.45%)

head,terminase,integrase,capsid,protease,tRNA,portal,tail

attL 1130628:1130650|attR 1166509:1166531

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1130628:1130650	attL	NA	NA	NA	NA
WP_065870448.1\|1130783_1131806_-\|integrase	tyrosine-type recombinase/integrase	R9TMQ4	Vibrio_phage	2.2e-101	54.7
WP_065870449.1\|1131809_1132337_-	hypothetical protein	NA	NA	NA	NA
WP_065870450.1\|1132329_1132689_-	STAS-like domain-containing protein	NA	NA	NA	NA
WP_065870451.1\|1132675_1133851_-	hypothetical protein	NA	NA	NA	NA
WP_065870452.1\|1133977_1135564_-	DUF4041 domain-containing protein	A0A142LP25	Marinitoga_camini_virus	2.8e-79	63.8
WP_065870453.1\|1135598_1136249_-	phage repressor protein CI	R9TR74	Vibrio_phage	9.3e-82	68.2
WP_045588167.1\|1136396_1136609_+	hypothetical protein	R9TMQ7	Vibrio_phage	1.2e-22	75.7
WP_029559289.1\|1136720_1137260_+	phage regulatory protein (CII)	U3PIJ8	Vibrio_phage	1.6e-55	60.3
WP_065870454.1\|1137269_1137605_+	hypothetical protein	NA	NA	NA	NA
WP_065870455.1\|1137670_1138183_+	hypothetical protein	U3PB56	Vibrio_phage	3.0e-27	50.6
WP_065870456.1\|1138179_1138632_+	DUF3850 domain-containing protein	D2XJW3	Escherichia_phage	1.4e-07	44.7
WP_065870457.1\|1138628_1139171_+	DNA methyltransferase	U3PDF3	Vibrio_phage	1.7e-84	82.9
WP_079879902.1\|1139269_1141822_+	replication endonuclease	A0A166YHE2	Vibrio_phage	1.1e-306	64.3
WP_065870458.1\|1141868_1142273_-	hypothetical protein	NA	NA	NA	NA
WP_141106056.1\|1142279_1142549_-	hypothetical protein	A0A2I7R204	Vibrio_phage	5.7e-09	70.5
WP_065870460.1\|1142561_1143137_-	hypothetical protein	NA	NA	NA	NA
WP_079879903.1\|1144002_1144275_+	hypothetical protein	U3PDF9	Vibrio_phage	5.7e-17	63.5
WP_079765352.1\|1144276_1144528_-	ogr/Delta-like zinc finger family protein	R9TNQ2	Vibrio_phage	1.9e-35	85.5
WP_065870462.1\|1144606_1145635_-\|portal	phage portal protein	A0A2I7RNI9	Vibrio_phage	1.4e-148	73.8
WP_065870463.1\|1145631_1147407_-\|terminase	terminase	A0A2I7RNI3	Vibrio_phage	1.1e-307	90.3
WP_065870464.1\|1147573_1148431_+\|capsid	phage capsid protein	A0A2I7RNH1	Vibrio_phage	3.8e-91	61.7
WP_065870465.1\|1148430_1149435_+\|capsid	phage major capsid protein, P2 family	R9TPZ5	Vibrio_phage	9.0e-108	62.5
WP_065870466.1\|1149445_1150162_+\|terminase	terminase	A0A2I7RNJ0	Vibrio_phage	9.6e-104	84.4
WP_065870467.1\|1150276_1150696_+\|head	head completion/stabilization protein	A0A2I7RNH7	Vibrio_phage	1.4e-51	75.5
WP_065870468.1\|1150692_1151184_+\|tail	phage tail protein	A0A2I7RNH2	Vibrio_phage	1.1e-77	86.9
WP_065870469.1\|1151167_1151824_+	virion morphogenesis protein	A0A2I7RNI6	Vibrio_phage	1.9e-98	82.1
WP_065870470.1\|1151827_1152958_+	DUF2586 family protein	A0A2I7RNI8	Vibrio_phage	1.8e-181	84.3
WP_065870471.1\|1152961_1153411_+	DUF2597 family protein	A0A2I7RNI0	Vibrio_phage	7.4e-78	95.3
WP_065302675.1\|1153423_1153642_+	molecular chaperone DnaK	A0A2I7RNJ6	Vibrio_phage	1.2e-22	72.1
WP_065870472.1\|1153638_1154136_+	hypothetical protein	A0A2I7S7C4	Vibrio_phage	3.7e-22	48.1
WP_065870473.1\|1154132_1154363_+	hypothetical protein	W6B371	Vibrio_phage	1.7e-06	41.2
WP_025517570.1\|1154365_1154650_+	hypothetical protein	NA	NA	NA	NA
WP_047508669.1\|1154646_1154910_+	hypothetical protein	A0A1D9C9R9	Salinivibrio_phage	1.7e-18	55.3
WP_158213473.1\|1154927_1155092_+	hypothetical protein	Q1I0Y8	Pasteurella_virus	1.2e-06	45.3
WP_065870474.1\|1155103_1156990_+\|tail	phage tail tape measure protein	A0A1D9C9V3	Salinivibrio_phage	5.4e-223	59.5
WP_031856781.1\|1156989_1157331_+	DUF2590 family protein	A0A2I7RNH9	Vibrio_phage	1.8e-44	81.8
WP_065870475.1\|1157330_1158518_+	hypothetical protein	A0A2I7RNJ7	Vibrio_phage	4.1e-192	82.0
WP_065870476.1\|1158504_1159107_+	hemolysin	A0A2I7RNJ4	Vibrio_phage	3.7e-101	85.0
WP_065870477.1\|1159120_1161979_+	hypothetical protein	A0A2I7RNJ3	Vibrio_phage	1.2e-128	79.6
WP_065870478.1\|1162138_1162675_+	adenine glycosylase	A0A2I7RNK5	Vibrio_phage	3.0e-62	68.0
WP_065870479.1\|1162684_1163374_+	hypothetical protein	A0A2I7RNK1	Vibrio_phage	1.5e-106	76.8
WP_065870480.1\|1163364_1164036_+	hypothetical protein	A0A2I7RNK2	Vibrio_phage	4.5e-95	73.6
WP_065870481.1\|1164037_1164235_+	hypothetical protein	A0A2I7RNJ8	Vibrio_phage	3.7e-18	78.5
WP_141106055.1\|1164909_1166148_-	hypothetical protein	NA	NA	NA	NA
WP_005456217.1\|1166621_1166786_-	pleiotropic regulatory protein RsmS	NA	NA	NA	NA
1166509:1166531	attR	NA	NA	NA	NA
WP_065870483.1\|1166785_1167331_-	prepilin peptidase	NA	NA	NA	NA
WP_005456200.1\|1167327_1168113_-	TSUP family transporter	NA	NA	NA	NA
WP_065870484.1\|1168127_1170203_-	ATP-dependent DNA helicase DinG	A0A127AW80	Bacillus_phage	6.9e-46	25.8
WP_021449333.1\|1170717_1171743_+	porin	NA	NA	NA	NA
WP_020840327.1\|1171819_1172497_+	DUF2057 family protein	NA	NA	NA	NA
WP_020840328.1\|1172609_1173308_-	pseudouridine synthase	NA	NA	NA	NA
WP_025520620.1\|1173619_1175845_+	NADP-dependent isocitrate dehydrogenase	NA	NA	NA	NA
WP_005456215.1\|1175975_1176194_-	cold shock domain-containing protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	1.2e-14	56.7
WP_005456259.1\|1176893_1177214_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	1.1e-14	46.9
WP_005495889.1\|1177261_1179532_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.7e-167	43.3
WP_025520618.1\|1179665_1180706_+	serine hydrolase	NA	NA	NA	NA
WP_001040192.1\|1180772_1180991_-	translation initiation factor IF-1	NA	NA	NA	NA
WP_024699955.1\|1181072_1181774_-	arginyltransferase	NA	NA	NA	NA
WP_065870485.1\|1181770_1182481_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_005495881.1\|1182520_1182997_+	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_065870486.1\|1183158_1184439_+	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_005495879.1\|1184496_1184745_-	YciN family protein	NA	NA	NA	NA
WP_005457230.1\|1185209_1187840_+	type I DNA topoisomerase	A0A2P1ELA0	Moumouvirus	4.3e-85	34.3
WP_005457246.1\|1188435_1189653_+	glucose-1-phosphate adenylyltransferase	A0A1D7XFC1	Escherichia_phage	2.2e-07	28.2
WP_025515343.1\|1189642_1191100_+	glycogen synthase GlgA	NA	NA	NA	NA
WP_005495870.1\|1191222_1192026_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_005483105.1\|1192067_1192388_-	hypothetical protein	NA	NA	NA	NA
WP_025506042.1\|1192387_1193080_-	TVP38/TMEM64 family protein	NA	NA	NA	NA
WP_005457243.1\|1193291_1193882_-	TfoX/Sxy family DNA transformation protein	NA	NA	NA	NA
WP_005457245.1\|1194354_1195359_-	HTH-type transcriptional repressor PurR	NA	NA	NA	NA
WP_020904011.1\|1195796_1196444_-	molecular chaperone TorD	NA	NA	NA	NA
WP_005457237.1\|1196709_1197423_+	two-component system response regulator TorR	W8CYM9	Bacillus_phage	1.3e-23	31.6
WP_005457224.1\|1197492_1198278_-	envelope biogenesis factor ElyC	NA	NA	NA	NA
WP_065871028.1\|1198392_1199184_+\|tRNA	tRNA uridine 5-oxyacetic acid(34) methyltransferase CmoM	NA	NA	NA	NA
WP_005483103.1\|1199186_1200524_+	chromosome partition protein MukF	NA	NA	NA	NA
WP_065870487.1\|1200504_1201230_+	chromosome partition protein MukE	NA	NA	NA	NA
WP_025543151.1\|1201232_1205696_+	chromosome partition protein MukB	NA	NA	NA	NA
WP_005457241.1\|1206219_1207188_-	alpha-L-glutamate ligase-like protein	NA	NA	NA	NA
WP_005495851.1\|1207191_1208697_-	inactive transglutaminase family protein	NA	NA	NA	NA
WP_005457212.1\|1208708_1209455_-\|protease	ATP-dependent zinc protease	NA	NA	NA	NA
WP_005483112.1\|1209676_1210648_-\|tRNA	tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB	NA	NA	NA	NA
WP_024699946.1\|1210760_1211498_-	carboxy-S-adenosyl-L-methionine synthase CmoA	NA	NA	NA	NA
WP_005483110.1\|1212778_1214557_+\|tRNA	aspartate--tRNA ligase	A0A2K9L3L6	Tupanvirus	5.3e-10	27.0

DBSCAN-SWA_4

1731651 : 1816821

Vibrio_phage(33.33%)

head,terminase,integrase,capsid,portal,tRNA,protease,tail

attL 1743570:1743586|attR 1760305:1760321

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005477636.1\|1731651_1732545_+\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	4.1e-104	68.4
WP_005495023.1\|1732638_1733586_-	universal stress protein UspE	NA	NA	NA	NA
WP_005477663.1\|1733765_1734512_-	FNR family transcription factor	NA	NA	NA	NA
WP_065871038.1\|1734602_1735280_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_005457379.1\|1735288_1735453_-	cbb3-type cytochrome oxidase assembly protein CcoS	NA	NA	NA	NA
WP_065870651.1\|1735467_1737831_-	cadmium-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.1e-76	30.3
WP_005495014.1\|1737835_1738312_-	hypothetical protein	NA	NA	NA	NA
WP_020840623.1\|1738417_1739392_-	cytochrome-c oxidase, cbb3-type subunit III	NA	NA	NA	NA
WP_005396487.1\|1739391_1739565_-	CcoQ/FixQ family Cbb3-type cytochrome c oxidase assembly chaperone	NA	NA	NA	NA
WP_005457377.1\|1739574_1740195_-	cytochrome-c oxidase, cbb3-type subunit II	NA	NA	NA	NA
WP_005477654.1\|1740207_1741635_-	cytochrome-c oxidase, cbb3-type subunit I	NA	NA	NA	NA
WP_005457383.1\|1741891_1742248_+	hypothetical protein	NA	NA	NA	NA
WP_065870655.1\|1742361_1743543_+	histidine kinase	NA	NA	NA	NA
WP_065870657.1\|1743532_1745263_+	response regulator	A0A1V0SGX0	Hokovirus	7.8e-43	31.3
1743570:1743586	attL	NA	NA	NA	NA
WP_065870658.1\|1745433_1745613_-	hypothetical protein	NA	NA	NA	NA
WP_065870659.1\|1745806_1746199_+	hypothetical protein	NA	NA	NA	NA
WP_065870660.1\|1746211_1746454_+	hypothetical protein	NA	NA	NA	NA
WP_065870661.1\|1746727_1748986_-	AAA family ATPase	A0A0K2FLP8	Brevibacillus_phage	7.8e-43	26.9
WP_065870662.1\|1748985_1749411_-	hypothetical protein	NA	NA	NA	NA
WP_025796163.1\|1749418_1749877_-	hypothetical protein	NA	NA	NA	NA
WP_065870663.1\|1749873_1752393_-	hypothetical protein	NA	NA	NA	NA
WP_065871039.1\|1752394_1754002_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_065870664.1\|1754012_1755536_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_021448551.1\|1756037_1756361_-	hypothetical protein	NA	NA	NA	NA
WP_005494983.1\|1756473_1756785_-	DUF3634 family protein	NA	NA	NA	NA
WP_005494981.1\|1756795_1757245_-	macrodomain Ter protein MatP	NA	NA	NA	NA
WP_065870665.1\|1757455_1759093_+\|protease	Lon protease family protein	NA	NA	NA	NA
WP_005390081.1\|1759163_1759682_+	bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase	NA	NA	NA	NA
WP_005494976.1\|1759795_1759969_-	ribosome modulation factor	NA	NA	NA	NA
WP_065870666.1\|1760140_1761865_-	DUF3466 family protein	NA	NA	NA	NA
1760305:1760321	attR	NA	NA	NA	NA
WP_005458252.1\|1761872_1763792_-	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	1.6e-52	28.8
WP_011105882.1\|1763769_1764012_-	glutaredoxin family protein	NA	NA	NA	NA
WP_005494968.1\|1764040_1766164_-	bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL	NA	NA	NA	NA
WP_005494967.1\|1766660_1767203_-	cell division protein ZapC	NA	NA	NA	NA
WP_005458264.1\|1767371_1768382_-	quinone-dependent dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_065870667.1\|1768690_1773532_-	NAD-glutamate dehydrogenase	NA	NA	NA	NA
WP_074534427.1\|1773733_1773952_-	DUF2835 domain-containing protein	NA	NA	NA	NA
WP_065870668.1\|1774017_1776645_-	aminopeptidase N	NA	NA	NA	NA
WP_029848917.1\|1776716_1776953_-	ArsR family transcriptional regulator	NA	NA	NA	NA
WP_065870669.1\|1777929_1778445_+	hypothetical protein	NA	NA	NA	NA
WP_065870670.1\|1778441_1779197_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_065870671.1\|1779348_1779795_-	hypothetical protein	NA	NA	NA	NA
WP_065870672.1\|1779924_1780533_-	hypothetical protein	NA	NA	NA	NA
WP_065870673.1\|1780593_1781394_-	DUF2971 domain-containing protein	NA	NA	NA	NA
WP_079879852.1\|1781544_1781910_-	peptidase M15	A0A2I7RAT1	Vibrio_phage	1.1e-34	62.0
WP_065870674.1\|1781918_1782449_-	hypothetical protein	NA	NA	NA	NA
WP_005490094.1\|1782448_1783456_-	radical SAM protein	NA	NA	NA	NA
WP_065870675.1\|1783471_1783846_-	hypothetical protein	NA	NA	NA	NA
WP_065870676.1\|1783849_1789000_-	hypothetical protein	M4MHT9	Vibrio_phage	3.9e-98	29.5
WP_065870677.1\|1789003_1789402_-	hypothetical protein	NA	NA	NA	NA
WP_065870678.1\|1789404_1789944_-	hypothetical protein	M4MD40	Vibrio_phage	1.5e-21	38.7
WP_029860508.1\|1789955_1790537_-	hypothetical protein	NA	NA	NA	NA
WP_065870679.1\|1790548_1792843_-\|tail	phage tail tape measure protein	A0A1J0GVM4	Pseudoalteromonas_phage	6.1e-11	24.1
WP_005490199.1\|1792858_1793152_-	hypothetical protein	NA	NA	NA	NA
WP_005490240.1\|1793196_1793532_-	hypothetical protein	NA	NA	NA	NA
WP_005490045.1\|1793598_1794054_-	hypothetical protein	NA	NA	NA	NA
WP_005490113.1\|1794066_1794390_-	hypothetical protein	NA	NA	NA	NA
WP_065870680.1\|1794437_1795046_-	hypothetical protein	NA	NA	NA	NA
WP_029848884.1\|1795038_1795383_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_065870681.1\|1795395_1795944_-\|head,tail	phage gp6-like head-tail connector protein	A0A2I7S7I1	Vibrio_phage	2.3e-09	27.3
WP_023667249.1\|1795959_1797150_-\|capsid	phage major capsid protein	M4MA06	Vibrio_phage	4.7e-39	34.3
WP_005490062.1\|1797244_1798093_-\|head,protease	HK97 family phage prohead protease	A0A2I7S7P2	Vibrio_phage	1.6e-28	36.0
WP_065870682.1\|1798055_1799381_-\|portal	phage portal protein	M4MHV5	Vibrio_phage	3.1e-76	38.8
WP_023667246.1\|1799390_1801151_-\|terminase	terminase large subunit	A0A0K1LKI4	Staphylococcus_phage	1.1e-81	35.9
WP_029860027.1\|1801274_1801469_-	hypothetical protein	NA	NA	NA	NA
WP_029848887.1\|1801478_1801913_-	hypothetical protein	NA	NA	NA	NA
WP_079856377.1\|1802055_1802466_-\|terminase	phage terminase small subunit P27 family	K7PHI2	Enterobacteria_phage	7.6e-05	27.6
WP_065870683.1\|1802554_1802965_-	hypothetical protein	NA	NA	NA	NA
WP_005490181.1\|1803245_1803437_-	hypothetical protein	NA	NA	NA	NA
WP_065870684.1\|1803647_1804292_+	antirestriction protein	G0YPX7	Erwinia_phage	2.9e-11	31.4
WP_005490250.1\|1804347_1804560_+	hypothetical protein	NA	NA	NA	NA
WP_065870685.1\|1804659_1805148_+	hypothetical protein	NA	NA	NA	NA
WP_079879853.1\|1805873_1806287_-	HNH endonuclease	A0A2H4J3B4	uncultured_Caudovirales_phage	2.9e-12	32.5
WP_005490042.1\|1806334_1806517_-	hypothetical protein	NA	NA	NA	NA
WP_005490248.1\|1806555_1806819_-	hypothetical protein	NA	NA	NA	NA
WP_065870686.1\|1806903_1807755_-	hypothetical protein	NA	NA	NA	NA
WP_065870687.1\|1807845_1808433_-	deoxynucleoside kinase	A0A1V0S992	Catovirus	4.3e-09	28.9
WP_005490154.1\|1808432_1808720_-	hypothetical protein	NA	NA	NA	NA
WP_100084493.1\|1808719_1808917_-	hypothetical protein	NA	NA	NA	NA
WP_029853619.1\|1808924_1809518_-	deoxynucleoside kinase	A0A249Y6S3	Cherax_quadricarinatus_iridovirus	1.6e-08	28.3
WP_029848890.1\|1809652_1809925_-	hypothetical protein	NA	NA	NA	NA
WP_029848891.1\|1809921_1810209_-	hypothetical protein	A0A142K9B6	Gordonia_phage	1.8e-08	53.7
WP_005490210.1\|1810412_1810634_-	hypothetical protein	NA	NA	NA	NA
WP_005490170.1\|1810621_1811464_-	exonuclease	F1D0G7	Vibrio_phage	3.3e-55	42.4
WP_065870688.1\|1811473_1811761_-	hypothetical protein	NA	NA	NA	NA
WP_005490177.1\|1811803_1812052_-	hypothetical protein	NA	NA	NA	NA
WP_005490208.1\|1812035_1812233_-	DUF1382 family protein	NA	NA	NA	NA
WP_005490066.1\|1812398_1812830_-	tellurite resistance protein	Q1MVI3	Enterobacteria_phage	7.2e-30	47.9
WP_065870689.1\|1813126_1815178_-	DNA polymerase	A0A0F7DD46	Delftia_phage	5.5e-144	40.8
WP_023667234.1\|1815177_1816821_-	toprim domain-containing protein	L7TLT7	Rhizobium_phage	5.2e-121	48.3

DBSCAN-SWA_5

2837028 : 2854202

uncultured_Mediterranean_phage(18.18%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005455546.1\|2837028_2839611_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.0e-78	37.9
WP_065870915.1\|2839753_2840221_-	recombination regulator RecX	NA	NA	NA	NA
WP_005478550.1\|2840344_2841388_-	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	8.1e-112	60.7
WP_065870916.1\|2841588_2842071_-	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	1.7e-27	48.7
WP_065870917.1\|2842155_2844717_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	1.3e-33	23.7
WP_005478537.1\|2844796_2845786_-	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	6.9e-36	35.2
WP_065870918.1\|2845866_2846790_-	peptidoglycan DD-metalloendopeptidase family protein	D7RWE0	Brochothrix_phage	4.1e-06	35.2
WP_005455562.1\|2846804_2847431_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.3e-35	52.1
WP_021450028.1\|2847430_2848207_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	6.6e-66	52.4
WP_021450029.1\|2848206_2849250_-\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_005380896.1\|2849296_2849773_-	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_024702351.1\|2849790_2850495_-	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	A0A2H4UTB4	Bodo_saltans_virus	4.5e-05	23.6
WP_005455577.1\|2850496_2850778_-	cell division protein FtsB	NA	NA	NA	NA
WP_005455579.1\|2851181_2852483_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	4.2e-134	59.2
WP_005455581.1\|2852561_2854202_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	4.2e-155	52.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP010884

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP010884_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010884_1

68769-68866

Orphan

Consensus_repeat	Method
TATTTTTAAAATGCCTTTTCAAAAA	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of NZ_CP010884_1

>merge|NZ_CP010884|1|68769-68866|CRISPRCasFinder
TATTTTTAAAATGCCTTTTCAAAAATTTGAAACCGCGCAATTAAAGAATCCGGAAAAACAAGATCGCAATCAATATTTTTAAAACGCCTTTTCAAAAA

>NZ_CP010884|1|1|68769-68866|CRISPRCasFinder
TATTTTTAAAATGCCTTTTCAAAAA	TTTGAAACCGCGCAATTAAAGAATCCGGAAAAACAAGATCGCAATCAA
TATTTTTAAAACGCCTTTTCAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010884.1\|WP_062851910.1\|65975_67844_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|225457
NZ_CP010884.1\|WP_005464972.1\|64392_65262_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176159
NZ_CP010884.1\|WP_065871079.1\|71351_72263_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223730
NZ_CP010884.1\|WP_005482833.1\|60255_60717_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|226429
NZ_CP010884.1\|WP_025621985.1\|61162_62002_-\|S-formylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|178061
NZ_CP010884.1\|WP_025550686.1\|72361_73291_+\|sugar-kinase	unknown	unknown	gnl\|CDD\|238571
NZ_CP010884.1\|WP_005464959.1\|59164_60256_-\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NZ_CP010884.1\|WP_011106212.1\|58750_59155_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010884.1\|WP_005460834.1\|73302_73926_+\|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase	unknown	unknown	gnl\|CDD\|235577
NZ_CP010884.1\|WP_005460779.1\|70638_71274_+\|RpiB/LacA/LacB-family-sugar-phosphate-isomerase	unknown	unknown	gnl\|CDD\|181746
NZ_CP010884.1\|WP_005482845.1\|75980_76658_+\|porin	unknown	unknown	gnl\|CDD\|368776
NZ_CP010884.1\|WP_005464962.1\|62063_63212_-\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176260
NZ_CP010884.1\|WP_005497706.1\|69745_70270_+\|YgjV-family-protein	unknown	unknown	gnl\|CDD\|378474
NZ_CP010884.1\|WP_065871076.1\|63505_64312_+\|arylamine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366312
NZ_CP010884.1\|WP_065871081.1\|76673_78902_+\|exopolygalacturonate-lyase	unknown	unknown	unknown
NZ_CP010884.1\|WP_005482916.1\|68965_69727_+\|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD	unknown	unknown	gnl\|CDD\|181605
NZ_CP010884.1\|WP_065871078.1\|70277_70598_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380366
NZ_CP010884.1\|WP_005460804.1\|67927_68710_-\|DNA-binding-transcriptional-regulator-KdgR	unknown	unknown	gnl\|CDD\|185046
NZ_CP010884.1\|WP_065871077.1\|65262_65973_-\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|236392
NZ_CP010884.1\|WP_065871080.1\|74111_75851_-\|transporter	unknown	unknown	gnl\|CDD\|271371

Protein	Function_ID	Function_description	E-value
NZ_CP010884.1\|WP_062851910.1\|65975_67844_-\|CBS-domain-containing-protein	gnl\|CDD\|225457	COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms].	2.36634e-138
NZ_CP010884.1\|WP_005464972.1\|64392_65262_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176159	cd08470, PBP2_CrgA_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding domain. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 1. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.14139e-108
NZ_CP010884.1\|WP_065871079.1\|71351_72263_+\|alpha/beta-hydrolase	gnl\|CDD\|223730	COG0657, Aes, Esterase/lipase [Lipid metabolism].	1.88196e-17
NZ_CP010884.1\|WP_005482833.1\|60255_60717_-\|oxidoreductase	gnl\|CDD\|226429	COG3915, COG3915, Uncharacterized protein conserved in bacteria [Function unknown].	3.9997e-40
NZ_CP010884.1\|WP_025621985.1\|61162_62002_-\|S-formylglutathione-hydrolase	gnl\|CDD\|178061	PLN02442, PLN02442, S-formylglutathione hydrolase.	5.32771e-143
NZ_CP010884.1\|WP_025550686.1\|72361_73291_+\|sugar-kinase	gnl\|CDD\|238571	cd01166, KdgK, 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP). KDG is the common intermediate product, that allows organisms to channel D-glucuronate and/or D-galacturinate into the glycolysis and therefore use polymers, like pectin and xylan as carbon sources.	1.39478e-102
NZ_CP010884.1\|WP_005464959.1\|59164_60256_-\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	5.06677e-44
NZ_CP010884.1\|WP_005460834.1\|73302_73926_+\|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase	gnl\|CDD\|235577	PRK05718, PRK05718, keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional.	4.28455e-121
NZ_CP010884.1\|WP_005460779.1\|70638_71274_+\|RpiB/LacA/LacB-family-sugar-phosphate-isomerase	gnl\|CDD\|181746	PRK09273, PRK09273, hypothetical protein; Provisional.	2.15977e-144
NZ_CP010884.1\|WP_005482845.1\|75980_76658_+\|porin	gnl\|CDD\|368776	pfam06178, KdgM, Oligogalacturonate-specific porin protein (KdgM). This family consists of several bacterial proteins which are homologous to the oligogalacturonate-specific porin protein KdgM from Erwinia chrysanthemi. The phytopathogenic Gram-negative bacteria Erwinia chrysanthemi secretes pectinases, which are able to degrade the pectic polymers of plant cell walls, and uses the degradation products as a carbon source for growth. KdgM is a major outer membrane protein, whose synthesis is strongly induced in the presence of pectic derivatives. KdgM behaves like a voltage-dependent porin that is slightly selective for anions and that exhibits fast block in the presence of trigalacturonate. In contrast to most porins, KdgM seems to be monomeric.	3.08357e-24
NZ_CP010884.1\|WP_005464962.1\|62063_63212_-\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	gnl\|CDD\|176260	cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	0
NZ_CP010884.1\|WP_005497706.1\|69745_70270_+\|YgjV-family-protein	gnl\|CDD\|378474	pfam10688, Imp-YgjV, Bacterial inner membrane protein. This is a family of inner membrane proteins. Many of the members are YgjV protein.	9.00507e-50
NZ_CP010884.1\|WP_065871076.1\|63505_64312_+\|arylamine-N-acetyltransferase	gnl\|CDD\|366312	pfam00797, Acetyltransf_2, N-acetyltransferase. Arylamine N-acetyltransferase (NAT) is a cytosolic enzyme of approximately 30kDa. It facilitates the transfer of an acetyl group from Acetyl Coenzyme A on to a wide range of arylamine, N-hydroxyarylamines and hydrazines. Acetylation of these compounds generally results in inactivation. NAT is found in many species from Mycobacteria (M. tuberculosis, M. smegmatis etc) to man. It was the first enzyme to be observed to have polymorphic activity amongst human individuals. NAT is responsible for the inactivation of Isoniazid (a drug used to treat Tuberculosis) in humans. The NAT protein has also been shown to be involved in the breakdown of folic acid.	9.34991e-98
NZ_CP010884.1\|WP_005482916.1\|68965_69727_+\|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD	gnl\|CDD\|181605	PRK08993, PRK08993, 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD.	0
NZ_CP010884.1\|WP_065871078.1\|70277_70598_+\|cupin-domain-containing-protein	gnl\|CDD\|380366	cd02238, cupin_KdgF, pectin degradation protein KdgF and related proteins, cupin domain. This family includes bacterial and archaeal pectin degradation protein KdgF that catalyzes the linearization of unsaturated uronates from both pectin and alginate, which are polysaccharides found in the cell walls of plants and brown algae, respectively, and represent an important source of carbon. These polysaccharides, mostly consisting of chains of uronates, can be metabolized by bacteria through a pathway of enzymatic steps to the key metabolite 2-keto-3-deoxygluconate (KDG). Pectin degradation is used by many plant-pathogenic bacteria during infection, and also, pectin and alginate can both represent abundant sources of carbohydrate for the production of biofuels. These proteins belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold.	1.1965e-53
NZ_CP010884.1\|WP_005460804.1\|67927_68710_-\|DNA-binding-transcriptional-regulator-KdgR	gnl\|CDD\|185046	PRK15090, PRK15090, DNA-binding transcriptional regulator KdgR; Provisional.	0
NZ_CP010884.1\|WP_065871077.1\|65262_65973_-\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|236392	PRK09146, PRK09146, DNA polymerase III subunit epsilon; Validated.	9.31668e-39
NZ_CP010884.1\|WP_065871080.1\|74111_75851_-\|transporter	gnl\|CDD\|271371	cd11477, SLC5sbd_u1, Uncharacterized bacterial solute carrier 5 subfamily; putative solute-binding domain. SLC5 (also called the sodium/glucose cotransporter family or solute sodium symporter family) is a family of proteins that co-transports Na+ with sugars, amino acids, inorganic ions or vitamins. Prokaryotic members of this family include Vibrio parahaemolyticus glucose/galactose (vSGLT), and Escherichia coli proline (PutP) and pantothenate (PutF) cotransporters. One member of the SLC5 family, human SGLT3, has been characterized as a glucose sensor and not a transporter. This subfamily belongs to the solute carrier 5 (SLC5) transporter family.	1.63941e-109

>NZ_CP010884.1|WP_005460804.1|67927_68710_-|DNA-binding-transcriptional-regulator-KdgR
MEKSTQPEAVSSVLKVFHILQALGEQKAIGVSELSQRLMMSKATTYRFLQTMKSLGYVSQEGEADKYSLTLKLFELGAKSLEYVDLIELADKEMRHISEQTNEALHLGALDENAIIYIHKIDSGYNLRMQSRIGRRNPLYSTAIGKVLLSERDESFVRDVLSDVEFIKHTEKTLENTDQVLEELAKVRDFHYAEDNEEQEPGLRCIAAPIYDRFGQIIAGLSISFPTIRFDEERMEYYVGLLHQAGKNISEQLGYHDYPA
>NZ_CP010884.1|WP_062851910.1|65975_67844_-|CBS-domain-containing-protein
MGTSVTPNIFDFLIKIDPFDKLPEPVVESIANSVKVKYLVRGETIGFSALCDQRYLYIIRTGAIEQRTPNGELRARLGQDDQFGFTFLDPLENAEDGYQAEAIEDSLLYLIPHSELKLVSEEHPEFADYFAAQANVRLSSAVKYVCRKEEKGLFFRTVGEIASENIAIVDVNDSIRSVAQTMCGKQRSSCAVVMKEGEIIGLVTDRDMTKSVVAQDMDTNHPIADVMTPNPVLIEDDAKVIQAISLMLQYNIRCLPVVHGKQVKGLLTTTHLVHNHRTQSLFLIEKIKYASSLNALAALKEERQTIFQALVESGVSAEIQGRVMSMIMDAFTRRIIQLNEELLGPPPCDYAWLVAGSHARNEVHMLSDQDSAIVLSDDATEEHKLYFTHLAMRVCNGLAACGYPLCDGKYMAASPKWCQPIRRWKEYYQKWVASPEYNKLLSISVFLEVRAIHGNREFVDQIQQHLHDCIQKSPSFIPALVRDAIDTQPPLGIFNNLVLEKGGENSNTLNIKKYALNLIIDLARIFSLAAGGSLTGTEERFRYAAQHGTLSKDSVENIIGAYRFITQVRFRHQLNAILAGTTPDNHIAPDDFSSFERKHLKDAFKIISELQDVAKLKFVKGA
>NZ_CP010884.1|WP_065871077.1|65262_65973_-|DNA-polymerase-III-subunit-epsilon
MIKRWFKRWETPLSPEQKRQAIHVVDDWPIVLKDYLQRPLVDDSTTLKDLSFVALDFETTGVDAQGDKILSIGVVDLTLDGIDIASSKEWYICHGQFIKPETAQINGLTPQDLAKGLPLDEGMNRLLERITGKVVLAHGCCIEKAFIHAYFSSRYQVEDFPAYFIDTLQIEKQFSYAGKSGVHSSYQLDDLRRYYHLPGYLSHSAASDALACAELFLVQSKKLTALPDVTLRQLMR
>NZ_CP010884.1|WP_005464972.1|64392_65262_+|LysR-family-transcriptional-regulator
MANWEGVSEFVAVAETNSFTGAAAKLKTSVAQISRRVSALEERLAVKLLHRTTRKVSLSEAGQLYYQQCKHLVEGLELAELAVTQMQTEPRGLLRVTAPVTYGEMNLAPLLHQFLEKYPRVDLDLVLTNQKLDLIEQGVDVAIRLGRLQDSSMIAKRLSSRQTYVCASPMYLERFGEPHTLSELGRHQCLVGSVDYWHFKENKRDKSLRVSGRIKCNSGFALVDAAKRGLGLVQLPDYYVQEALDSGELVEVLTDYRDDREGIWALYPQSRNLSPKVRLLIDFLAQELA
>NZ_CP010884.1|WP_065871076.1|63505_64312_+|arylamine-N-acetyltransferase
MNKTDLNAYLTKLGLPSELPADLESLHKIHVAQHRCLPFENFDISLQRGISVEIEDIIQKTVHHSRGGYCFELNGLMLDVLKTLGFEARSLLGRVHVMGTPTGRSHQITLVTLDEQAWIVDVGFGSNTPRAPLPFILNQVIQTDLQTFRFVEDAQFGYFLQVLSTDGTDTWNNLYSFDLEFVFAGDIACGNFFTSTSPHSRFTSARVAAKATESGLVTLLNYTLKYTSQGEQTELELEPGQAYLDALKEYFGIELDAQYGDLRPLSDA
>NZ_CP010884.1|WP_005464962.1|62063_63212_-|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase
MTLEIKPGQTHIKSKAMVAWAAGEPLKMEEVDVQLPKAGEVLVRIVATGVCHTDAFTLSGDDPEGIFPSILGHEGGGIVEMVGEGVTSVEVGDHVIPLYTAECGECKFCKSGKTNLCQAVRETQGKGLMPDGTSRFSINGETIFHYMGCSTFSEYTVLPEISLAKVNKQAPLEEVCLLGCGVTTGMGAVLNTAKVEKGDTVAIFGLGGIGLSAIIGARMAGASRIIGIDINESKFDLAKQLGATDVINPQKFDKPIQEVIVEMTDGGVDYSFECIGNVNVMRQALECCHKGWGESVIIGVAGAGQEISTRPFQLVTGRVWRGSAFGGVKGRSELPEIVNRYMAGEFGLQEFITHTMGLEDVNKAFDLMHEGKSIRTVIHMDK
>NZ_CP010884.1|WP_025621985.1|61162_62002_-|S-formylglutathione-hydrolase
MTIENVSQTKVFGGWHKQYTHDSKALNCTMRFAIFLPPNATKSNPVPALYWLSGLTCTDENFMQKAGAFRMAAELGIAIIAPDTSPRGEGVADDASYDLGQGAGFYLNATQAPWSLHYHMYDYVTQELPAIIEANFPVSDVKSISGHSMGGHGALTIGLKNPTLYRSISAFSPISNPMQCPWGQKAFTAYLGTDIESWKQYDASELLKKEKSPLPILVDQGDADGFLSEQLKPEVLLAAAKQHGSELNLRMQSGYDHSYYFISSFIDNHLNFHAKYLFS
>NZ_CP010884.1|WP_005482833.1|60255_60717_-|oxidoreductase
MKKIVSLSLLLFAPFLSANSITFSSPQQPSVTLKLEELQSLPTTSYTTDLPWIQQSSEFLGVKLSTLLTHVYGSIPEQVDIGSLNNYHSTLSRKDIVRYQPILAYQQDHHYIKVRNKGPYWVIYPLSQYPELDHNEYHAQMVWQVNEMKIKQK
>NZ_CP010884.1|WP_005464959.1|59164_60256_-|GGDEF-domain-containing-protein
MKLSEAYPIKQKNYSTTSKMLLLVFATSLLLANVILLQQTRVLAQSFTDEQKQATWFLFQLSKELSELVSEARRLDENVLKIEGAELQYELAWSRFDLLINSKDVYTFFSRNHIQQYFLQLFNEFKELEPLLVEAKTGDSQAAAQFYRATQTLYLNLVEFVNQNFRLTSQVYETQKDESQRLMKAQYMLFATFVLSILSLTYFFYRESHFHRKLALSDPLTGLGNRNALFVTLRNNTRNRTAFSLCLLDLNGFKNVNDTYGHQAGDTVLCEIAKRLKDMNIDSFSTYRMGGDEFAVVIESSDVDAEEAKKHIHSVFDTPVLNANNVSSLSTSIGVAHYPSDSDNVDFLISIADKRMYKMKFQR
>NZ_CP010884.1|WP_011106212.1|58750_59155_-|hypothetical-protein
MMRKFMQVLLLLAVIAAGVLAWVFIPSHETIGQKTLEQALNDDYSLVGHRIYSTDPDAGNRFGYFVLATGQSIEEQEPFLVTSDQFIRMEQTGDNTLSVTVNGRIYQYHNDLWVPKSDGKLQHFLVSATANYVR
>NZ_CP010884.1|WP_005482916.1|68965_69727_+|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD
MILDSFNLEGKVAIVTGCDTGLGQGMALGLAKAGCDIVGVNISEPTETIEKVEAEGRKFVDIRANLMKLDDIPTIVDRAVTELGRIDILVNNAGIIRRNDAIEFSEQDWDDVMNINVKSVFFMSQAVAKQFIAQGEGGKIINIASMLSFQGGIRVPSYTASKSGVMGVTRLMANEWASHGINVNAIAPGYMATNNTAALRADEQRNKEIVDRIPAARWGTPEDLAGPCVFLASKAADYINGYTIAVDGGWLAR
>NZ_CP010884.1|WP_005497706.1|69745_70270_+|YgjV-family-protein
MVDTTILAQALGFISFGLGFSVFYQKNDRHLKILMLIFNLNHLLHFLLLGSMVSALSALLSALRTTTAIFVSSKRVAAVFIVISLVSGFWVAEQWRDLWPIIGTVIGTYSVFCLSGIRMRIGFLLGASCWLTNNILVGSIGGTLLEMTVIVMNLLTIYRLHRQQSESMINQSSY
>NZ_CP010884.1|WP_065871078.1|70277_70598_+|cupin-domain-containing-protein
MFVFNQDIPMEDLGEGISRKVLAHSDNMMSVEVHFEEGAIGEMHSHPHEQLTYVLSGEFEFTIGDEKKIVKTGDTMYKEPNIEHGCVCLKAGVLIDTFTPMRKDFV
>NZ_CP010884.1|WP_005460779.1|70638_71274_+|RpiB/LacA/LacB-family-sugar-phosphate-isomerase
MKIALMMENSQAAKNAMVAGELNSVAGGLGHDVFNVGMTDENDHHLTYIHLGIMASILLNSKAVDFVVTGCGTGQGALMSCNLHPGVVCGYCLEPSDAFLFNQINNGNAISLAFAKGFGWAGELNVRYIFEKAFTGKRGEGYPIERAAPQQANAAILNNVKSAVAKDVVEGLRAIDQELVKTAVGSTQFQECFFAHCQVPEIAEYVKSLLD
>NZ_CP010884.1|WP_065871079.1|71351_72263_+|alpha/beta-hydrolase
MHVAPITSLQTWFPEHLVLPLWSEPQIPSHLVQSYQERNPNELLPDRAVFDITHPEIVVFEPEQSNGIGILLMPGGGYQRVSVDKEGADSARVLNQVGFTVFVMTYRMPNEGHEFGAWTPLADAQRAMRLVRRLPLASHLSSIGVLGFSAGGHVAASLATNHALDIYPLQDEADRVSAKPDFCALMYPVISMNTDIAHMGSRAELLANLERESDLLRFSLEKQVTSDMPPCFLLHASDDTAVSVANSLVFWQALRQHEIATEMHLFEQGKHGFGIRDAQGLPVAAWPQLLSAWLQNLTEKARR
>NZ_CP010884.1|WP_025550686.1|72361_73291_+|sugar-kinase
MNPISRVAIIGECMVELKKHDGVLQQGFGGDTLNTAVYLSRLTKQHGVETSYVTGLGHDPFSREMLAAWREEGINTDMVYLSEDKLPGIYAIETAEDGERSFFYWRNDAAAKYWLRERALLSLVKDLCQHQMIYLSGISLAIISDDCRQMLIELLTMCRKEGVKIAFDNNFRPKLWPNIEQARDFYSKILSVTDMAFLTFDDEVMLWGDKHEDEAISRTKNFGVKEIIVKRGADDCFVVTQDQQHTVAALKVDAVVDTTAAGDSFSAGYLAKRILGGDVAESALAGHKVAGTVIQHRGAIIPSQAMPTI
>NZ_CP010884.1|WP_005460834.1|73302_73926_+|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase
MKDLNQQLSEIKVVPVIAIKDAGKAVKLAQVLIENGLPCAEVTFRTEDAALAIKNMREAYPEMLIGAGTVLTSAQVDEAIDAGVDFIVSPGFNPTTVKYCQQRNVTIVPGVNNPSLVEQAMEMGLRTLKFFPAEPSGGVAMLKALSAVYPVKFMPTGGVSPSNVKDYLSISSVLACGGTWMVPGDLIDNEQWDELAKLVREVAGIIE
>NZ_CP010884.1|WP_065871080.1|74111_75851_-|transporter
MTLLDSMIVMIYLLFIGIAAWLFRRFSTSSNDFLQGGGTMMWWMAGATAFMTQFSAWTFTGAAAKAYEDGISVMFIFWGNALGFFVAAAFFARRYRRLRVETAMEVIRVRFGHTSEQLFTWLSFPLTLIACAIWMNGLASFFSAVFAIEMSTTILAMGVIVTLIAVSGGAWTVSVTNVIQLILLIAITLVIGYAALQRFDSPSEVFAYTTPIYGEQIRMPSLFVMWAIAMLLQQTMSNNHTLSCYRFLTTANDKDATKAAFVAGVLFVFAPVLWFMPAWFVAAQNIDLLAIYPALEQSANNAAYLYYIQHYMPQGLLGLVMVALVAATIAPLSSAHNRNAGIVVKSLYQVWFNPNATSRQQLMVGKIATIVSGVLATVTALLLASVESYSLFDMMIVFAAFIQMPINIPSLLALVSLKTPNWSGWATVMVGCAVSLFMMFIFDVQWLSSSPLTPRESKDLSVVATLAVHLLVTGGFFLSTRVFYAKEPPSIQQSRTALAIQLATPISDEELSPINHKQGLYVGSITALAGMLLILAGVVLAGSSQSIFVAIGCIVLLFSLFLLQPTLHSKRAWQKQKTK
>NZ_CP010884.1|WP_005482845.1|75980_76658_+|porin
MKVRYLTSALLLAMTSGLAAAASVDIRHEYVPDRDGDEHRDRIYVSHRFDNQIGFSVEAKWNYKDGHMGNAGHETGVSYRWKATDNFSLTPGINIDASPSGASVFKYNLTGAYKINDEWDVAARIRHGYKNTDDSRYNQLNLYANRKFEWGKLGVEAEYKDIHGGEGGWKDKGHDQLIDFKGEYTKLESGVIPFFAIAAITHKGDGSEFKDEYVPRFRVGLKYNF
>NZ_CP010884.1|WP_065871081.1|76673_78902_+|exopolygalacturonate-lyase
MKKHTLALCLAAILAPAAHAAEIKVEDLTWKAITFGQSTDMNFGSTILPEKVGVNQVTVNGDAVAAGKLASTFTIESRGGKLANSHEGLTFYYTELPTDVNFTLSADVVLEQLGPETGATPNRQEGAGLMVRDILGAERLVPQPEGHEEFPSASNMVMNLMRSHTRTNDGMTNINASFREGVYQPWGTPGNRLSRVDYVEGVPYGTAETYRMTLTRTNDGFKVSYRNGEKFVEQAVKGANANIVEMQNSDSQYVGFFASRNAKMTVSNVDLQLAAADTVDAPKYAAKQGELVFQIASSPRSATKEYPVQARANYSGEFEVLHNDKVVAKQTVTAGELFSQWLTLDSGANQMEVRFTAIDGPNKETQAQRYSVDVVSLPDPMTLYVAPNGSDKGNGSQAQPLDFATAVELLPAGGTIILKDGDYQGMEIPLTASGSADKLKHLRAEGDNVRFVSELRHEANYWHYQGIEVAGAQFIVHGSHNTFEKMVTHGAPDTGFVITSPENIGRALWASYNQVIESESYNNMDPSQINADGFAAKMRIGDGNTFIRCLSHHNIDDGWDLFNKVEDGANGAVTILDSISFSNGRTLDVANKGGTIGNGFKLGGEGIPVPHVVKNSLSFNNNMDGFTDNFNPGALVLSDNVSIDNKRFNYLFRKSPYSGEIEQGTFTNNRSYRFHVSSKYDDVINSAKSTGNALVENGTTYTSDGKAVDSQTLAPLKQASVIDTQQAIPGKQEAMQLKQLIH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

935059 : 943260

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029849354.1\|935059_935428_-	hypothetical protein	A0A1W6UGD7	Vibrio_phage	1.7e-35	63.6
WP_065871318.1\|935624_935897_+	hypothetical protein	NA	NA	NA	NA
WP_025441867.1\|935896_936121_+	hypothetical protein	G8IRU4	Vibrio_phage	9.2e-13	56.1
WP_029803951.1\|936113_937370_+	replication protein	G8IRU5	Vibrio_phage	5.0e-148	62.0
WP_065871319.1\|937375_937702_+	hypothetical protein	NA	NA	NA	NA
WP_025441870.1\|937698_937944_+	hypothetical protein	R9TMT7	Vibrio_phage	6.3e-07	43.9
WP_065871320.1\|937972_938164_+	hypothetical protein	R9TRU5	Vibrio_phage	3.2e-06	53.3
WP_065871321.1\|938297_939797_+	chemotaxis protein	NA	NA	NA	NA
WP_025441873.1\|939796_940129_+	DUF2523 domain-containing protein	NA	NA	NA	NA
WP_065871322.1\|940132_941557_+	toxin	Q64EV0	Vibrio_phage	1.8e-122	51.7
WP_025441875.1\|941655_941865_+	hypothetical protein	NA	NA	NA	NA
WP_065871323.1\|942193_942658_-	hypothetical protein	A0A1W6UFZ4	Vibrio_phage	4.4e-33	43.7
WP_065871324.1\|942689_943064_-	phage protein	A0A1W6UG37	Vibrio_phage	8.9e-61	91.9
WP_114139625.1\|943020_943260_-	hypothetical protein	A0A1W6UFY8	Vibrio_phage	3.1e-27	74.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP010885

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

76708 : 82627

Vibrio_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065871618.1\|76708_76963_-	hypothetical protein	A0A2I7S7Y8	Vibrio_phage	1.2e-24	63.1
WP_029792981.1\|76979_77474_-	hypothetical protein	A0A067ZG68	Vibrio_phage	9.7e-23	40.5
WP_025443162.1\|77499_77751_-	hypothetical protein	NA	NA	NA	NA
WP_065871619.1\|78326_79307_-	restriction endonuclease	A0A0P0ZG22	Escherichia_phage	8.9e-68	42.3
WP_065871620.1\|79436_80948_+	N-6 DNA methylase	A0A2L1IV91	Escherichia_phage	3.6e-100	42.3
WP_114139638.1\|81029_82210_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	6.6e-118	66.0
WP_065871622.1\|82426_82627_-	hypothetical protein	A0A1J0MDC3	Vibrio_phage	9.7e-06	44.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP010883

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP010884

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP010885

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection