CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP013752	Lactiplantibacillus plantarum strain KP plasmid unnamed3, complete sequence	0 crisprs	NA	0
NZ_CP013751	Lactiplantibacillus plantarum strain KP plasmid unnamed2, complete sequence	0 crisprs	csa3	1
NZ_CP013749	Lactiplantibacillus plantarum strain KP chromosome, complete genome	2 crisprs	DinG,csa3,WYL,cas3,DEDDh	10
NZ_CP013750	Lactiplantibacillus plantarum strain KP plasmid unnamed1, complete sequence	0 crisprs	csa3	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

59062 : 100641

Streptococcus_phage(33.33%)

holin,transposase,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063485943.1\|59062_59698_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_068874499.1\|60965_63119_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	5.2e-105	46.9
WP_063491173.1\|63137_63599_+	hypothetical protein	NA	NA	NA	NA
WP_068874505.1\|63588_63996_+	hypothetical protein	NA	NA	NA	NA
WP_068874506.1\|64105_65071_+	DUF3991 and TOPRIM domain-containing protein	NA	NA	NA	NA
WP_063493016.1\|65067_65262_+	hypothetical protein	NA	NA	NA	NA
WP_068874507.1\|65264_65870_+	hypothetical protein	NA	NA	NA	NA
WP_068874509.1\|65872_67657_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A2C9CXH0	Yersinia_phage	1.8e-82	35.9
WP_062690082.1\|67722_68037_+	hypothetical protein	NA	NA	NA	NA
WP_068874510.1\|68130_70233_+	hypothetical protein	NA	NA	NA	NA
WP_063489405.1\|70242_71022_+	class A sortase	NA	NA	NA	NA
WP_063489404.1\|71050_74038_+	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_063489403.1\|74114_74411_+	hypothetical protein	NA	NA	NA	NA
WP_068874511.1\|74512_75427_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_021353390.1\|76486_76576_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_068874513.1\|76873_78028_-	S-adenosyl-L-homocysteine hydrolase	NA	NA	NA	NA
WP_014940864.1\|78017_78680_-	HD domain-containing protein	A0A1Q1PP35	Noumeavirus	5.0e-14	31.4
WP_063489446.1\|78679_80071_-	MFS transporter	NA	NA	NA	NA
WP_021731144.1\|80349_80463_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_063489400.1\|80695_81844_+	FRG domain-containing protein	NA	NA	NA	NA
WP_063489399.1\|82011_82506_-	HXXEE domain-containing protein	NA	NA	NA	NA
WP_063489398.1\|82595_83156_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_080476989.1\|83734_83842_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_063489397.1\|84970_85486_-	HXXEE domain-containing protein	NA	NA	NA	NA
WP_063489396.1\|85577_85904_-	DUF4828 domain-containing protein	NA	NA	NA	NA
WP_068874514.1\|85909_87745_-	DHA2 family efflux MFS transporter permease subunit	A0A0M3UL24	Mycobacterium_phage	3.5e-25	25.4
WP_050676723.1\|87916_88468_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_016526703.1\|89848_90148_-	hypothetical protein	NA	NA	NA	NA
WP_013356270.1\|90149_91010_-	ParA family protein	F0PIG8	Enterococcus_phage	1.7e-43	40.2
WP_010014534.1\|93690_93972_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_033098918.1\|93961_94468_+	mRNA interferase PemK	NA	NA	NA	NA
WP_013356307.1\|94457_94736_-	hypothetical protein	NA	NA	NA	NA
WP_003555660.1\|94758_94986_-	hypothetical protein	NA	NA	NA	NA
WP_068874515.1\|95237_97298_+	MobA/MobL family protein	NA	NA	NA	NA
WP_080476987.1\|97417_98929_+	topoisomerase C-terminal repeat-containing protein	A0A1X9I6W8	Streptococcus_phage	2.0e-106	46.0
WP_057138795.1\|99050_99266_+	hypothetical protein	NA	NA	NA	NA
WP_021353390.1\|100551_100641_-\|holin	putative holin-like toxin	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP013751

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4049 : 67414

Streptococcus_phage(55.56%)

holin,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022638817.1\|4049_5279_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	1.9e-88	48.8
WP_080476990.1\|5637_6546_+	hypothetical protein	NA	NA	NA	NA
WP_063491182.1\|6857_7148_+	hypothetical protein	NA	NA	NA	NA
WP_063491181.1\|7149_7650_+	hypothetical protein	NA	NA	NA	NA
WP_068874551.1\|7667_8135_+	hypothetical protein	NA	NA	NA	NA
WP_063491179.1\|8106_10296_+	hypothetical protein	NA	NA	NA	NA
WP_063491178.1\|10297_10930_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_187337722.1\|11141_11219_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_063491176.1\|11571_11811_+	hypothetical protein	NA	NA	NA	NA
WP_063491175.1\|11829_12738_+	hypothetical protein	NA	NA	NA	NA
WP_068874553.1\|13779_15933_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	9.6e-107	47.9
WP_063491173.1\|15951_16413_+	hypothetical protein	NA	NA	NA	NA
WP_063491172.1\|16402_16810_+	hypothetical protein	NA	NA	NA	NA
WP_063492928.1\|16919_17885_+	DUF3991 and TOPRIM domain-containing protein	NA	NA	NA	NA
WP_063485948.1\|17881_18076_+	hypothetical protein	NA	NA	NA	NA
WP_063485949.1\|18078_18681_+	hypothetical protein	NA	NA	NA	NA
WP_068874555.1\|18683_20468_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	1.3e-80	33.4
WP_022638680.1\|20533_20848_+	hypothetical protein	NA	NA	NA	NA
WP_022638679.1\|20943_23037_+	hypothetical protein	NA	NA	NA	NA
WP_022638678.1\|23046_23787_+	class A sortase	NA	NA	NA	NA
WP_022638677.1\|23817_26811_+	hypothetical protein	NA	NA	NA	NA
WP_022638676.1\|26886_27183_+	hypothetical protein	NA	NA	NA	NA
WP_063485848.1\|37067_37505_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_022638658.1\|37882_38458_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	1.6e-32	44.6
WP_022638657.1\|38567_39425_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_033607892.1\|40307_40781_-	hypothetical protein	NA	NA	NA	NA
WP_022638655.1\|41373_41655_+	BRCT domain-containing protein	NA	NA	NA	NA
WP_063492998.1\|41837_44552_+	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_022638653.1\|44681_44900_+	hypothetical protein	NA	NA	NA	NA
WP_068874557.1\|44900_46712_+	hypothetical protein	NA	NA	NA	NA
WP_022638651.1\|46793_47192_-	hypothetical protein	NA	NA	NA	NA
WP_022638650.1\|47184_47505_-	hypothetical protein	NA	NA	NA	NA
WP_022638649.1\|47497_48799_-	Y-family DNA polymerase	M1Q231	Streptococcus_phage	8.4e-82	39.3
WP_022638648.1\|49079_49367_-	hypothetical protein	NA	NA	NA	NA
WP_099735248.1\|49350_50304_-	AAA family ATPase	A0A1X9I765	Streptococcus_phage	3.5e-21	28.3
WP_022638646.1\|51043_52576_+	primase C-terminal domain-containing protein	NA	NA	NA	NA
WP_068874559.1\|52884_55506_+	hypothetical protein	NA	NA	NA	NA
WP_022638644.1\|55831_56158_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_022638643.1\|56235_56799_-	cadmium resistance transporter	NA	NA	NA	NA
WP_022638642.1\|57083_57467_+	hypothetical protein	NA	NA	NA	NA
WP_022638641.1\|57438_58098_+	hypothetical protein	NA	NA	NA	NA
WP_022638640.1\|58113_60066_+	conjugation-related ATPase	NA	NA	NA	NA
WP_063491305.1\|60067_60274_+	hypothetical protein	NA	NA	NA	NA
WP_063491307.1\|60274_61438_+	CHAP domain-containing protein	A0A0A0RSI6	Bacillus_phage	4.5e-10	35.5
WP_063491308.1\|61450_62080_+	hypothetical protein	NA	NA	NA	NA
WP_022638636.1\|62100_62256_+	hypothetical protein	NA	NA	NA	NA
WP_063491310.1\|62373_62613_+	hypothetical protein	NA	NA	NA	NA
WP_068874561.1\|62638_63367_+	hypothetical protein	NA	NA	NA	NA
WP_063491314.1\|63924_64884_+	DUF3102 domain-containing protein	A0A2H4JAH5	uncultured_Caudovirales_phage	2.0e-32	39.7
WP_022638631.1\|64880_65093_+	hypothetical protein	NA	NA	NA	NA
WP_063491315.1\|65094_65310_+	hypothetical protein	NA	NA	NA	NA
WP_063491317.1\|65309_65615_+	hypothetical protein	NA	NA	NA	NA
WP_063491319.1\|65604_66030_+	thioredoxin family protein	NA	NA	NA	NA
WP_022638817.1\|66184_67414_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	1.9e-88	48.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP013749

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013749_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013749_1

1220668-1220753

Orphan

Consensus_repeat	Method
AATAAGATACTTTAAGTTTCTTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013749_1

>merge|NZ_CP013749|1|1220668-1220753|CRISPRCasFinder
AATAAGATACTTTAAGTTTCTTATTGACTTTTTCTTTATATAGCGTATTATACCAGTTATGCGAATAAGACACTTTAAGTTTCTTA

>NZ_CP013749|1|1|1220668-1220753|CRISPRCasFinder
AATAAGATACTTTAAGTTTCTTA	TTGACTTTTTCTTTATATAGCGTATTATACCAGTTATGCG
AATAAGACACTTTAAGTTTCTTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013749.1\|WP_003643398.1\|1220050_1220650_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP013749.1\|WP_003642338.1\|1231072_1232485_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143418
NZ_CP013749.1\|WP_022638457.1\|1212840_1213296_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|100047
NZ_CP013749.1\|WP_003642345.1\|1223535_1224102_+\|DUF1211-domain-containing-protein	unknown	unknown	gnl\|CDD\|226078
NZ_CP013749.1\|WP_003642340.1\|1227649_1227934_-\|DUF1905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378097
NZ_CP013749.1\|WP_022638461.1\|1224250_1225288_-\|aldehyde-reductase	unknown	unknown	gnl\|CDD\|187538
NZ_CP013749.1\|WP_022638459.1\|1215982_1216978_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP013749.1\|WP_022638462.1\|1228219_1230802_+\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|119382
NZ_CP013749.1\|WP_022638458.1\|1214352_1215246_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187572
NZ_CP013749.1\|WP_003642355.1\|1213312_1214059_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP013749.1\|WP_011102046.1\|1211694_1212531_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|212492
NZ_CP013749.1\|WP_003642342.1\|1226139_1226868_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP013749.1\|WP_003642350.1\|1217969_1218764_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP013749.1\|WP_003642346.1\|1222362_1223316_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318
NZ_CP013749.1\|WP_011102039.1\|1227000_1227366_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP013749.1\|WP_011102040.1\|1225414_1225981_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP013749.1\|WP_022638460.1\|1220767_1222246_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP013749.1\|WP_044432936.1\|1219048_1219930_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238558
NZ_CP013749.1\|WP_003643400.1\|1216974_1217973_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP013749.1\|WP_003643401.1\|1215226_1215739_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100

Protein	Function_ID	Function_description	E-value
NZ_CP013749.1\|WP_003643398.1\|1220050_1220650_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.95133e-09
NZ_CP013749.1\|WP_003642338.1\|1231072_1232485_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143418	cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like. Succinate-semialdehyde dehydrogenase 1 (SSADH1, GabD1, EC=1.2.1.16) catalyzes the NADP(+)-dependent oxidation of succinate semialdehyde (SSA) to succinate. SSADH activity in Mycobacterium tuberculosis (Mtb) is encoded by both gabD1 (Rv0234c) and gabD2 (Rv1731). The Mtb GabD1 SSADH1 reportedly is an enzyme of the gamma-aminobutyrate shunt, which forms a functional link between two TCA half-cycles by converting alpha-ketoglutarate to succinate.	0
NZ_CP013749.1\|WP_022638457.1\|1212840_1213296_+\|hypothetical-protein	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	4.35635e-53
NZ_CP013749.1\|WP_003642345.1\|1223535_1224102_+\|DUF1211-domain-containing-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	5.75015e-29
NZ_CP013749.1\|WP_003642340.1\|1227649_1227934_-\|DUF1905-domain-containing-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	1.07383e-22
NZ_CP013749.1\|WP_022638461.1\|1224250_1225288_-\|aldehyde-reductase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.1504e-93
NZ_CP013749.1\|WP_022638459.1\|1215982_1216978_-\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.20451e-78
NZ_CP013749.1\|WP_022638462.1\|1228219_1230802_+\|SH3-domain-containing-protein	gnl\|CDD\|119382	cd06522, GH25_AtlA-like, AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.	2.40303e-70
NZ_CP013749.1\|WP_022638458.1\|1214352_1215246_+\|SDR-family-oxidoreductase	gnl\|CDD\|187572	cd05262, SDR_a7, atypical (a) SDRs, subgroup 7. This subgroup contains atypical SDRs of unknown function. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	2.26987e-130
NZ_CP013749.1\|WP_003642355.1\|1213312_1214059_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.40011e-91
NZ_CP013749.1\|WP_011102046.1\|1211694_1212531_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|212492	cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs. Classical SDR subgroup containing retinol-DHs, LPORs, and related proteins. Retinol is processed by a medium chain alcohol dehydrogenase followed by retinol-DHs. Pchlide reductases act in chlorophyll biosynthesis. There are distinct enzymes that catalyze Pchlide reduction in light or dark conditions. Light-dependent reduction is via an NADP-dependent SDR, LPOR. Proteins in this subfamily share the glycine-rich NAD-binding motif of the classical SDRs, have a partial match to the canonical active site tetrad, but lack the typical active site Ser. This subgroup includes the human proteins: retinol dehydrogenase -12, -13 ,and -14, dehydrogenase/reductase SDR family member (DHRS)-12 , -13 and -X (a DHRS on chromosome X), and WWOX (WW domain-containing oxidoreductase), as well as a Neurospora crassa SDR encoded by the blue light inducible bli-4 gene. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.88105e-54
NZ_CP013749.1\|WP_003642342.1\|1226139_1226868_-\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	1.6523e-89
NZ_CP013749.1\|WP_003642350.1\|1217969_1218764_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	5.60764e-114
NZ_CP013749.1\|WP_003642346.1\|1222362_1223316_+\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	5.65843e-131
NZ_CP013749.1\|WP_011102039.1\|1227000_1227366_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.16334e-31
NZ_CP013749.1\|WP_011102040.1\|1225414_1225981_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	7.31502e-05
NZ_CP013749.1\|WP_022638460.1\|1220767_1222246_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.10264e-72
NZ_CP013749.1\|WP_044432936.1\|1219048_1219930_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	2.72098e-56
NZ_CP013749.1\|WP_003643400.1\|1216974_1217973_-\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.31826e-81
NZ_CP013749.1\|WP_003643401.1\|1215226_1215739_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	3.33884e-08

>NZ_CP013749.1|WP_003643398.1|1220050_1220650_-|TetR/AcrR-family-transcriptional-regulator
MTKTRRRGAELENAIYQAARDILNQDGLEQLTFANVAEQAGTSKPVIYRRWRSPLELAIAAIQDQIITENHGQLDEVSLTGQTLSEDLFQVLKRFTVSINTFNQALVITWFHHLDQQANPEVKDLLNAVKKIDAHAIERVCQRAQQRGELRTGTLSCDLQLMPFDWLRYRAFANEPITDATLHLLVDDLLVPAYQHALG
>NZ_CP013749.1|WP_044432936.1|1219048_1219930_+|ABC-transporter-substrate-binding-protein
MGSLLLGACGAKQPTSTTVTRTDYLKHKVKVPKHPKRIVASYLEDDLVALGIKPVVQWSVKNGSGTQAYLKEQLKGVPLIDYSLPYEAVTKAKPDLILIGTSSAVANGKYAQYNKIAPTYVVKNGTTVTWRQTFLDVAKVVNRQAKAKKVLAKYDKQVQTTRQALKKSGQHKVAVLWVTNNTAYMVNDNSASGALLYQDLQLGEPSLVKQVSKSATADWSAVSLEKLAKLDADDIFLVNSQKSASLFKDPLWKNIKAVKNNHLYQYGDSSSWQYSGPIAYSQMIDMVKTDLLK
>NZ_CP013749.1|WP_003642350.1|1217969_1218764_-|ABC-transporter-ATP-binding-protein
MNTIEAQNISIGYGDKVIVDQLSITIPHGQITTLIGPNGSGKSTLIRAIAHLLPPTTGVILLDHQNIQQIKSKTFAKKIAVLPQTNQTANDLTVEELVSFGRLPYRRPLSGLTTTDHQKIEWALTQASLQDLRQRPLSTLSGGQRQRAWIAMAVAQDTDTIILDEPTTYLDLTHQLEVMQLVKKLNEQAHRTIIMALHDLNHAARISDQLIALKDGHVLAHGPVSTVMTAANLKTIFNIDATLVDYHGTPLILTYNGCQEVAPA
>NZ_CP013749.1|WP_003643400.1|1216974_1217973_-|iron-ABC-transporter-permease
MKSTSRYWGWLALSTGVLILVMGLSLRFGADQMRTATVWHALTTTHTGNLDQQIIRHIRVPRVLGAALIGAALAGSGALMQAVTRNPLADSGLLGINAGAGLMLTLCLAFFPKLSTLQTTGWAIIGAAASAGLIFSISTARHVQLDPTILVLAGIAISSLLTALSEGLALVLQLKQDLAFWYFGGLGAVSWTQLKFLGPGLVLGLLLTLLLAPQLNLAYLTDDNAQSLGKSLPLLRGLALICAVILSGISVALVGTITFVGLMIPHMARWLVGANYRNSMPLTLILGATLTVGADLIARLVNPPHETPFGIIISLIGVPCFIYLARKEPMKA
>NZ_CP013749.1|WP_022638459.1|1215982_1216978_-|iron-ABC-transporter-permease
MSPNRRLIIWSLLLTASMLGLAILNLSTGTMTISWPALLGILTSRGNATDMLVLVNFRLPRIVLAIMVGWALALSGNVLQTVTNNPMADPSLLGINNGAGLAVMLLIIGAGTNASLTLSLPIVALAGAWLSTALIFLLANQRQRGISSKRLLLVGVALSGCFSALMVLMTLKLSPDNYQFVMNWLAGSLWGTDWSYIGWALPWLAVGSGILFIQLPVLDAFTLDTTTAQTLGINLKRQQLGLISVAAMLAGVSVAISGGISFIGLITPNLARRIVGSRQRYQLPLAGLLGSTLLLAADTLGKLITTTTELPAGVLVALIGAPYFIYLLVRG
>NZ_CP013749.1|WP_003643401.1|1215226_1215739_-|TetR/AcrR-family-transcriptional-regulator
MANQRNQRMQATILLAYENLLSDKPFRKITVQDISDAALVHRSTFYKHFQDQYDLLEALFEQKRQQSKLTIDQIFTHPFETLNSFGNARFQETLRHQFNDDAFRDAFLNYLIHLCKDTVDDDQRLVRFLAVGRIKGLTLWITVGNAPYNIFTDTATLDNIFSNPLNTVNY
>NZ_CP013749.1|WP_022638458.1|1214352_1215246_+|SDR-family-oxidoreductase
MKVFITGGTGFVGSAVVQELVANGFEVVGLARSETSAQKLISWGAQPVRGSLTSLSTLATAAAQADAIIHLGFNNDFRYFFQAGAMDRRAIETMGRAISGTNKPLVVTYGTTGIRKHVETEHEVADTGLLKWLTPRKSEIVARQLMAQNINAFVVRLSPAVHGAGDMGFTRTVIERAKKSHRAEYFGLGTHAWSAVHRLDAAHLFYLVTMYGLEHPTTNERVFNAVAEESITIAAIARTISRKLNVPLKAKYNPLSFGDTAMLYLINCPTSSQLTRQILGWVPVQPDLLTDISSSRY
>NZ_CP013749.1|WP_003642355.1|1213312_1214059_+|SDR-family-oxidoreductase
MSIKGKVVVITGASSGIGAATAKLLAAKGAKVVLGARREERLQALSQAIGDNAVYQVTDVTDRQQVRALIDLAVSKFGRVDVLYNNAGTMPQGNLSDREYDKWQMMLNVNIMGVLNGIGEVLPIMQKQHDGLIIATDSVAGHVVYPASAVYNGTKYAVRAIMEGLRQEEKEHGIRSTIVSPGAVRTELVNTIGNTQIQAGISELMNADDRQGLALNPEDIANAVLFAIDQPKHVAISEVLVRPAQQEV
>NZ_CP013749.1|WP_022638457.1|1212840_1213296_+|hypothetical-protein
MNVTREPSEIRERLAEITGQTIDISVEIRVPLWTDYGRNLKIGKRVFINDNVQITDLGGIKLADDVLIGPGAMLLSVNHPLDPAKRHAVEVQPIHIERNAWIGAGAKVLAGVTVGENAVVGAGAVVTKSVPANTVVAGVPAKVIKTIEQVD
>NZ_CP013749.1|WP_011102046.1|1211694_1212531_-|SDR-family-NAD(P)-dependent-oxidoreductase
MQSKLAVIIGGTSGVGKHTAIDLANQNYHVIIVGSRADKGRQAQADISQATGNQAVQLALADLSTKTGVQQFAHQLAAMTDHIDILLNSIGVILPERHLSADGYDLNLVLNYLTHFWTIQALLPLLKHSDQARILLVGALPFVINHAKVSLPDFDAPATSKYNAMTVTAQATAARVLLTLALSERLTATNVTINIFHPGYVPDSNFGAGGSWVSRLAGRILGESFSRKNSPIGAWLATAPELTHTSGHFYDDRLRQVRLSKQYTRSKANDLWRLSSQY
>NZ_CP013749.1|WP_022638460.1|1220767_1222246_+|DHA2-family-efflux-MFS-transporter-permease-subunit
MQAKAKISKATMTIAWVVVFGAMAPLLDSTMINIAINNLVTSFHSSVTTVQWAVTGYLLATGVAVPFSSWLLNRFDGKAVFVAGEILFGLGSIFAAVAPNIQLLIIARLVQGFAGGLIMPLLTTLLVQTAGAAVMGQMMATVGLPMILGPLIGPVIGGIIIKFASWHWIFWINVPVVLISIALILWKMPNYPAQNRTAKMDFIGILLLIVSSSAIIYSLVNAAHTDRFNNATSIEMLILGAIALISYVVWAAWQKERAVVPLHLFKFASFDGAGLGLFIAGTVLNGAMLLLPLYFQNVRGMSVINAALALLPQGAGMLVSRTLTGRLTDQIGAKYVVLGSVVITFVGTLPFYWFGQQTSYWILALILFVRGIGAGGILMPLMADAYTGMQPGQVPAATIGTRIIQNIGSAFGSALITTIVTAYSTHQVNVFERHLKAETYHVDAAHLQVFTTSHLQAIRLAAFQQGFLVIAIAAIVIILPTLLLTNKLKAAK
>NZ_CP013749.1|WP_003642346.1|1222362_1223316_+|aldo/keto-reductase
MKTIQIGASQLKASAVALGIMRMVRLDTDAAANVLETVHDRGVNFIDSADIYGNGDSERIFGQALKQSSLKREDFFIQSKGGIVLDPEKSSGELVFGQRYDFSKQHLIATVDKILQRMQLDYLDSFLLHRPDPLMDPAEVAAAFDELQATGKVRHFGVSNFNPMQVEMLQAAVSQKLMINQLQFGVMHTGPIQFGLHTNMQDTASLNHDGEIIEYSRLHHMTIQAWSPYQYGMFAGTFIDNPKFPELNAKLQELADQYHVTKNAIATAWILRHPANMQVILGSMNPQHLDESIAGTDVTLTRQEWYDVYFAAGNDLP
>NZ_CP013749.1|WP_003642345.1|1223535_1224102_+|DUF1211-domain-containing-protein
MNKARLEAFTDAIIAIVLTLLVLDLPRPQTPSVRALFAEWQSIYVYIITFTLLISIWLNHHDLFVQVKKIDRVVFWANSFWLLCQSFIPFMASWITKFPHSKWPAVFYILTGFVWMLAYQLLVAAVRRLNPHIHRMSSPALSVVFGGFLVVLTVALINPDVGLFLIPVHAFASVILATKRKWHLRKYF
>NZ_CP013749.1|WP_022638461.1|1224250_1225288_-|aldehyde-reductase
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGGITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPAVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVSSAKYSHSNIQIQQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTIPNAAVKLAAKARPELRMVASLVGTYAETSNHKAQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>NZ_CP013749.1|WP_011102040.1|1225414_1225981_+|TetR/AcrR-family-transcriptional-regulator
MAATNHAQAIKKDSQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLTAYFAPAIAARFQDVLQHVPANRKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNANMTNYYQATMTNGMLTAVQLKYWTRFMSAGVYAIWREWLLGGQLESLTTIHEILATLQTATMQALTQAQK
>NZ_CP013749.1|WP_003642342.1|1226139_1226868_-|SDR-family-oxidoreductase
MKPLVVITGASSGFGAEIAKLFAADNYPLLLLGRRQAKLAALSANFENAMIDTVDVTNYHQFETAVRKAEAKYGKTDLLVNNAGLMLLGNVQNQDPQEWQTMLNTNVMGVLNGTQIVLNDMRDREHGTILNMSSLAGKKTFVNHAAYVASKFGVHGLSETLREENAPKNVRVMLVAPGAAETELLTHVTSKSALSDYEAWKASMGGLTLDPKHVAATVKFMYDMPQNVNIREVDIAATAQDA
>NZ_CP013749.1|WP_011102039.1|1227000_1227366_+|helix-turn-helix-transcriptional-regulator
MLKERVTAQPRYRNEFDATMQLIRGKWKIMILFELAEVKVSRFADLQHHIQAVSHKTLASQLKELEQDELIERHDFKTAQPHVEYRLTAKGQSLIPILDAICTWGDQHVDPALIERSLCDE
>NZ_CP013749.1|WP_003642340.1|1227649_1227934_-|DUF1905-domain-containing-protein
MKTYQFDAPIQAATIGKGGAYVACPFDIRDLFGKGRVKVHATFDEVPYNGSIVNMGVKNLDGSICYILGIRKDIRAKLHKSIGDVVAVTVTAID
>NZ_CP013749.1|WP_022638462.1|1228219_1230802_+|SH3-domain-containing-protein
MNFKSQNPIDASQSERFKLYKSGKLWLVAGLTFFSFLGGSVLNNTNVHADATNATTTSSSAASTASSASVATSSAASDATTKATSVSSSAATQVTSAATTKTTSQAATASSSAATSQSTSTASSSTSQATKTASSAATSTSATATSQATSVASSTATTTQVSHTASSTAASAASSTATVKAVKAASSTVSSAATTATKATAKVAAVAYTAATTSSTDVWTIGDTTRPRVDVVDVASYQSTMTQSDFNKLKAAGVKTVIVKSTEGTDYTNPAALNQAKMANKAGLNVDFYHYATFSTADAAKSEATNMAGFLVKNNVSTKVLLFADMEDSSSYSVNATANLNAFWSTLDSFGYKNHGVYTSNSYLYRDAVVKTVGQSRVWRAQYPYTPSANNLWNTNDGAWQFSDTALLPSGSDYTGYIDVSIDYNGLTEDSAGTNTFVTTTSSNDTTTSEVTTDTSATTNTSTSSTTKKASGWYTFTKNTAIKSAASDSAKTVGTYSKGNRVYYNAEITTNGETWLRYLSYSGSEHFVKIAAAKTTTTKPAASTSKTVTKNETGTYKFTKTTAIKGSVSDSAKTLGTYYKGDTVYYNAKVTKNGETWLRYLSYSGAQHYVKISGAATSTTTTKPATGSSKTVTKAETGTYKFTGTTAIKGSVNDSAKTLGTYYKGDTVYYNAKVTKNGQTWLRYLSYSGAQHYVKISGAATTTTTSSKSTATASAKTVAQSGTYKFAKTTAIKSSASDAASTVGTYYKGNTVNYNAKVTTNGQTWLRYTSYSGAQHYVKVSGGAATTTSSSASKTTAAAGTYTFKTTTNIRTAASLNASVVGQYSAGESVYYIGTVSADGYQWLKYLSNSGAYHYVAKIG
>NZ_CP013749.1|WP_003642338.1|1231072_1232485_-|NAD-dependent-succinate-semialdehyde-dehydrogenase
MAYQTINPYTNEVVKTYDNATTDQIEQALTTGDALYHQWRHEPVSSRAASLHKIAALLREHKDELAKIATIDMGKLLSESQGEVELCAMIADYYADHGAELLAPTPISTQATGDAEIEKQATGVLMLVEPWNFPYYQIMRVFAPNYMVGNPMILKHASNTPGSAAAFAKIVEEAGAPAGSLTNLFLNYDQVSDIIADPRIQGVALTGSKRGGQAVAKAAGANLKKSSMELGGSDAFVVLADADIDEAVNLAWRVRLYNAGQVCTSSKRFIVAADVYDDFLAKLKERFAKLVPGDPMDPQTTLAPMNSKRAKEKLQDQVDRAIAGGATVAYGNEPIDLPGQFFQPTILTDIDQDNPLFYEEMFGPVAQVFKVDSEQAAIDLANNSELGLGGIVFAGTAAHGKAVAQQIETGMVFVNTFLSSLPELPFGGVKGSGYGRELSSLGLMAFVNEKLVVTAQKPDYDNGAGGLVVL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013749_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013749_2

1452261-1452458

Orphan

Consensus_repeat	Method
GGCCGACGTTGCACTCTGGCTCGTCGTGCTAGTGACTGAACTAGCACT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013749_2

>merge|NZ_CP013749|2|1452261-1452458|CRISPRCasFinder
GGTTACCGTTGTACTTTGACTAGCCGCACTTTTTACTGAACTAGCACTGGCTTGACTAGTACTGCTTTGGCTAGCGGCCGACGTTGCACTCTGGCTCGTCGTGCTAGTGACTGAACTAGCACTGGCTTGACTAGTACTACTTTGGCTAGTGGCCGACGTTGCACTCTGGCTCGTCGTACTAGTGACTGAACTAGCACT

>NZ_CP013749|2|2|1452261-1452458|CRISPRCasFinder
GGTTACCGTTGTACTTTGACTAGCCGCACTTTTTACTGAACTAGCACT	GGCTTGACTAGTACTGCTTTGGCTAGCGGCCGACGTTGCACTCTGGCTCGTCGTGCTAGTGACTGAACTAGCACTGGCTTGACTAGTACTACTTTGGCTAGT
GGCCGACGTTGCACTCTGGCTCGTCGTACTAGTGACTGAACTAGCACT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013749.1\|WP_003642132.1\|1444484_1445747_+\|ArgE/DapE-family-deacylase	unknown	unknown	gnl\|CDD\|181490
NZ_CP013749.1\|WP_013355871.1\|1458769_1459780_+\|putative-sulfate-exporter-family-transporter	unknown	unknown	gnl\|CDD\|225411
NZ_CP013749.1\|WP_003644818.1\|1454691_1456236_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340855
NZ_CP013749.1\|WP_003642134.1\|1441117_1441819_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224059
NZ_CP013749.1\|WP_003642126.1\|1449402_1450302_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226631
NZ_CP013749.1\|WP_003644758.1\|1447291_1448035_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP013749.1\|WP_003644759.1\|1446957_1447278_+\|carboxymuconolactone-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|223672
NZ_CP013749.1\|WP_003644756.1\|1451224_1451725_-\|methylated-DNA--[protein]-cysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|223427
NZ_CP013749.1\|WP_003644761.1\|1445918_1446353_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133384
NZ_CP013749.1\|WP_003644815.1\|1460485_1460986_-\|DUF4811-domain-containing-protein	unknown	unknown	gnl\|CDD\|374344
NZ_CP013749.1\|WP_003644757.1\|1448192_1449410_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224582
NZ_CP013749.1\|WP_011101931.1\|1460982_1462467_-\|multidrug-efflux-MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP013749.1\|WP_003642122.1\|1453438_1454383_-\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	unknown
NZ_CP013749.1\|WP_013355872.1\|1456232_1457741_+\|accessory-Sec-system-glycosyltransferase-Asp1	unknown	unknown	gnl\|CDD\|340855
NZ_CP013749.1\|WP_003644760.1\|1446525_1446924_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380361
NZ_CP013749.1\|WP_013355869.1\|1463461_1464649_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
NZ_CP013749.1\|WP_003644813.1\|1462680_1463343_+\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319787
NZ_CP013749.1\|WP_003642119.1\|1457825_1458653_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP013749.1\|WP_033607854.1\|1459863_1460427_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
NZ_CP013749.1\|WP_003642133.1\|1441812_1444404_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223650

Protein	Function_ID	Function_description	E-value
NZ_CP013749.1\|WP_003642132.1\|1444484_1445747_+\|ArgE/DapE-family-deacylase	gnl\|CDD\|181490	PRK08588, PRK08588, succinyl-diaminopimelate desuccinylase; Reviewed.	0
NZ_CP013749.1\|WP_013355871.1\|1458769_1459780_+\|putative-sulfate-exporter-family-transporter	gnl\|CDD\|225411	COG2855, COG2855, Predicted membrane protein [Function unknown].	2.81967e-67
NZ_CP013749.1\|WP_003644761.1\|1445918_1446353_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133384	cd01109, HTH_YyaN, Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	2.12096e-48
NZ_CP013749.1\|WP_003642134.1\|1441117_1441819_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224059	COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms].	4.59578e-102
NZ_CP013749.1\|WP_003642126.1\|1449402_1450302_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226631	COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only].	1.14298e-136
NZ_CP013749.1\|WP_003644758.1\|1447291_1448035_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	4.86242e-97
NZ_CP013749.1\|WP_003644759.1\|1446957_1447278_+\|carboxymuconolactone-decarboxylase-family-protein	gnl\|CDD\|223672	COG0599, COG0599, Uncharacterized homolog of gamma-carboxymuconolactone decarboxylase subunit [Function unknown].	5.24383e-25
NZ_CP013749.1\|WP_003644756.1\|1451224_1451725_-\|methylated-DNA--[protein]-cysteine-S-methyltransferase	gnl\|CDD\|223427	COG0350, Ada, Methylated DNA-protein cysteine methyltransferase [DNA replication, recombination, and repair].	1.72955e-47
NZ_CP013749.1\|WP_003644818.1\|1454691_1456236_+\|glycosyltransferase	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	8.2518e-93
NZ_CP013749.1\|WP_003644815.1\|1460485_1460986_-\|DUF4811-domain-containing-protein	gnl\|CDD\|374344	pfam16069, DUF4811, Domain of unknown function (DUF4811). This family of proteins is found in bacteria. Proteins in this family are typically between 188 and 241 amino acids in length. There is a single completely conserved residue Y that may be functionally important.	1.81864e-41
NZ_CP013749.1\|WP_003644757.1\|1448192_1449410_-\|ABC-transporter-permease	gnl\|CDD\|224582	COG1668, NatB, ABC-type Na+ efflux pump, permease component [Energy production and conversion / Inorganic ion transport and metabolism].	6.10363e-34
NZ_CP013749.1\|WP_011101931.1\|1460982_1462467_-\|multidrug-efflux-MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	6.06458e-95
NZ_CP013749.1\|WP_013355872.1\|1456232_1457741_+\|accessory-Sec-system-glycosyltransferase-Asp1	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	1.15478e-80
NZ_CP013749.1\|WP_003644760.1\|1446525_1446924_+\|cupin-domain-containing-protein	gnl\|CDD\|380361	cd02233, cupin_HNL-like, Granulicella tundricola hydroxynitrile lyase (GtHNL) and related proteins, cupin domain. This family includes archaeal, eukaryotic, and bacterial proteins homologous to hydroxynitrile lyase from Granulicella tundricola (GtHNL), a novel class of HNLs that does not show any sequence or structural similarity to any other HNL and does not contain conserved motifs typical of HNLs. HNLs comprise a diverse group of enzymes that vary in terms of their substrate specificity, enantioselectivity and the need for a co-factor. In plants, they catalyze the reversible cleavage of cyanohydrins, yielding HCN and aldehydes or ketones. Also included in this family is TM1010 from Thermotoga maritima, a protein of unknown function. Some but not all members of this family have N- or C-terminal carboxymuconolactone decarboxylase domains in addition to the cupin domain. Members of this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	8.25352e-52
NZ_CP013749.1\|WP_013355869.1\|1463461_1464649_+\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.63824e-66
NZ_CP013749.1\|WP_003644813.1\|1462680_1463343_+\|HAD-family-hydrolase	gnl\|CDD\|319787	cd02588, HAD_L2-DEX, L-2-haloacid dehalogenase. L-2-Haloacid dehalogenase catalyzes the hydrolytic dehalogenation of L-2-haloacids to produce the corresponding D-2-hydroxyacids with an inversion of the C2-configuration. 2-haloacid dehalogenases are of interest for their potential to degrade recalcitrant halogenated environmental pollutants and their use in the synthesis of industrial chemicals. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	4.60136e-60
NZ_CP013749.1\|WP_003642119.1\|1457825_1458653_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	6.66516e-33
NZ_CP013749.1\|WP_033607854.1\|1459863_1460427_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	4.34607e-25
NZ_CP013749.1\|WP_003642133.1\|1441812_1444404_+\|ABC-transporter-permease	gnl\|CDD\|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	3.85225e-14

>NZ_CP013749.1|WP_003644756.1|1451224_1451725_-|methylated-DNA--[protein]-cysteine-S-methyltransferase
MHLTLTQTTINQQTYWLGTTPTGLAFVGRANGPRDEWQAFFKSANIHYDQQANQQACQELHDYLTGQRQHFDIPLDQTTGTPLQHQVWQALTRIPYGQTATYSQLATMINHPTAVRAVASAVGQNPLLIVIPCHRIRRKDGQLGGYRGGLPMKRALLALENARLPK
>NZ_CP013749.1|WP_003642126.1|1449402_1450302_-|ABC-transporter-ATP-binding-protein
MLSIAHIQKRFGTVQALNDVSFDVHDGEIMGLIGQNGAGKSTTFHSILNFLSFDGQITWNGQPLTADDYDQIGYLPEERSLMSKLTITQQIVYLARLKNQPARVTKGKIAAWMKRFAVKGQPTDKIDKLSKGNQQKVQLICTLIHDPKLIILDEPFSGLDPVNADLLKQAILDAKQRGAAIIFSSHDMSNVEAICDSLVMLRNGEAVLKGTVEDVRAQFGRTRLFLTTDWSQAQLADLPGVTTVTQQGARRFRLELADASVGPAIFDQVTAGHYIEEFSQQPPTLDEIFRTEAGGVNHE
>NZ_CP013749.1|WP_003644757.1|1448192_1449410_-|ABC-transporter-permease
MNKTWIVTFETYLRQIKSWSFLSLVFMPFLFFGFVAAFSYFAAPSASKNDIAVVSTSPQLRTSFIKQSHVATANKYQTLASAKAATKRNDIAGYLVLTTKNQQLQAQFTGPNAVSSGDKAKIQQFLATAQSQRNVQRAQLSAKQTQALTVQPKFTEQLQKHAASDKTAKTVSFYIVVFFVYLILTTYSAITAQEIAADKGTKIMEVIFSSTTPRKYFNGKIYGVLLVIVTQLLVYLVGGFAVMQFVKRSSLTIDFWQQNTDLINQVIHNLVSINLLFALLAVLLYTVASAFCGALVTRVADASKAAQPVIYLSMLAFFMALAFQNTPTNLFVKIFSYIPFFSSYFMPLRLINGMATMPAAIVSLLILIATIIGSMIYIGRIYGGLMLQTDELGFWGNLKRGLRLK
>NZ_CP013749.1|WP_003644758.1|1447291_1448035_+|SDR-family-oxidoreductase
MTVKNKVVVITGASSGIGATTAKQLASNGAKVVLGARREERLAALVDEIKAAGGQAAYQVTDVTKSADVQALVKLAQTQFGGLDVIFNNAGIMPTSPISALHTDEWDQMVDINIKGVLNGVAAVMPIFTAQKSGQIITTSSVAGIKSFAGSGVYGATKFAVRNLMEVIRMESAQEGTNIRTVSLYPAAINTELLHTITDKTAKQNMTDFYQQVGISPAAVANVVNFAIDQPEDVNVNEFTIYPTKQA
>NZ_CP013749.1|WP_003644759.1|1446957_1447278_+|carboxymuconolactone-decarboxylase-family-protein
MTVKQTAGRDNLGKLAPQFAALNDDVLFGEVWARESTLSLHDRSMITIACLMTSGDFPQLKAHFKMGKDHGISKDEAVEIVTHLAFYAGWPKAWSAMALIKEVYGE
>NZ_CP013749.1|WP_003644760.1|1446525_1446924_+|cupin-domain-containing-protein
MTTTNNSGLFGLGVKNEAYQQYFIGQSYLNALAGDEQVDVNVSNVTFEPGCRNNWHIHHNGYQILLVTSGEGWYQEAGKPAQLLHPGDVVTIHPGVKHWHGATKDSWFAHIAITKGTSEWLEPVDDEAYAKL
>NZ_CP013749.1|WP_003644761.1|1445918_1446353_-|MerR-family-transcriptional-regulator
MVRTTTERYSIGDFAKAVGLSAPTLRYYEKAGLIEPHRLDNGRRYYETADINWVKFLLHLKGTGMSISELQQYVTWRAAGDDTIPQRLALLKHVKEDFLVQFNEVQHHLQILNDKINWYEEKEAGITQDHEDFSSYLQRFGHHE
>NZ_CP013749.1|WP_003642132.1|1444484_1445747_+|ArgE/DapE-family-deacylase
MNGMAETAQLEAAVQALSDIVKMNTVNNHEQLVADYLVTLLKQHGIEAQSIEYAPGRVNLVAEIGDGHGPVVALDGHEDTVALGDADKWHTDPLAATIKDNRLYGRGVTDMKAGLMAEVFAMIALHDQDAPLHGTVRLLATVGEEVDHLGAEQLTELGYADDIQTLICAEPSGADKQLLLTKSIQAMLGVDGDTAQRMADANPTTEQHFIELAHKGSLTYTIKAQGVAAHSSMPAIGQNAIDMLMTYYQKQTAYFDSFKTIVNPVLGPTVPVVTLISGGEQVNTVPASAEMSVKIRTIPELRNDRLIKDLEAIIAECNADGANLTMDIASSFYPVHTPEDSQLVQLAKKVGEQVLQQRLPYFGAPGGTDASSYIVKSPDMQVIVFGPGNITAHQVNEYVDLDMYGRFIEIYQKMITELLA
>NZ_CP013749.1|WP_003642133.1|1441812_1444404_+|ABC-transporter-permease
MVGAAMTAAYFKTIMREIWSSKARFASILLIIFLGVAFYTGIRATGPDMSQAANDYYAKQKLATNSVQSTMGLTKADTRVLNQHRSQLTYQATRYADVNQLNNSQVVRVMALPTTQRLNRLRIVKGRLPRHANEIVLDAQAQRLQPKLKVGSTYRISSTAKRNAQFTRRTFKVVGFVNSPTYVENTNRGVTNVGKGTLDYLVYVRPQVIKSSVITRIDVQFKNLRGVTPYTAKYRRLNRENTAQLKRWLKPQARKRQQALQAQAQAKLKPLQQATQQLASQVPAGTAQLVKLQSQLKRAQAQVAAITMPTYLYTDRTDNPGYTEYHENTQRVVALSTVFPLFFIAIAALICLTTMTRMVEELRLQMGTLKALGYTNTAVGSEFMIYGGLAALIGTALGVLFGVNFFPRFIAQAYGSMYNLPAINVQYIWMDIGIALAIALLCTLGTALVVLRVDLNSLPAQLLQPRSPKAGKTLLLERWQWLWHRLSFNHKITLRNLFRYKQRLLMTVLGIAGCMAMMITGFGLKDSIGDISVKQFNELWHYDAVVTRSGNETDQQRQALSRGQLYQASLKLQAKQVTVKQSGVAEQTATLGIPAPHQSLSKFVVLRHRQSHQAIHIGDRGAVIDEKLAKLYGVQAGDDLTIKLAGQTTKRIHISAVAENYVNHFIYMSPTYYRRVFKQAPVYNTNYVRFKQATKKQENAYADRLLKQAGVQNVTLMSTEKATNFKMLDSMNLVVLIFVISAGALALVVLYNLTNINVSERIRELSTIKVLGFYDGEVTMYIFRENLILTVLGIIAGCFLGNWLHAYILQTAETNALMFSPTIHPLSYVYAALLTLAFSLLVMGMMHRKLKRVNMLDALKSVD
>NZ_CP013749.1|WP_003642134.1|1441117_1441819_+|ABC-transporter-ATP-binding-protein
MAYIEVQQATRQFKNGEQVTVANRDISFEVDQGAVVVILGPSGAGKSTLLNILGGMDSPTSGRVLVDGVDIAQFNSRQLTTYRRQAVGFVFQFYNLVPNLTARENVELASQITKDARDVDETLTLVGLTHRSDNFPAQLSGGEQQRVAIARAVAKNPKLLLCDEPTGALDYQTGKQVLQVIQDAAKQTQTTVIIVTHNSAIAQLGDQVIRINDAQVQSVEHNAHPTPLAEIEW
>NZ_CP013749.1|WP_003642122.1|1453438_1454383_-|LysM-peptidoglycan-binding-domain-containing-protein
MKIKNALLTSLAATGLLALGTTVANADTVVVKAGDTVSEIALTHKTTIKAIQKANHLKNVNLIYIGDKLEVNGKHHATTVTTQVPTSAASSTASSTSTASSTANSTSTQSASSASVSSSTSTSAASTATSSSTTSVASSSAASSSSTSAASSSVTSTSTASAASSSAASSSTSSATSSSATSQASTASSSTATSASMTKLSNTTASSAASTSTAASSSATTSSSTTTSTSSSSSTTSTSSSAEAAAKAWIANKESGGSYTASNGNYYGKYQLSKSLLNGDYSASNQETVADEYVASRYGSWVAAKAFWEANGYY
>NZ_CP013749.1|WP_003644818.1|1454691_1456236_+|glycosyltransferase
MYYFVNTSINPKKSGIEHAEMKRLALFNQHHVPAKMVTRFFSLSLHQTLTAAGIAAENQINLFDFIQHSSERPTTKMTIEDLHLAPDLRVQPVGRHYEVYQNDQLLMKVNTFLNTQKQLNNVQYYDQNGKLVKTDWYDTRGFKGLEQFYAADGQVASEQVFNPDGEVVYQTFHMADRQNQVQNSLYRFINYEGQDWSFAGETAMTTFFLDELNRRTPHAVFVIDRTYELAYAALHMRTKAFKVMHLHSNHVNDPAHPKTASLNFNYAYALNNLDQWNGVIASTKQQTADFQARFGNQPAVYTIPVGIVDDATLNAPKPSFDQRTAGKIIFVARLAEEKQQDQVIRAFKKVLAQVPNATLDFWGYANGDTGKQLHQLVEQLGLKAAVTFNDYTTDLTAVYNDAQLAMLTSRAEGFALALLEGQAHGVPQIAYDVKYGPRDIIRDGHDGQLVPVNDENALATAMIDLLTQPKKLAMYSQQAYQDAQRFSTTAVWQQWQPLMKAAADFYQVEGATQR
>NZ_CP013749.1|WP_013355872.1|1456232_1457741_+|accessory-Sec-system-glycosyltransferase-Asp1
MNFFVNQYLMALNSGVEHAEFKRLQLFKDHQAPAKLVTRQFDGLLHQNMRRFNIADDQMANLFDFFRETTSFSSRVIKMADLNWPTAYDIKPDPNVSEVRAGDRLVAKVHFVPSTVGHVYFIEIFDHFNNLVQRTDYDERGFKARDEFFSSAGEPITDIFYRPDGSRMAEQYYAHDNNGTNYVSLCHLINYHGRDYYFNGEQEWYRFFLDELNKQYDENNVFIADRPLAAQWPVVNMQTAAKKYLWLPTPHAVDPRDQVYSNLNNAYVYGLHEFLSAWDGVITSTEQQKQDLTQWLGGQPSVPILTISAAVVSKQQAQHAPISISERHAHEIIYTGRLDAERRVDQLVTAFDQVHHKITDATLVIYGYGGELDRLKQQVSQLHLETAVTFAGYQPNLTMAYDQAGAYVYTGESDAQPLSLIEALSHGVPAIAYDINYGPKDVLKDGKNGYLVTDGAVNQLVRALTRTLESPQRQQRLSKGAYRSSEQYSDEQVWQQWQPVVQ
>NZ_CP013749.1|WP_003642119.1|1457825_1458653_-|LysR-family-transcriptional-regulator
MFKQLETFCAVYETRNFSHAAEQLFISQPTVSTQIKQLEADLQTTLLTRNGRQEIVPTASGQLLYQQAQKLLTTWAATKTAVQSPRHLVKVPCRIGASHTTGRLILPTLLANLSAVSDRFDFQVTLANSAEILTAMSQHKLDFGLVEKPLVTDQLNRLPFGHDELVHAGDFASPLWLLREPNSGVRHYTNAFLKARNIQPAQVMVIHSNQIIADLLAHGIGQTIISRHVLSNEIPIEQLSAHYQRQFFLLTNTQPAAALRPVQTAITQYLTTWSD
>NZ_CP013749.1|WP_013355871.1|1458769_1459780_+|putative-sulfate-exporter-family-transporter
MKVKGILPGLVTSLVIAIISQGLAQFVPALGAATIAILLGIIGGNTFLKQPQLGRGTKFAESKLLEYSVMLLGATMTVQTIGKIGGFGVLFILCQMTITIVGALWLGRKLGFSQSVRMLMAGGNAVCGSSAIASIAPVIDADEDDKGTVITLVNLMGTVLMLTLPVLGMAVFGGSVILKGALIGGTLQSVGQVVAAASMVNQTTVQFATIFKIMRIMMLVVVVLIFGRLHQRTIENELAEDAVVSGNGNGHWLPWYVAGFLILCALNSLISLPAIIGATAHTISSWFEIIALAAIGLRLNLVNFMKAGKRLALYGLGVGTIQVVSALILITLLLQH
>NZ_CP013749.1|WP_033607854.1|1459863_1460427_+|GNAT-family-N-acetyltransferase
MFMLTYRVTPAIELREPLPQSDAPALLALLTANRAQYQYYLPWVAKIQTVADEQRFLTFAQAQLQQAQALNLVIVVEQRVAGMVSCDHFDDNDHSANIGYWLGRPFQGRGVMTAAVCGVCDLGFNQYHRQCLRIRAAVDNQASNAVAQRTGFDFLIQHPGGQHLLDGDHDENVYQVSAVDWLAKRHK
>NZ_CP013749.1|WP_003644815.1|1460485_1460986_-|DUF4811-domain-containing-protein
MIIVLLILATFVFAGTMIFSPAGRNRLIAIIISGLIIATSLIALVLNDNYHWGMHEVTRTQIQDLAPLKSKQVALRVQQLGTGSERVISYRVAAATKVSHTVTATTTTTKLTSGSPAQVQLKTTTWQFKNHLTHVLFSLGNTKTKIVQRQYLFTIPKTWQVVTVKN
>NZ_CP013749.1|WP_011101931.1|1460982_1462467_-|multidrug-efflux-MFS-transporter
MPTQNSTLPLDANGQPYHRTWLVLTLLVGTFTTFITQTLLTTAFPTLMADFHISATAVQWLTTGFMLIMGIMIPVSAWLLTRINSKYLYLTAMLIFGLGTTLAYFAVNFQMLLIARMIQAMGVGISAPVFQTIMSSVYPPEKRGSAMGTAGIVIGLAPAIGPTLSGWIIDNYSWRALFLFILPINILVIIVSFFTLRKVLPTSKQPIDWWSVLISTIGFGSMLYGFSSVGNAGWGDPVVLTTLVIGLIFIGLFVWRQLHMDQPLLELRVFKIPAFTLSAILTALAYMAMMGVEMILPMYIQTVLGRSAMDSGLILLPGAIMMGIMSPITGRIFDHIGARRLAMTGMLLLTLGTAFFLSISATTPILWIIVVYAIRMFGLTMVTMPVTTTGINALPFRLISHGTAANNTLRQVAASMGTAVLISVYSSVAKWQMPGHQLLTQAPLKYRQDGITATLTGYHMAFVVSLIFCAIGFGITFFLKANHSKTISQEDDAA
>NZ_CP013749.1|WP_003644813.1|1462680_1463343_+|HAD-family-hydrolase
MTKKYLTFDCYGTLINTEPLYQWVANLGLAVGLDPLTVRKAYATYEDDPASVNPYLDYSTLVRADLKHLDRLFEQRHFFESHYVECLEVQRHLLPYADVIPTLTAWQQLGYQLIIMSNSSWDIMPANIAALKVPFTAVVTAEDVQAYKPALAFFETVQERFKLTADNHWHIARGYESDVVPASAMQWPMIWINRDQRQPTSSERPTHMVTDLAAAKQWVN
>NZ_CP013749.1|WP_013355869.1|1463461_1464649_+|MFS-transporter
MNSKSLNKSTVLLMAISAAIVVANINYIQPIEADIAQQFNLPNAVIGAVAMLTQLGYAFGLLLIVPMGDIMNRRMLIMRLLVLAIISALLAFVAPNIWVYALASLLIGITSVAPQVIIPYAGFLAPRNQRGQVLGNVLSGLLVGVLLSRTVSGVLASYLPWQMVYLIAAILIAGLWLVLWRKLPHDPVTTHTTNYKAMIQTVPQLVKRYPVLRASAVNGFVLFGVSNIFWATLVFYLQHQYGWGSREAGLLALLGVTGVLAAPLIGRLADRFRPRTIIGLGLVLSTLAYVVFWLSGTHLVGLIIGIVILDLGTQFGQVANQTRIQSIDVHASSRFNSVFMFGYFMGGALGSFCGNVLWDLAGWNGVCGLAVVVLMIGFYAHFVHYPRVVTRQAQY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

52232 : 143573

112

Lactobacillus_phage(54.39%)

terminase,capsid,tRNA,integrase,tail,protease,holin,portal

attL 104246:104262|attR 151974:151990

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011101144.1\|52232_52877_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003640983.1\|53041_53719_-	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_013355247.1\|53887_55870_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	4.4e-50	29.2
WP_011101143.1\|56756_57803_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.0e-61	41.4
WP_003640979.1\|57807_58263_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_011101142.1\|58255_58834_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_003640977.1\|58817_59543_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_003640976.1\|59822_60875_+	PhnD/SsuA/transferrin family substrate-binding protein	NA	NA	NA	NA
WP_022638340.1\|60912_61683_+	phosphonate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.9e-13	31.8
WP_022638341.1\|61672_62476_+	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_003640973.1\|62472_63327_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_013355242.1\|63351_64149_+	phosphonoacetaldehyde hydrolase	NA	NA	NA	NA
WP_013355241.1\|64170_65271_+	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
WP_013355240.1\|65404_66400_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.0e-51	38.5
WP_003640969.1\|66538_67324_-	acyl-ACP thioesterase	NA	NA	NA	NA
WP_013355239.1\|67327_68224_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	4.4e-82	55.7
WP_003640967.1\|68322_68670_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_003640966.1\|68694_69714_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640965.1\|69730_70060_-	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_003643941.1\|70056_70722_-	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640957.1\|71119_71371_-	YaaL family protein	NA	NA	NA	NA
WP_003637790.1\|71385_71985_-	recombination protein RecR	NA	NA	NA	NA
WP_003640956.1\|72000_72309_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003643940.1\|72330_74028_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0
WP_003640954.1\|74553_75060_-	nucleoside deaminase	NA	NA	NA	NA
WP_003640953.1\|75062_75671_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_003640952.1\|75893_76124_+	redoxin NrdH	X2KRY7	Enterococcus_phage	2.8e-09	40.0
WP_013355235.1\|76262_78428_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	2.2e-268	63.3
WP_003640950.1\|78455_79466_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	3.1e-108	60.5
WP_003640949.1\|79547_80123_+	TIGR00730 family Rossman fold protein	A0A1G5S9X4	Enterococcus_phage	6.4e-26	41.7
WP_022638342.1\|80297_82901_-	bifunctional lysylphosphatidylglycerol flippase/synthetase MprF	NA	NA	NA	NA
WP_013355233.1\|83204_83873_+	hypothetical protein	NA	NA	NA	NA
WP_022638343.1\|83885_84815_+	DNA/RNA non-specific endonuclease	NA	NA	NA	NA
WP_063491215.1\|85616_86495_+	Abi family protein	NA	NA	NA	NA
WP_080476963.1\|86580_86790_+	hypothetical protein	O48431	Lactobacillus_phage	1.7e-05	44.8
WP_063491216.1\|86841_87468_-	hypothetical protein	NA	NA	NA	NA
WP_063491217.1\|87467_87659_-	hypothetical protein	NA	NA	NA	NA
WP_063491218.1\|87847_88225_-\|holin	holin	A0A2H4PBB2	Lactobacillus_phage	2.8e-14	85.4
WP_063491219.1\|88211_88508_-	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	9.9e-39	76.5
WP_187337720.1\|88508_89621_-	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	2.5e-34	33.5
WP_063491221.1\|89674_89887_-	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	2.1e-19	85.2
WP_063491222.1\|89883_90978_-	hypothetical protein	A0A1I9KKB6	Lactobacillus_phage	3.4e-36	57.6
WP_134901158.1\|90995_91145_-	XkdX family protein	U5U4L4	Lactobacillus_phage	3.6e-05	56.8
WP_063491223.1\|91144_91456_-	hypothetical protein	NA	NA	NA	NA
WP_187337719.1\|91467_93627_-	hypothetical protein	M4ZSB3	Bacillus_phage	1.5e-38	32.9
WP_022638353.1\|93627_93918_-	hypothetical protein	O03939	Lactobacillus_phage	2.2e-11	53.9
WP_076637296.1\|93895_94189_-	hypothetical protein	NA	NA	NA	NA
WP_022638355.1\|94181_95300_-\|tail	phage tail protein	O03938	Lactobacillus_phage	1.5e-199	93.8
WP_022638356.1\|95312_96122_-\|tail	phage tail family protein	D2KRB8	Lactobacillus_phage	9.6e-52	41.2
WP_063491224.1\|96121_100978_-	peptidoglycan DD-metalloendopeptidase family protein	O03937	Lactobacillus_phage	0.0e+00	66.8
WP_063491225.1\|100981_101605_-	hypothetical protein	O03936	Lactobacillus_phage	1.2e-102	94.4
WP_063491226.1\|101610_102042_-	hypothetical protein	O03935	Lactobacillus_phage	2.4e-73	97.2
WP_063491227.1\|102091_102628_-	hypothetical protein	O03972	Lactobacillus_phage	8.8e-94	98.9
WP_022638361.1\|102660_103065_-\|capsid	phage capsid protein	O03934	Lactobacillus_phage	9.0e-67	96.3
WP_022638362.1\|103064_103412_-\|capsid	minor capsid protein	O03933	Lactobacillus_phage	4.1e-44	77.1
WP_022638363.1\|103411_103762_-\|capsid	phage capsid protein	O03932	Lactobacillus_phage	1.1e-55	92.2
WP_022638364.1\|103761_104190_-	hypothetical protein	NA	NA	NA	NA
WP_022638365.1\|104210_105098_-	hypothetical protein	U3PDP8	Lactobacillus_phage	6.1e-92	59.4
104246:104262	attL	NA	NA	NA	NA
WP_022638367.1\|105791_106055_-	hypothetical protein	O03930	Lactobacillus_phage	3.4e-14	48.1
WP_022638368.1\|106061_107222_-\|capsid	phage capsid protein	O03929	Lactobacillus_phage	2.5e-162	90.2
WP_033607818.1\|107218_108745_-\|portal	phage portal protein	O03928	Lactobacillus_phage	7.6e-284	96.3
WP_068874229.1\|108754_110098_-\|terminase	PBSX family phage terminase large subunit	O03927	Lactobacillus_phage	5.2e-260	96.0
WP_080476964.1\|110078_110555_-	hypothetical protein	Q597W0	Lactobacillus_virus	2.1e-38	58.5
WP_068874232.1\|110700_110889_-	hypothetical protein	E9LUP6	Lactobacillus_phage	2.0e-16	85.1
WP_003642805.1\|111944_112406_-	transcriptional regulator	D6PSV8	Lactobacillus_phage	1.1e-39	57.0
WP_022638180.1\|112533_112701_-	hypothetical protein	E9LUP4	Lactobacillus_phage	1.8e-13	87.2
WP_022638179.1\|112697_113045_-	hypothetical protein	A0A142F1A4	Bacillus_phage	4.9e-13	43.4
WP_187326027.1\|113041_113407_-	hypothetical protein	Q5ULS7	Lactobacillus_virus	1.0e-13	51.9
WP_022638177.1\|113427_113601_-	hypothetical protein	A0A2K9VC41	Lactobacillus_phage	4.7e-25	87.7
WP_022638176.1\|113593_113812_-	hypothetical protein	A0A2P0ZLC3	Lactobacillus_phage	1.1e-13	90.2
WP_022638175.1\|113857_114253_-	hypothetical protein	NA	NA	NA	NA
WP_022638173.1\|114389_114620_-	hypothetical protein	O03916	Lactobacillus_phage	1.0e-19	56.6
WP_022638172.1\|114616_115036_-	RusA family crossover junction endodeoxyribonuclease	A8YQM5	Lactobacillus_phage	1.3e-23	42.3
WP_022638171.1\|115028_115562_-	hypothetical protein	O03915	Lactobacillus_phage	2.1e-39	54.3
WP_022638170.1\|115558_115846_-	hypothetical protein	NA	NA	NA	NA
WP_022638169.1\|115842_116727_-	hypothetical protein	NA	NA	NA	NA
WP_022638168.1\|116808_117774_-	hypothetical protein	A6M982	Geobacillus_virus	1.0e-63	53.6
WP_022638167.1\|117776_118289_-	hypothetical protein	NA	NA	NA	NA
WP_027821907.1\|118741_119029_+	hypothetical protein	A0A2H4JEH2	uncultured_Caudovirales_phage	1.3e-22	48.9
WP_063491234.1\|119279_119567_-	hypothetical protein	NA	NA	NA	NA
WP_011101088.1\|119572_120127_-	hypothetical protein	O03909	Lactobacillus_phage	3.6e-98	100.0
WP_060417488.1\|120187_120370_-	hypothetical protein	NA	NA	NA	NA
WP_062688295.1\|120449_120728_+	hypothetical protein	NA	NA	NA	NA
WP_154698910.1\|120724_120865_-	hypothetical protein	NA	NA	NA	NA
WP_062688292.1\|120922_121144_+	DUF2188 domain-containing protein	E8ZD70	Streptococcus_phage	5.0e-19	66.2
WP_061468338.1\|121140_121341_-	hypothetical protein	NA	NA	NA	NA
WP_061468339.1\|121337_121565_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011101778.1\|121693_122056_+	helix-turn-helix domain-containing protein	A0A2R2ZGJ3	Clostridioides_phage	1.7e-08	48.4
WP_033608843.1\|122067_122481_+	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	1.5e-05	32.1
WP_068874234.1\|122507_123380_+	hypothetical protein	NA	NA	NA	NA
WP_003644972.1\|123892_125095_+\|integrase	tyrosine-type recombinase/integrase	A0A126GGK4	Streptococcus_phage	2.6e-37	29.5
WP_003637775.1\|125246_125615_-	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_003643933.1\|125676_126180_-	50S ribosomal protein L10	NA	NA	NA	NA
WP_003640943.1\|126378_127068_-	50S ribosomal protein L1	NA	NA	NA	NA
WP_003640942.1\|127168_127594_-	50S ribosomal protein L11	NA	NA	NA	NA
WP_022638154.1\|127695_128583_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003643932.1\|128610_129159_-	transcription termination/antitermination protein NusG	NA	NA	NA	NA
WP_003640939.1\|129263_129449_-	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_003637768.1\|129460_129610_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_050578344.1\|129671_130274_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_003640936.1\|130780_131326_-	NYN domain-containing protein	NA	NA	NA	NA
WP_003640935.1\|131327_132113_-	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_003640934.1\|132084_132495_-	Mini-ribonuclease 3	NA	NA	NA	NA
WP_013355229.1\|132496_133909_-\|tRNA	cysteine--tRNA ligase	F1C979	Terra1_virus	1.5e-44	27.7
WP_003640932.1\|134186_135677_-\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_003640931.1\|136002_137178_-	PIN/TRAM domain-containing protein	NA	NA	NA	NA
WP_003643928.1\|137193_138573_-	DNA repair protein RadA	NA	NA	NA	NA
WP_011101073.1\|139620_140157_-	dUTP diphosphatase	J9PV85	Bacillus_phage	1.1e-35	46.4
WP_003640927.1\|140295_140592_+	N-acetyltransferase	NA	NA	NA	NA
WP_003640926.1\|140600_141284_+	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_003643927.1\|141359_142691_+	C1 family peptidase	R4TV59	Phaeocystis_globosa_virus	5.4e-68	33.3
WP_033607779.1\|142880_143573_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
151974:151990	attR	NA	NA	NA	NA

DBSCAN-SWA_2

255256 : 316116

uncultured_Mediterranean_phage(22.22%)

bacteriocin,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643835.1\|255256_256528_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	8.4e-95	43.4
WP_003642042.1\|256996_258610_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.2e-143	49.9
WP_003642041.1\|258782_259391_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_003642040.1\|259435_259876_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_003643833.1\|260238_261171_+	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_169484456.1\|261179_262538_+	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	5.2e-26	32.9
WP_003642037.1\|262557_263367_+	sugar-phosphatase	NA	NA	NA	NA
WP_022638206.1\|265301_266288_-	hypothetical protein	NA	NA	NA	NA
WP_003642034.1\|266370_267393_-	YdcF family protein	NA	NA	NA	NA
WP_003643830.1\|267681_268662_-	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	4.9e-42	36.3
WP_022638207.1\|269027_269852_-	serine hydrolase	NA	NA	NA	NA
WP_022638208.1\|270087_271470_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L140	Tupanvirus	5.7e-28	33.2
WP_003642030.1\|271538_272375_-	pur operon repressor	NA	NA	NA	NA
WP_003642029.1\|272867_273131_-	hypothetical protein	NA	NA	NA	NA
WP_022638209.1\|273145_273688_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_003642026.1\|274236_274398_-	hypothetical protein	NA	NA	NA	NA
WP_068874482.1\|274766_275564_-	metal ABC transporter permease	NA	NA	NA	NA
WP_003642023.1\|275556_276255_-	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	1.2e-15	27.8
WP_003642022.1\|276521_277466_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003643828.1\|277775_278642_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_003642020.1\|278774_279026_-	Veg family protein	NA	NA	NA	NA
WP_003642019.1\|279130_280021_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_022638211.1\|280017_280581_-	ribonuclease M5	NA	NA	NA	NA
WP_003643825.1\|280567_281344_-	TatD family hydrolase	NA	NA	NA	NA
WP_022638212.1\|281466_282651_-	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_003643823.1\|282883_284935_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8
WP_003646492.1\|285256_285646_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_003642012.1\|286242_287085_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_003642011.1\|287084_287789_-	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_068874235.1\|287810_288770_-	IpaB/EvcA family protein	NA	NA	NA	NA
WP_003642009.1\|288762_290037_-	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_003642008.1\|290082_291000_-	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_003643820.1\|291168_291963_-	hypothetical protein	NA	NA	NA	NA
WP_003642006.1\|291967_293101_-	hypothetical protein	NA	NA	NA	NA
WP_003643818.1\|293554_294568_-\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_003642004.1\|294680_295427_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_003642003.1\|295576_296473_-	ROK family protein	NA	NA	NA	NA
WP_022638214.1\|296593_298030_-	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	1.7e-30	25.8
WP_003643816.1\|298047_299403_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003642000.1\|299625_300048_-	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003641999.1\|300037_300226_-	hypothetical protein	NA	NA	NA	NA
WP_003641998.1\|300232_301594_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641997.1\|301666_302377_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003643815.1\|302784_303801_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003643814.1\|304239_305016_-	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_022638217.1\|305274_307584_+	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_003641993.1\|307678_307882_-	hypothetical protein	NA	NA	NA	NA
WP_003641992.1\|308019_308706_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641991.1\|308799_309480_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641990.1\|309566_310235_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641987.1\|311081_312458_-	HlyD family secretion protein	NA	NA	NA	NA
WP_003641986.1\|312473_314624_-	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	6.1e-45	27.9
WP_003641985.1\|314890_315061_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_003643811.1\|315085_315244_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_003646470.1\|315342_316116_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_3

319545 : 364861

Paramecium_bursaria_Chlorella_virus(50.0%)

bacteriocin,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641979.1\|319545_319692_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_003641977.1\|320569_321316_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641976.1\|321346_322546_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_003641975.1\|322663_322831_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_003641974.1\|322958_323159_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641973.1\|324020_324188_+\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnJ	NA	NA	NA	NA
WP_003641972.1\|324218_324392_+\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnK	NA	NA	NA	NA
WP_003641971.1\|324388_325057_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641969.1\|325468_325672_-	hypothetical protein	NA	NA	NA	NA
WP_011100995.1\|326056_327241_-	cation:proton antiporter	NA	NA	NA	NA
WP_011100994.1\|327285_328662_-	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_003641966.1\|329187_330003_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_003641965.1\|330162_331035_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_022638220.1\|331105_331897_+	HAD family hydrolase	NA	NA	NA	NA
WP_022638221.1\|331900_333055_+	MFS transporter	NA	NA	NA	NA
WP_003641962.1\|333058_333676_+	sugar O-acetyltransferase	NA	NA	NA	NA
WP_003641960.1\|334057_334333_-	hypothetical protein	NA	NA	NA	NA
WP_003641956.1\|335603_336011_-	immunity 63 family protein	NA	NA	NA	NA
WP_114071742.1\|336087_336234_-	glycohydrolase toxin TNT-related protein	NA	NA	NA	NA
WP_003641952.1\|337077_337464_-	hypothetical protein	NA	NA	NA	NA
WP_003641950.1\|337843_338122_-	hypothetical protein	NA	NA	NA	NA
WP_003641949.1\|338233_338497_-	hypothetical protein	NA	NA	NA	NA
WP_003641948.1\|338540_339458_-	hypothetical protein	NA	NA	NA	NA
WP_068874237.1\|339454_341254_-	pre-toxin TG domain-containing protein	NA	NA	NA	NA
WP_003641946.1\|341255_344939_-	MucBP domain-containing protein	NA	NA	NA	NA
WP_003641945.1\|345525_346248_-	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_022638505.1\|346262_348092_-	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003643773.1\|348106_349624_-	glycerol kinase GlpK	NA	NA	NA	NA
WP_022638504.1\|350089_351421_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003641941.1\|351498_352470_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_003641940.1\|352470_353997_-	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_003646442.1\|354234_354681_+	ribonuclease H	NA	NA	NA	NA
WP_013355178.1\|355427_356339_-	oxidoreductase	NA	NA	NA	NA
WP_003646441.1\|356475_357396_+	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_013355176.1\|357561_358134_-	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_003641935.1\|358237_358693_-	hypothetical protein	NA	NA	NA	NA
WP_013355174.1\|359290_360487_+	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|360517_361027_+	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_013355173.1\|361139_361508_-	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_022638503.1\|361772_363278_-	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_022638502.1\|363435_364104_-	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_003643762.1\|364297_364861_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_4

648879 : 655900

Staphylococcus_phage(40.0%)

terminase,head,capsid,tail,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022638531.1\|648879_649146_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_022638530.1\|649556_651140_-\|capsid	phage major capsid protein	A0A1J0MFW8	Staphylococcus_phage	2.5e-40	34.3
WP_022638529.1\|651129_652236_-\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	3.2e-50	33.6
WP_022638527.1\|652390_654094_-\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	4.4e-123	41.3
WP_022638526.1\|654090_654564_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_033607857.1\|655179_655569_-	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	1.0e-19	45.2
WP_033607856.1\|655561_655900_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	7.9e-08	34.7

DBSCAN-SWA_5

1560414 : 1568925

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645861.1\|1560414_1560897_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0
WP_011101896.1\|1560880_1562011_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003642587.1\|1562013_1562745_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_003642588.1\|1562746_1563001_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_022638052.1\|1563000_1563681_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003645864.1\|1563673_1565893_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.5e-144	39.3
WP_003642591.1\|1565877_1567332_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
WP_013355836.1\|1567328_1568354_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	5.4e-60	40.7
WP_003645867.1\|1568346_1568925_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9

DBSCAN-SWA_6

1729882 : 1795680

Lactobacillus_phage(56.41%)

terminase,head,capsid,transposase,integrase,tail,holin,portal

attL 1744133:1744148|attR 1765443:1765458

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013355194.1\|1729882_1731145_-\|transposase	ISL3-like element ISP1 family transposase	NA	NA	NA	NA
WP_011101813.1\|1731299_1731749_-	VOC family protein	NA	NA	NA	NA
WP_003642738.1\|1732809_1733397_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003642739.1\|1733481_1735035_+	ABC-F family ATP-binding cassette domain-containing protein	Q6DMX7	Streptococcus_phage	1.2e-39	27.0
WP_003644673.1\|1735295_1736486_-	GGDEF domain-containing protein	NA	NA	NA	NA
WP_003642741.1\|1736709_1736940_+	hypothetical protein	NA	NA	NA	NA
WP_003642742.1\|1736965_1737187_+	hypothetical protein	NA	NA	NA	NA
WP_003642743.1\|1737333_1737798_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_003642744.1\|1738019_1738913_+	C40 family peptidase	NA	NA	NA	NA
WP_003644672.1\|1738979_1739843_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003642746.1\|1740404_1740569_+	hypothetical protein	NA	NA	NA	NA
WP_003642747.1\|1740627_1741371_+	NUDIX hydrolase	NA	NA	NA	NA
WP_022638136.1\|1741476_1742664_+	MFS transporter	NA	NA	NA	NA
WP_003644671.1\|1742877_1743195_+	hypothetical protein	NA	NA	NA	NA
WP_003642750.1\|1743270_1743831_+	ECF transporter S component	NA	NA	NA	NA
1744133:1744148	attL	NA	NA	NA	NA
WP_011101810.1\|1744587_1745526_-	EamA family transporter	NA	NA	NA	NA
WP_003646616.1\|1745722_1745992_+	ACT domain-containing protein	NA	NA	NA	NA
WP_003642754.1\|1746001_1747345_+	PFL family protein	NA	NA	NA	NA
WP_003646617.1\|1747717_1748446_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.1e-34	37.1
WP_068874294.1\|1748442_1749966_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_003642757.1\|1750261_1751443_+	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	1.0e-46	30.1
WP_003642758.1\|1751677_1752535_+	GRP family sugar transporter	NA	NA	NA	NA
WP_068874296.1\|1752755_1754108_+	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_063491282.1\|1754220_1755489_-\|integrase	site-specific integrase	A0A0P0I3D2	Lactobacillus_phage	4.3e-91	42.7
WP_063491281.1\|1755837_1756548_-	hypothetical protein	NA	NA	NA	NA
WP_080474029.1\|1756713_1757139_-	ImmA/IrrE family metallo-endopeptidase	D6PSS8	Lactobacillus_phage	6.2e-26	46.8
WP_063491280.1\|1757135_1757483_-	helix-turn-helix domain-containing protein	A8ASM2	Listeria_phage	1.7e-10	38.7
WP_063491279.1\|1757640_1757844_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011101087.1\|1757911_1758094_+	hypothetical protein	NA	NA	NA	NA
WP_063491278.1\|1758154_1758709_+	hypothetical protein	O03909	Lactobacillus_phage	2.3e-97	98.9
WP_063491277.1\|1758715_1758961_+	hypothetical protein	NA	NA	NA	NA
WP_024002536.1\|1759355_1759886_+	host-nuclease inhibitor Gam family protein	E9LUU0	Lactobacillus_phage	6.1e-55	59.2
WP_063491276.1\|1759897_1760863_+	hypothetical protein	A6M982	Geobacillus_virus	1.3e-63	53.6
WP_063491275.1\|1760942_1761731_+	hypothetical protein	NA	NA	NA	NA
WP_063491274.1\|1761711_1762554_+	ATP-binding protein	O03914	Lactobacillus_phage	4.8e-155	97.9
WP_063491273.1\|1762686_1763187_+	hypothetical protein	O03915	Lactobacillus_phage	3.4e-84	89.7
WP_134901162.1\|1763228_1763609_+	VRR-NUC domain-containing protein	A0A0M7RDN7	Lactobacillus_phage	4.4e-23	58.6
WP_063491272.1\|1763608_1763839_+	hypothetical protein	O03916	Lactobacillus_phage	1.1e-21	57.9
WP_063491271.1\|1763841_1764477_+	hypothetical protein	E9LUN9	Lactobacillus_phage	6.4e-35	38.6
WP_134901160.1\|1764489_1764669_+	hypothetical protein	NA	NA	NA	NA
WP_063491269.1\|1764808_1765204_+	hypothetical protein	NA	NA	NA	NA
WP_022638176.1\|1765249_1765468_+	hypothetical protein	A0A2P0ZLC3	Lactobacillus_phage	1.1e-13	90.2
1765443:1765458	attR	NA	NA	NA	NA
WP_022638177.1\|1765460_1765634_+	hypothetical protein	A0A2K9VC41	Lactobacillus_phage	4.7e-25	87.7
WP_187326027.1\|1765654_1766020_+	hypothetical protein	Q5ULS7	Lactobacillus_virus	1.0e-13	51.9
WP_022638179.1\|1766016_1766364_+	hypothetical protein	A0A142F1A4	Bacillus_phage	4.9e-13	43.4
WP_022638180.1\|1766360_1766528_+	hypothetical protein	E9LUP4	Lactobacillus_phage	1.8e-13	87.2
WP_003642805.1\|1766655_1767117_+	transcriptional regulator	D6PSV8	Lactobacillus_phage	1.1e-39	57.0
WP_022638374.1\|1768030_1768582_+	hypothetical protein	A8ASQ2	Listeria_phage	3.2e-22	38.9
WP_022638373.1\|1768786_1768966_+	hypothetical protein	E9LUP6	Lactobacillus_phage	1.4e-08	56.4
WP_022638372.1\|1768934_1769213_+	hypothetical protein	C9E2J2	Enterococcus_phage	3.1e-26	59.8
WP_063491267.1\|1769266_1769794_+\|terminase	terminase small subunit	O03926	Lactobacillus_phage	3.2e-48	64.2
WP_063491266.1\|1769777_1771064_+\|terminase	PBSX family phage terminase large subunit	B7T0C6	Staphylococcus_virus	2.2e-114	49.9
WP_080476969.1\|1771053_1772712_+\|portal	phage portal protein	D2IZF6	Enterococcus_phage	9.1e-65	32.8
WP_063491265.1\|1772711_1773656_+\|capsid	minor capsid protein	NA	NA	NA	NA
WP_063491264.1\|1773753_1774404_+	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_063491263.1\|1774417_1775488_+	hypothetical protein	A0A0S0N2Q7	Pseudomonas_phage	2.7e-33	30.8
WP_063491262.1\|1775502_1775877_+\|head,tail	phage head-tail connector protein	H9A0V3	Staphylococcus_phage	9.0e-05	38.2
WP_187337711.1\|1775830_1776205_+	hypothetical protein	NA	NA	NA	NA
WP_063491261.1\|1776194_1776749_+	hypothetical protein	NA	NA	NA	NA
WP_080476970.1\|1776750_1777137_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_063491259.1\|1777147_1777738_+	hypothetical protein	NA	NA	NA	NA
WP_063491258.1\|1777755_1778268_+	hypothetical protein	NA	NA	NA	NA
WP_063491257.1\|1778336_1778573_+	hypothetical protein	NA	NA	NA	NA
WP_063492973.1\|1778572_1782808_+	hypothetical protein	E9LUR1	Lactobacillus_phage	5.2e-64	31.1
WP_063491256.1\|1782817_1783714_+\|tail	phage tail family protein	A8ATA8	Listeria_phage	1.0e-17	28.2
WP_187337712.1\|1783713_1784892_+\|tail	phage tail protein	Q9T1A5	Listeria_phage	6.3e-20	24.5
WP_063491254.1\|1784888_1785146_+	hypothetical protein	NA	NA	NA	NA
WP_063491253.1\|1785135_1785426_+	hypothetical protein	NA	NA	NA	NA
WP_187337713.1\|1785426_1787586_+	hypothetical protein	M4ZSB3	Bacillus_phage	1.3e-39	34.0
WP_063491252.1\|1787597_1787909_+	hypothetical protein	NA	NA	NA	NA
WP_134901158.1\|1787908_1788058_+	XkdX family protein	U5U4L4	Lactobacillus_phage	3.6e-05	56.8
WP_063491251.1\|1788075_1789083_+	hypothetical protein	A0A2K9VCK7	Lactobacillus_phage	1.7e-37	62.0
WP_063491250.1\|1789079_1789322_+	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	2.2e-12	86.4
WP_063491249.1\|1789333_1790506_+	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	1.0e-203	91.3
WP_063491248.1\|1790506_1790803_+	hypothetical protein	A0A2K9VCD4	Lactobacillus_phage	1.2e-36	71.4
WP_063491247.1\|1790789_1791164_+\|holin	holin	A0A2K9VCG4	Lactobacillus_phage	3.3e-15	63.8
WP_063491246.1\|1791395_1792310_-	hypothetical protein	NA	NA	NA	NA
WP_003646619.1\|1793089_1793281_+	hypothetical protein	NA	NA	NA	NA
WP_003642761.1\|1793685_1795680_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.2e-32	41.3

DBSCAN-SWA_7

1816714 : 1904396

115

Lactobacillus_phage(44.78%)

terminase,head,capsid,transposase,integrase,tail,protease,holin,portal

attL 1811324:1811383|attR 1828304:1828376

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1811324:1811383	attL	NA	NA	NA	NA
WP_013355755.1\|1816714_1817137_-	ImmA/IrrE family metallo-endopeptidase	A0A0S2SXM3	Bacillus_phage	3.0e-12	35.1
WP_013355754.1\|1817151_1817655_-	helix-turn-helix transcriptional regulator	S6C481	Thermus_phage	1.7e-22	42.6
WP_033099030.1\|1817800_1818055_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013355753.1\|1818111_1818426_-	hypothetical protein	NA	NA	NA	NA
WP_011101085.1\|1818463_1818700_-	helix-turn-helix transcriptional regulator	A0A0K2CNE2	Brevibacillus_phage	8.5e-09	30.7
WP_011101086.1\|1818846_1819047_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003642792.1\|1819205_1819376_+	hypothetical protein	NA	NA	NA	NA
WP_003642793.1\|1819387_1819693_+	DUF771 domain-containing protein	NA	NA	NA	NA
WP_022638124.1\|1819760_1820273_+	helix-turn-helix transcriptional regulator	D6PST4	Lactobacillus_phage	2.0e-23	39.4
WP_022638122.1\|1820643_1821024_+	hypothetical protein	NA	NA	NA	NA
WP_022638121.1\|1821026_1821914_+	recombinase RecT	E9LUM3	Lactobacillus_phage	4.6e-63	53.3
WP_161325284.1\|1821945_1822698_+	PD-(D/E)XK nuclease-like domain-containing protein	A0A0P0IZH9	Lactobacillus_phage	6.3e-74	52.2
WP_003642799.1\|1822776_1823685_+	DnaD domain protein	NA	NA	NA	NA
WP_022638119.1\|1823681_1823969_+	hypothetical protein	NA	NA	NA	NA
WP_022638118.1\|1823965_1824484_+	hypothetical protein	O03915	Lactobacillus_phage	1.9e-53	68.4
WP_022638117.1\|1824480_1824861_+	hypothetical protein	NA	NA	NA	NA
WP_021356389.1\|1824853_1824994_+	hypothetical protein	E9LUN8	Lactobacillus_phage	3.4e-05	96.3
WP_022638116.1\|1825071_1825533_+	hypothetical protein	D6PSV8	Lactobacillus_phage	4.1e-39	57.0
WP_155118608.1\|1826053_1826605_+	abortive infection family protein	NA	NA	NA	NA
WP_063491238.1\|1826756_1827959_-\|integrase	tyrosine-type recombinase/integrase	A0A126GGK4	Streptococcus_phage	1.5e-37	29.5
WP_063491237.1\|1828028_1828235_-	hypothetical protein	NA	NA	NA	NA
WP_161324305.1\|1828406_1829111_-	Ltp family lipoprotein	V9QJ01	Oenococcus_phage	3.0e-09	41.0
1828304:1828376	attR	NA	NA	NA	NA
WP_063491236.1\|1829720_1830143_-	ImmA/IrrE family metallo-endopeptidase	A0A0S2SXM3	Bacillus_phage	3.0e-12	34.4
WP_063204180.1\|1830157_1830676_-	helix-turn-helix domain-containing protein	S6C481	Thermus_phage	3.5e-15	34.1
WP_068874298.1\|1830817_1831072_+	helix-turn-helix transcriptional regulator	A0A2H4JFN1	uncultured_Caudovirales_phage	1.1e-06	41.3
WP_155118609.1\|1831068_1831227_+	hypothetical protein	NA	NA	NA	NA
WP_155118610.1\|1831216_1831381_-	hypothetical protein	NA	NA	NA	NA
WP_154698910.1\|1831439_1831580_+	hypothetical protein	NA	NA	NA	NA
WP_062688295.1\|1831576_1831855_-	hypothetical protein	NA	NA	NA	NA
WP_060417488.1\|1831934_1832117_+	hypothetical protein	NA	NA	NA	NA
WP_011101088.1\|1832177_1832732_+	hypothetical protein	O03909	Lactobacillus_phage	3.6e-98	100.0
WP_033607781.1\|1832737_1833025_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_022638167.1\|1833519_1834032_+	hypothetical protein	NA	NA	NA	NA
WP_068874300.1\|1834034_1835000_+	hypothetical protein	A6M982	Geobacillus_virus	3.9e-60	56.2
WP_068874308.1\|1835079_1835985_+	DnaD domain protein	NA	NA	NA	NA
WP_068874313.1\|1835998_1836514_+	hypothetical protein	O03915	Lactobacillus_phage	3.1e-56	68.3
WP_068874316.1\|1836506_1836926_+	RusA family crossover junction endodeoxyribonuclease	A8YQM5	Lactobacillus_phage	4.4e-24	43.1
WP_068874318.1\|1836922_1837153_+	hypothetical protein	O03916	Lactobacillus_phage	1.7e-22	60.5
WP_068874488.1\|1838040_1838304_+	DUF3310 domain-containing protein	A0A2P0ZL48	Lactobacillus_phage	1.4e-31	82.3
WP_068874320.1\|1838403_1839000_+	hypothetical protein	E9LUN9	Lactobacillus_phage	8.5e-98	87.1
WP_155118611.1\|1839073_1839223_+	hypothetical protein	NA	NA	NA	NA
WP_187337714.1\|1839240_1839390_+	hypothetical protein	O03920	Lactobacillus_phage	2.2e-10	68.1
WP_068874322.1\|1839414_1839831_+	hypothetical protein	A0A1I9KKG9	Lactobacillus_phage	1.0e-41	60.9
WP_068874325.1\|1839903_1840149_+	DUF3850 domain-containing protein	C9E2N9	Enterococcus_phage	2.0e-13	54.1
WP_068874328.1\|1840376_1840685_+	hypothetical protein	NA	NA	NA	NA
WP_068874330.1\|1840714_1840906_+	hypothetical protein	NA	NA	NA	NA
WP_068874332.1\|1840987_1841455_+	hypothetical protein	B4XYT9	Lactobacillus_phage	1.3e-16	40.8
WP_068874335.1\|1842510_1842714_+	hypothetical protein	NA	NA	NA	NA
WP_155118612.1\|1842761_1842923_+	hypothetical protein	NA	NA	NA	NA
WP_068874337.1\|1842909_1843173_+	hypothetical protein	A0A1S5RCN3	Lactobacillus_phage	4.8e-29	69.8
WP_068874340.1\|1843212_1843728_+\|terminase	terminase small subunit	O03926	Lactobacillus_phage	1.5e-50	71.1
WP_068874342.1\|1843720_1845034_+\|terminase	PBSX family phage terminase large subunit	D2IYW1	Enterococcus_phage	1.2e-125	54.3
WP_068874344.1\|1845048_1846785_+\|portal	phage portal protein	D2IZF6	Enterococcus_phage	2.4e-76	34.8
WP_068874346.1\|1846784_1847696_+\|capsid	minor capsid protein	NA	NA	NA	NA
WP_068874348.1\|1847806_1848466_+	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_060418034.1\|1848479_1848851_+	hypothetical protein	A0A0K2CNR0	Brevibacillus_phage	1.3e-08	34.4
WP_068874350.1\|1848866_1849976_+\|capsid	major capsid protein	A0A2H4J022	uncultured_Caudovirales_phage	3.1e-61	40.1
WP_068874352.1\|1849993_1850362_+\|head,tail	phage head-tail connector protein	NA	NA	NA	NA
WP_068874354.1\|1850358_1850691_+	hypothetical protein	NA	NA	NA	NA
WP_068874357.1\|1850691_1851183_+	hypothetical protein	NA	NA	NA	NA
WP_068874360.1\|1851185_1851581_+	hypothetical protein	NA	NA	NA	NA
WP_068874362.1\|1851629_1852283_+	hypothetical protein	NA	NA	NA	NA
WP_027821926.1\|1852311_1852830_+	hypothetical protein	NA	NA	NA	NA
WP_061871561.1\|1852904_1853162_+	hypothetical protein	NA	NA	NA	NA
WP_080476979.1\|1853386_1857175_+	tape measure protein	A0A0A7DMV4	Lactobacillus_phage	1.4e-39	58.6
WP_068874366.1\|1857200_1857467_-	hypothetical protein	NA	NA	NA	NA
WP_068874367.1\|1857540_1858452_+\|tail	phage tail family protein	Q9T1A6	Listeria_phage	1.2e-18	30.3
WP_061871752.1\|1858444_1859632_+\|tail	phage tail protein	NA	NA	NA	NA
WP_068874373.1\|1859606_1859972_+	hypothetical protein	NA	NA	NA	NA
WP_068874376.1\|1859964_1860240_+	hypothetical protein	NA	NA	NA	NA
WP_187337715.1\|1860240_1862400_+	hypothetical protein	M4ZSB3	Bacillus_phage	1.3e-39	34.0
WP_063491252.1\|1862411_1862723_+	hypothetical protein	NA	NA	NA	NA
WP_134901158.1\|1862722_1862872_+	XkdX family protein	U5U4L4	Lactobacillus_phage	3.6e-05	56.8
WP_063491251.1\|1862889_1863897_+	hypothetical protein	A0A2K9VCK7	Lactobacillus_phage	1.7e-37	62.0
WP_068874378.1\|1863893_1864106_+	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	1.8e-18	83.6
WP_068874490.1\|1864169_1865282_+	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	5.9e-44	59.5
WP_015380597.1\|1865282_1865579_+	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	1.2e-39	77.6
WP_068874385.1\|1865565_1865940_+\|holin	holin	A0A2H4PBB2	Lactobacillus_phage	4.6e-25	87.8
WP_063486137.1\|1866350_1866617_+	hypothetical protein	A9D9X7	Lactobacillus_prophage	3.9e-10	47.1
WP_068874386.1\|1866655_1867030_+	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_187337716.1\|1867340_1867595_+	hypothetical protein	NA	NA	NA	NA
WP_033607771.1\|1867704_1867884_+	hypothetical protein	E9LUP6	Lactobacillus_phage	4.6e-07	56.9
WP_022638114.1\|1868061_1868589_+\|terminase	terminase small subunit	O03926	Lactobacillus_phage	5.0e-41	73.1
WP_022638113.1\|1868578_1869817_+\|terminase	PBSX family phage terminase large subunit	M1PG09	Streptococcus_phage	7.1e-139	61.0
WP_022638112.1\|1869828_1871337_+\|portal	phage portal protein	V5US18	Oenococcus_phage	3.1e-136	52.0
WP_024971552.1\|1871266_1871563_+\|protease	ribosomal-processing cysteine protease Prp	D2J003	Enterococcus_phage	1.1e-10	40.2
WP_013355736.1\|1871709_1873395_+\|capsid	minor capsid protein	V5US81	Oenococcus_phage	6.5e-119	58.0
WP_003642815.1\|1873369_1873648_+	hypothetical protein	NA	NA	NA	NA
WP_013355734.1\|1873699_1873906_+	hypothetical protein	NA	NA	NA	NA
WP_013355733.1\|1874078_1874756_+	DUF4355 domain-containing protein	Q6SE80	Lactobacillus_prophage	6.0e-15	32.1
WP_013355732.1\|1874770_1875118_+	hypothetical protein	V5UTH9	Oenococcus_phage	4.4e-30	63.8
WP_022638111.1\|1875137_1876160_+\|capsid	major capsid protein	V5US24	Oenococcus_phage	7.5e-118	62.8
WP_003642820.1\|1876172_1876349_+	hypothetical protein	NA	NA	NA	NA
WP_013355731.1\|1876360_1876693_+\|head,tail	phage head-tail connector protein	V9QJ97	Oenococcus_phage	1.8e-12	45.3
WP_003642822.1\|1876692_1877040_+	hypothetical protein	V5US85	Oenococcus_phage	3.2e-36	62.3
WP_013355730.1\|1877041_1877593_+	HK97 gp10 family phage protein	V5URV0	Oenococcus_phage	2.0e-64	62.3
WP_013355729.1\|1877592_1877958_+	hypothetical protein	V5UQS4	Oenococcus_phage	3.0e-29	53.4
WP_099447638.1\|1878059_1878443_+\|tail	phage tail protein	V5USQ9	Oenococcus_phage	1.8e-37	58.4
WP_003642826.1\|1878542_1878941_+	hypothetical protein	V9QJA0	Oenococcus_phage	3.0e-46	74.8
WP_031275283.1\|1879048_1879312_+	hypothetical protein	V9QKH3	Oenococcus_phage	2.3e-23	65.4
WP_022638110.1\|1879327_1885159_+\|tail	phage tail protein	V5URV5	Oenococcus_phage	5.0e-227	40.9
WP_099739626.1\|1885202_1885535_+	hypothetical protein	V5UQS8	Oenococcus_phage	2.2e-42	73.4
WP_022638109.1\|1885549_1890805_+	hypothetical protein	Q6SE68	Lactobacillus_prophage	1.3e-144	59.6
WP_022638108.1\|1890826_1891276_+	DUF1617 family protein	A0A2P0ZLE0	Lactobacillus_phage	1.8e-20	39.9
WP_021732622.1\|1891278_1891713_+	hypothetical protein	NA	NA	NA	NA
WP_050578343.1\|1891891_1893007_+	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	3.1e-32	77.4
WP_022638106.1\|1893007_1893304_+	hypothetical protein	A0A2K9VCD4	Lactobacillus_phage	6.4e-38	74.5
WP_022638105.1\|1893290_1893668_+	hypothetical protein	A0A2K9VCG4	Lactobacillus_phage	7.9e-17	67.5
WP_022638104.1\|1894764_1895610_-	hypothetical protein	NA	NA	NA	NA
WP_022638794.1\|1896178_1897030_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_003641420.1\|1897252_1897645_+	YxeA family protein	NA	NA	NA	NA
WP_003644665.1\|1897868_1899599_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.6e-46	27.6
WP_003641422.1\|1899598_1901488_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	9.4e-58	32.1
WP_003641423.1\|1901502_1902474_+	hypothetical protein	NA	NA	NA	NA
WP_013355994.1\|1902743_1904396_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.8e-92	41.3

DBSCAN-SWA_8

2730109 : 2742887

Lactobacillus_phage(70.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013355474.1\|2730109_2731054_-	glycosyltransferase family 2 protein	V5USA4	Oenococcus_phage	2.0e-72	45.5
WP_013355473.1\|2731078_2731744_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_021356352.1\|2732453_2733146_+	response regulator transcription factor	W8CYM9	Bacillus_phage	5.3e-35	37.6
WP_022638019.1\|2733138_2734506_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	3.4e-25	31.0
WP_013355470.1\|2734896_2735337_+	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	1.2e-75	97.9
WP_013355469.1\|2735407_2735968_-	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	6.5e-100	98.4
WP_022638021.1\|2736055_2738494_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.6
WP_003643097.1\|2738496_2739111_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_003643099.1\|2739453_2740401_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_013355468.1\|2740586_2741558_+	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	3.5e-181	98.5
WP_013355467.1\|2741648_2742887_-	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	2.4e-219	98.7

DBSCAN-SWA_9

2768993 : 2835784

Lactobacillus_phage(79.49%)

terminase,head,capsid,tRNA,integrase,tail,protease,holin,portal

attL 2790560:2790576|attR 2830057:2830073

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643128.1\|2768993_2770682_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	1.2e-75	32.9
WP_013355456.1\|2770953_2771400_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003643130.1\|2771788_2772034_-	hypothetical protein	NA	NA	NA	NA
WP_003643131.1\|2772160_2773552_-	MATE family efflux transporter	NA	NA	NA	NA
WP_013355455.1\|2773827_2775603_-	SLC13 family permease	NA	NA	NA	NA
WP_013355454.1\|2776108_2777848_-	aryl-sulfate sulfotransferase	NA	NA	NA	NA
WP_013355453.1\|2778068_2779025_-	bifunctional oligoribonuclease/PAP phosphatase NrnA	NA	NA	NA	NA
WP_013355452.1\|2779014_2779638_-	adenylyl-sulfate kinase	A0A2K9L4R9	Tupanvirus	6.3e-27	40.6
WP_134901165.1\|2779640_2780741_-	sulfate adenylyltransferase	A0A2P1ELS9	Moumouvirus	6.1e-49	32.9
WP_022638032.1\|2780773_2782411_-	sulfotransferase family protein	NA	NA	NA	NA
WP_013355448.1\|2783299_2785606_+	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
WP_003643140.1\|2785619_2787476_+	bifunctional homocysteine S-methyltransferase/methylenetetrahydrofolate reductase	NA	NA	NA	NA
WP_003645248.1\|2787548_2787908_+	YisL family protein	NA	NA	NA	NA
WP_003643142.1\|2788007_2788529_-	GtrA family protein	NA	NA	NA	NA
WP_003643143.1\|2788634_2789648_+	hypothetical protein	NA	NA	NA	NA
WP_003645249.1\|2789812_2790238_+	hypothetical protein	NA	NA	NA	NA
2790560:2790576	attL	NA	NA	NA	NA
WP_068874417.1\|2791294_2791825_-\|holin	holin	E9LUS0	Lactobacillus_phage	8.5e-41	98.9
WP_003644510.1\|2791836_2792100_-	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
WP_068874418.1\|2793139_2793499_-	hypothetical protein	A0A2P0ZLF6	Lactobacillus_phage	5.0e-45	79.0
WP_181815834.1\|2793482_2793644_-	hypothetical protein	A0A2P0ZLG1	Lactobacillus_phage	6.8e-18	96.2
WP_068874420.1\|2793647_2793890_-	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	2.4e-30	94.7
WP_068874422.1\|2796988_2799403_-	hypothetical protein	A0A2P0ZLF8	Lactobacillus_phage	0.0e+00	90.5
WP_068874425.1\|2799471_2801247_-\|tail	phage tail family protein	A0A2P0ZLH2	Lactobacillus_phage	0.0e+00	96.8
WP_068874427.1\|2801325_2806074_-	C40 family peptidase	A0A2P0ZLG0	Lactobacillus_phage	0.0e+00	73.6
WP_015640500.1\|2806105_2806291_-	hypothetical protein	NA	NA	NA	NA
WP_068874429.1\|2806335_2806710_-\|tail	phage tail assembly chaperone	A0A2P0ZLH4	Lactobacillus_phage	3.5e-57	95.2
WP_068874433.1\|2806782_2807436_-\|tail	phage tail protein	A0A2P0ZLH1	Lactobacillus_phage	5.4e-114	95.4
WP_068874435.1\|2807452_2807833_-	DUF806 family protein	A0A2P0ZLF4	Lactobacillus_phage	4.8e-62	95.2
WP_068874437.1\|2807832_2808240_-	HK97 gp10 family phage protein	A0A2P0ZLE6	Lactobacillus_phage	2.2e-65	93.1
WP_061812664.1\|2808242_2808590_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	4.1e-44	73.9
WP_068874440.1\|2808579_2808912_-\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	6.1e-45	86.1
WP_068874442.1\|2808984_2810217_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	5.5e-208	91.6
WP_022638400.1\|2810216_2810975_-\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	1.2e-128	96.0
WP_068874444.1\|2810952_2812146_-\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	3.4e-223	98.5
WP_063722563.1\|2812148_2812343_-	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	1.8e-25	95.3
WP_068874448.1\|2812332_2814231_-\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	0.0e+00	92.6
WP_016511011.1\|2814240_2814696_-\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	3.0e-79	96.7
WP_013355635.1\|2814885_2815137_-	hypothetical protein	NA	NA	NA	NA
WP_068874450.1\|2815154_2815424_-	hypothetical protein	NA	NA	NA	NA
WP_080476972.1\|2815429_2815900_-	HNH endonuclease	E9LUP7	Lactobacillus_phage	1.6e-83	94.2
WP_013355638.1\|2815910_2816081_-	hypothetical protein	E9LUP6	Lactobacillus_phage	3.3e-23	96.4
WP_033098961.1\|2816240_2817053_-	hypothetical protein	NA	NA	NA	NA
WP_021732015.1\|2817631_2818057_-	RinA family transcriptional regulator	E9LUP5	Lactobacillus_phage	7.2e-67	87.2
WP_022638825.1\|2818214_2818412_-	hypothetical protein	NA	NA	NA	NA
WP_054598400.1\|2818484_2818919_-	hypothetical protein	Q5ULS7	Lactobacillus_virus	7.2e-14	53.2
WP_022638755.1\|2818902_2819079_-	hypothetical protein	E9LUP2	Lactobacillus_phage	8.8e-19	81.0
WP_155118607.1\|2819108_2819276_-	hypothetical protein	NA	NA	NA	NA
WP_022638754.1\|2819450_2819609_-	hypothetical protein	A0A2P0ZLB5	Lactobacillus_phage	3.9e-18	92.3
WP_022638753.1\|2819601_2819910_-	hypothetical protein	E9LUN7	Lactobacillus_phage	1.7e-49	96.1
WP_068874453.1\|2820045_2820831_-	ATP-binding protein	E9LUN6	Lactobacillus_phage	1.4e-132	90.8
WP_068874454.1\|2820830_2821547_-	helix-turn-helix domain-containing protein	A0A0P0I7Q1	Lactobacillus_phage	1.2e-32	39.3
WP_068874456.1\|2821641_2821899_-	hypothetical protein	NA	NA	NA	NA
WP_187337717.1\|2821898_2822069_-	hypothetical protein	NA	NA	NA	NA
WP_003644546.1\|2822554_2822809_-	hypothetical protein	NA	NA	NA	NA
WP_003644547.1\|2822821_2823025_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_033615377.1\|2823190_2823481_+	hypothetical protein	NA	NA	NA	NA
WP_068874458.1\|2824021_2824351_-	DUF771 domain-containing protein	E9LUT3	Lactobacillus_phage	4.6e-53	88.1
WP_068874460.1\|2824443_2824653_+	hypothetical protein	NA	NA	NA	NA
WP_155118613.1\|2824649_2824811_-	hypothetical protein	NA	NA	NA	NA
WP_003641364.1\|2824823_2825033_-	hypothetical protein	NA	NA	NA	NA
WP_068874462.1\|2825044_2825779_-	ORF6C domain-containing protein	A0A1P8BM06	Lactococcus_phage	1.4e-49	45.2
WP_063845781.1\|2825794_2825998_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_068874463.1\|2826254_2826674_+	helix-turn-helix transcriptional regulator	A0A0M4QX29	Bacillus_phage	5.3e-30	47.9
WP_068874464.1\|2826685_2827123_+	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	2.3e-07	35.2
WP_068874466.1\|2827180_2827930_+	ion transporter	A0A1B0Y2S3	Lactobacillus_phage	1.3e-39	53.1
WP_068874469.1\|2827932_2828151_+	hypothetical protein	NA	NA	NA	NA
WP_068874471.1\|2828803_2829940_+\|integrase	site-specific integrase	E9LUS1	Lactobacillus_phage	1.4e-210	97.6
WP_022638033.1\|2830586_2832854_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	2.0e-118	31.4
2830057:2830073	attR	NA	NA	NA	NA
WP_003643147.1\|2832918_2833206_-	hypothetical protein	NA	NA	NA	NA
WP_013355446.1\|2833320_2833833_+	hypothetical protein	NA	NA	NA	NA
WP_003643149.1\|2833949_2834426_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003645251.1\|2835097_2835784_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_10

2995447 : 3079000

Lactobacillus_phage(73.33%)

terminase,head,capsid,integrase,tRNA,tail,protease,portal

attL 3023679:3023695|attR 3072314:3072330

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072533917.1\|2995447_2996050_+\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	4.8e-32	41.3
WP_013355383.1\|2996098_2997115_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	2.3e-66	42.0
WP_022638386.1\|2997207_2998413_-	hypothetical protein	NA	NA	NA	NA
WP_013355381.1\|2998539_2998935_-	glycerol-3-phosphate cytidylyltransferase	A0A1V0SGE7	Hokovirus	1.7e-17	42.2
WP_022638387.1\|2998954_3000370_-	flippase	NA	NA	NA	NA
WP_013355379.1\|3000439_3001324_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_033098981.1\|3001341_3002466_-	CDP-glycerol--glycerophosphate glycerophosphotransferase	NA	NA	NA	NA
WP_013355377.1\|3002455_3003520_-	glycosyltransferase	NA	NA	NA	NA
WP_013355376.1\|3003564_3004341_-	DUF4422 domain-containing protein	NA	NA	NA	NA
WP_022638388.1\|3004349_3005630_-	hypothetical protein	NA	NA	NA	NA
WP_033607823.1\|3005654_3006794_-	hypothetical protein	NA	NA	NA	NA
WP_013355374.1\|3006780_3007383_-	AAA family ATPase	NA	NA	NA	NA
WP_013355373.1\|3007406_3008042_-	hypothetical protein	NA	NA	NA	NA
WP_013355372.1\|3008165_3009284_-	UDP-galactopyranose mutase	E4ZFQ1	Streptococcus_phage	4.0e-173	79.8
WP_003643315.1\|3009433_3010150_-	aquaporin family protein	A0A1J0F964	Only_Syngen_Nebraska_virus	5.6e-19	32.7
WP_003643314.1\|3010339_3011269_-	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_003646267.1\|3011645_3012764_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	2.7e-20	31.2
WP_171831422.1\|3014375_3015731_+	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_003646269.1\|3015813_3016377_-	hypothetical protein	NA	NA	NA	NA
WP_003643305.1\|3016810_3017251_-	hypothetical protein	NA	NA	NA	NA
WP_003643304.1\|3017450_3017651_+	hypothetical protein	NA	NA	NA	NA
WP_003643303.1\|3017800_3018667_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_013355368.1\|3018659_3019967_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003643301.1\|3020100_3020541_+	universal stress protein	NA	NA	NA	NA
WP_022638390.1\|3021083_3021617_-	hypothetical protein	E9LUS0	Lactobacillus_phage	1.4e-35	97.6
WP_003644510.1\|3021628_3021892_-	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
WP_022638392.1\|3022922_3023282_-	hypothetical protein	A0A2P0ZLF6	Lactobacillus_phage	1.0e-45	80.7
WP_003644513.1\|3023265_3023427_-	hypothetical protein	A0A2P0ZLG1	Lactobacillus_phage	9.5e-20	100.0
WP_022638393.1\|3023430_3023673_-	hypothetical protein	A0A2P0ZLG3	Lactobacillus_phage	3.4e-29	100.0
WP_022638394.1\|3023665_3026305_-	hypothetical protein	A0A2P0ZLG5	Lactobacillus_phage	1.2e-130	64.5
3023679:3023695	attL	NA	NA	NA	NA
WP_022638395.1\|3026321_3028736_-\|tail	phage tail protein	A0A2P0ZLF8	Lactobacillus_phage	0.0e+00	92.4
WP_022638396.1\|3028802_3030578_-\|tail	phage tail family protein	A0A2P0ZLH2	Lactobacillus_phage	1.4e-300	90.3
WP_022638397.1\|3030650_3035558_-	tape measure protein	E9LUR1	Lactobacillus_phage	0.0e+00	62.9
WP_016058335.1\|3035570_3035762_-	hypothetical protein	E9LUR0	Lactobacillus_phage	1.5e-27	100.0
WP_016058334.1\|3035758_3036142_-	hypothetical protein	E9LUQ9	Lactobacillus_phage	3.9e-64	100.0
WP_021732001.1\|3036343_3036982_-\|tail	phage tail protein	E9LUQ8	Lactobacillus_phage	3.7e-107	92.9
WP_022638398.1\|3036982_3037366_-	DUF806 family protein	E9LUQ7	Lactobacillus_phage	1.0e-64	96.9
WP_021732003.1\|3037362_3037803_-	hypothetical protein	E9LUQ6	Lactobacillus_phage	3.2e-78	97.9
WP_021732004.1\|3037792_3038155_-\|head	phage head closure protein	E9LUQ5	Lactobacillus_phage	1.5e-65	99.2
WP_016058329.1\|3038138_3038477_-\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	7.0e-57	100.0
WP_022638399.1\|3038549_3039782_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	8.5e-201	88.0
WP_022638400.1\|3039781_3040540_-\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	1.2e-128	96.0
WP_022638401.1\|3040517_3041711_-\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	6.9e-224	98.7
WP_022638402.1\|3041713_3041908_-	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	5.3e-25	93.8
WP_063491136.1\|3041897_3043796_-\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	0.0e+00	92.6
WP_016511011.1\|3043805_3044261_-\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	3.0e-79	96.7
WP_050578353.1\|3044438_3044978_-	HNH endonuclease	A0A2D1GPF4	Lactobacillus_phage	6.9e-30	48.4
WP_022638404.1\|3044980_3045451_-	HNH endonuclease	E9LUP7	Lactobacillus_phage	1.5e-65	75.2
WP_022638405.1\|3045461_3045641_-	hypothetical protein	E9LUP6	Lactobacillus_phage	4.3e-13	67.8
WP_022638406.1\|3045843_3046395_-	hypothetical protein	A8ASQ2	Listeria_phage	1.6e-21	38.3
WP_022638818.1\|3046930_3047356_-	phage transcriptional activator RinA	E9LUP5	Lactobacillus_phage	3.1e-62	81.6
WP_033607948.1\|3047537_3047732_-	hypothetical protein	E9LUP4	Lactobacillus_phage	8.0e-05	52.7
WP_054598401.1\|3047728_3048145_-	hypothetical protein	E9LUP3	Lactobacillus_phage	4.2e-35	54.9
WP_022638825.1\|3048141_3048339_-	hypothetical protein	NA	NA	NA	NA
WP_054598400.1\|3048411_3048846_-	hypothetical protein	Q5ULS7	Lactobacillus_virus	7.2e-14	53.2
WP_022638755.1\|3048829_3049006_-	hypothetical protein	E9LUP2	Lactobacillus_phage	8.8e-19	81.0
WP_155118607.1\|3049035_3049203_-	hypothetical protein	NA	NA	NA	NA
WP_022638754.1\|3049377_3049536_-	hypothetical protein	A0A2P0ZLB5	Lactobacillus_phage	3.9e-18	92.3
WP_022638753.1\|3049528_3049837_-	hypothetical protein	E9LUN7	Lactobacillus_phage	1.7e-49	96.1
WP_022638752.1\|3049972_3050758_-	ATP-binding protein	E9LUN6	Lactobacillus_phage	2.2e-130	90.0
WP_022638751.1\|3050757_3051465_-	conserved phage C-terminal domain-containing protein	A0A0P0I7Q1	Lactobacillus_phage	1.8e-33	59.3
WP_022638750.1\|3051506_3052205_-	DUF968 domain-containing protein	E9LUU3	Lactobacillus_phage	3.4e-122	92.2
WP_022638749.1\|3052251_3052923_-	DUF669 domain-containing protein	E9LUU2	Lactobacillus_phage	2.8e-81	87.9
WP_022638748.1\|3052924_3053587_-	AAA family ATPase	E9LUU1	Lactobacillus_phage	1.5e-119	97.7
WP_022638747.1\|3053587_3054448_-	DUF1351 domain-containing protein	A0A2D1GPE4	Lactobacillus_phage	3.4e-31	36.1
WP_022638746.1\|3054447_3054594_-	hypothetical protein	E9LUT9	Lactobacillus_phage	1.3e-15	87.2
WP_022638745.1\|3054876_3055116_-	hypothetical protein	E9LUT6	Lactobacillus_phage	5.9e-34	82.4
WP_033607908.1\|3055577_3055859_+	CRISPR-associated endonuclease Cas2	A0A2H4JEH2	uncultured_Caudovirales_phage	1.9e-15	42.9
WP_022638743.1\|3055852_3055999_-	hypothetical protein	NA	NA	NA	NA
WP_022638742.1\|3056067_3056556_+	hypothetical protein	NA	NA	NA	NA
WP_022638741.1\|3056533_3056740_-	hypothetical protein	A0A182BQC3	Lactococcus_phage	6.0e-11	57.4
WP_022638740.1\|3056769_3057522_-	phage antirepressor KilAC domain-containing protein	E9LUT0	Lactobacillus_phage	6.4e-58	96.5
WP_022638739.1\|3057534_3057750_-	hypothetical protein	NA	NA	NA	NA
WP_022638738.1\|3058009_3058339_+	helix-turn-helix transcriptional regulator	A0A0P0IZG9	Lactobacillus_phage	1.8e-12	38.7
WP_033607910.1\|3058369_3058759_+	ImmA/IrrE family metallo-endopeptidase	D6PSS8	Lactobacillus_phage	7.1e-37	55.8
WP_022638736.1\|3058822_3059398_+	hypothetical protein	NA	NA	NA	NA
WP_022638735.1\|3059403_3059604_+	hypothetical protein	E9LUS6	Lactobacillus_phage	3.2e-25	98.5
WP_022638734.1\|3060054_3061236_+\|integrase	site-specific integrase	B4XYR4	Lactobacillus_phage	1.2e-58	37.4
WP_003641354.1\|3061477_3062812_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.9e-37	30.9
WP_003644135.1\|3062824_3063832_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_003638174.1\|3064018_3064219_-	cold-shock protein	Q9AZD3	Lactococcus_phage	3.1e-20	71.4
WP_003641352.1\|3064562_3064928_+	DUF4828 domain-containing protein	NA	NA	NA	NA
WP_013355365.1\|3065083_3065860_-	lysozyme	A0A141HSE6	Bacillus_phage	2.6e-06	31.1
WP_003644133.1\|3065884_3066763_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_022638540.1\|3066887_3067772_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003644132.1\|3067764_3069081_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003646275.1\|3069320_3071660_-	cation-translocating P-type ATPase	M1HI01	Paramecium_bursaria_Chlorella_virus	7.1e-39	24.8
WP_003641346.1\|3071926_3072505_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
3072314:3072330	attR	NA	NA	NA	NA
WP_022638541.1\|3072958_3074332_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	F5CA72	Streptococcus_phi-m46.1-like_phage	5.5e-124	52.2
WP_003641344.1\|3074665_3075688_-	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	2.6e-17	26.5
WP_003641343.1\|3075792_3077217_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_003644129.1\|3077216_3078680_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_003641341.1\|3078679_3079000_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP013750

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP013751

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP013749

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection