CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP015992	Pseudomonas sp. TCU-HL1 chromosome, complete genome	1 crisprs	DEDDh,DinG,cas3,RT,csa3	0	0	8	0
NZ_CP015993	Pseudomonas sp. TCU-HL1 plasmid pTCUH, complete sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015992_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015992_1

870972-871087

Orphan

Consensus_repeat	Method
GCCCCTCTCCCGCAGGCGGGAGAGGGGAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015992_1

>merge|NZ_CP015992|1|870972-871087|CRISPRCasFinder
GCCCCTCTCCCGCAGGCGGGAGAGGGGAGGAAAAGCGAGGCCCCTCTCCTGTCATTTGGTGGGGCGCTGTTTTTGCCCTCTCCCCCAGCCCCTCTCCCGCAAGCGGGAGAGGGGAG

>NZ_CP015992|1|1|870972-871087|CRISPRCasFinder
GCCCCTCTCCCGCAGGCGGGAGAGGGGAG	GAAAAGCGAGGCCCCTCTCCTGTCATTTGGTGGGGCGCTGTTTTTGCCCTCTCCCCCA
GCCCCTCTCCCGCAAGCGGGAGAGGGGAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015992.1\|WP_069082056.1\|879433_880252_-\|zinc-dependent-peptidase	unknown	unknown	gnl\|CDD\|377621
NZ_CP015992.1\|WP_016490694.1\|878826_879354_-\|inorganic-diphosphatase	unknown	unknown	gnl\|CDD\|179262
NZ_CP015992.1\|WP_069082048.1\|865334_866453_-\|FAD-binding-protein	unknown	unknown	gnl\|CDD\|234593
NZ_CP015992.1\|WP_069082043.1\|860762_861062_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|240386
NZ_CP015992.1\|WP_083246043.1\|872032_873352_-\|undecaprenyl-phosphate-glucose-phosphotransferase	unknown	unknown	gnl\|CDD\|274396
NZ_CP015992.1\|WP_069082044.1\|861289_862039_-\|WecB/TagA/CpsF-family-glycosyltransferase	unknown	unknown	gnl\|CDD\|224833
NZ_CP015992.1\|WP_069082046.1\|863039_864266_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015992.1\|WP_069082054.1\|877069_877504_-\|low-molecular-weight-phosphotyrosine-protein-phosphatase	unknown	unknown	gnl\|CDD\|319971
NZ_CP015992.1\|WP_069082049.1\|866468_867740_-\|flippase	unknown	unknown	gnl\|CDD\|240533
NZ_CP015992.1\|WP_069082052.1\|874196_874703_-\|transcription/translation-regulatory-transformer-protein-RfaH	unknown	unknown	gnl\|CDD\|131010
NZ_CP015992.1\|WP_161490956.1\|862051_863065_-\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340839
NZ_CP015992.1\|WP_069082058.1\|881240_882755_+\|IS21-family-transposase	unknown	unknown	gnl\|CDD\|226950
NZ_CP015992.1\|WP_069082053.1\|874804_877045_-\|polysaccharide-biosynthesis-tyrosine-autokinase	unknown	unknown	gnl\|CDD\|183173
NZ_CP015992.1\|WP_069082051.1\|869143_870271_-\|UDP-N-acetylglucosamine-2-epimerase-(non-hydrolyzing)	unknown	unknown	gnl\|CDD\|223458
NZ_CP015992.1\|WP_069082042.1\|859417_860524_-\|polysaccharide-biosynthesis/export-family-protein	unknown	unknown	gnl\|CDD\|237903
NZ_CP015992.1\|WP_069082050.1\|867809_869078_-\|UDP-N-acetyl-D-mannosamine-dehydrogenase	unknown	unknown	gnl\|CDD\|182940
NZ_CP015992.1\|WP_069082047.1\|864268_865333_-\|polysaccharide-pyruvyl-transferase-family-protein	unknown	unknown	gnl\|CDD\|377253
NZ_CP015992.1\|WP_069082057.1\|880262_880922_-\|DedA-family-protein	unknown	unknown	gnl\|CDD\|182775
NZ_CP015992.1\|WP_069082055.1\|877737_878340_-\|trypsin-like-peptidase-domain-containing-protein	unknown	unknown	gnl\|CDD\|379142
NZ_CP015992.1\|WP_069082059.1\|882772_883528_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|366760

Protein	Function_ID	Function_description	E-value
NZ_CP015992.1\|WP_069082056.1\|879433_880252_-\|zinc-dependent-peptidase	gnl\|CDD\|377621	pfam06167, Peptidase_M90, Glucose-regulated metallo-peptidase M90. MtfA (earlier known as YeeI) is a transcription factor A that binds Mlc (make large colonies), itself a repressor of glucose and hence a protein important in regulation of the phosphoenolpyruvate:glucose-phosphotransferase (ptsG) system, the major glucose transporter in E.coli. Mlc is a repressor of ptsG, and MtfA is found to bind and inactivate Mlc with high affinity. The membrane-bound protein EIICBGlc encoded by the ptsG gene is the major glucose transporter in Escherichia coli. MtfA is found to be a glucose-regulated peptidase, whose activity is regulated by binding to Mlc available in the cytoplasm, which in turn has been released from EIICBGlc during times when no glucose is taken up. A physiologically relevant target for this peptidase is not yet known.	2.46094e-122
NZ_CP015992.1\|WP_016490694.1\|878826_879354_-\|inorganic-diphosphatase	gnl\|CDD\|179262	PRK01250, PRK01250, inorganic diphosphatase.	1.36258e-123
NZ_CP015992.1\|WP_069082048.1\|865334_866453_-\|FAD-binding-protein	gnl\|CDD\|234593	PRK00046, murB, UDP-N-acetylmuramate dehydrogenase.	2.69553e-103
NZ_CP015992.1\|WP_069082043.1\|860762_861062_-\|hypothetical-protein	gnl\|CDD\|240386	PTZ00370, PTZ00370, STEVOR; Provisional.	0.00624403
NZ_CP015992.1\|WP_083246043.1\|872032_873352_-\|undecaprenyl-phosphate-glucose-phosphotransferase	gnl\|CDD\|274396	TIGR03023, Sugar_transferase., Undecaprenyl-phosphate glucose phosphotransferase. This family of proteins encompasses the E. coli WcaJ protein involved in colanic acid biosynthesis, the Methylobacillus EpsB protein involved in methanolan biosynthesis, as well as the GumD protein involved in the biosynthesis of xanthan. All of these are closely related to the well-characterized WbaP (formerly RfbP) protein, which is the first enzyme in O-antigen biosynthesis in Salmonella typhimurium. The enzyme transfers galactose from UDP-galactose (NOTE: not glucose) to a polyprenyl carrier (utilizing the highly conserved C-terminal sugar transferase domain, pfam02397) a reaction which takes place at the cytoplasmic face of the inner membrane. The N-terminal hydrophobic domain is then believed to facilitate the "flippase" function of transferring the liposaccharide unit from the cytoplasmic face to the periplasmic face of the inner membrane. Most of these genes are found within large operons dedicated to the production of complex exopolysaccharides such as the enterobacterial O-antigen. Colanic acid biosynthesis utilizes a glucose-undecaprenyl carrier, knockout of EpsB abolishes incorporation of UDP-glucose into the lipid phase, and the C-terminal portion of GumD has been shown to be responsible for the glucosyl-1-transferase activity.	4.07369e-158
NZ_CP015992.1\|WP_069082044.1\|861289_862039_-\|WecB/TagA/CpsF-family-glycosyltransferase	gnl\|CDD\|224833	COG1922, WecG, Teichoic acid biosynthesis proteins [Cell envelope biogenesis, outer membrane].	5.51639e-90
NZ_CP015992.1\|WP_069082049.1\|866468_867740_-\|flippase	gnl\|CDD\|240533	cd13128, MATE_Wzx_like, Wzx, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Escherichia coli Wzx and related proteins from other gram-negative bacteria are thought to act as flippases, assisting in the membrane translocation of lipopolysaccharides including those containing O-antigens. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	3.44906e-41
NZ_CP015992.1\|WP_069082054.1\|877069_877504_-\|low-molecular-weight-phosphotyrosine-protein-phosphatase	gnl\|CDD\|319971	cd16343, LMWPTP, Low molecular weight protein tyrosine phosphatase. Low molecular weight protein tyrosine phosphatases (LMW-PTP) are a family of small soluble single-domain enzymes that are characterized by a highly conserved active site motif (V/I)CXGNXCRS and share no sequence similarity with other types of protein tyrosine phosphatases (PTPs). LMW-PTPs play important roles in many biological processes and are widely distributed in prokaryotes and eukaryotes.	2.66475e-65
NZ_CP015992.1\|WP_069082052.1\|874196_874703_-\|transcription/translation-regulatory-transformer-protein-RfaH	gnl\|CDD\|131010	TIGR01955, Transcriptional_activator_rfaH., transcription elongation factor/antiterminator RfaH. This model represents the transcription elongation factor/antiterminator, RfaH. This protein is most closely related to the transcriptional termination/antitermination protein NusG (TIGR00922) and contains the KOW motif (pfam00467). This protein appears to be limited to the gamma proteobacteria. In E. coli, this gene appears to control the expression of haemolysin, sex factor and lipopolysaccharide genes. [Transcription, Transcription factors].	3.23961e-53
NZ_CP015992.1\|WP_161490956.1\|862051_863065_-\|glycosyltransferase-family-4-protein	gnl\|CDD\|340839	cd03811, GT4_GT28_WabH-like, family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.	1.44761e-21
NZ_CP015992.1\|WP_069082058.1\|881240_882755_+\|IS21-family-transposase	gnl\|CDD\|226950	COG4584, COG4584, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	7.73358e-34
NZ_CP015992.1\|WP_069082053.1\|874804_877045_-\|polysaccharide-biosynthesis-tyrosine-autokinase	gnl\|CDD\|183173	PRK11519, PRK11519, tyrosine-protein kinase Wzc.	0
NZ_CP015992.1\|WP_069082051.1\|869143_870271_-\|UDP-N-acetylglucosamine-2-epimerase-(non-hydrolyzing)	gnl\|CDD\|223458	COG0381, WecB, UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane].	0
NZ_CP015992.1\|WP_069082042.1\|859417_860524_-\|polysaccharide-biosynthesis/export-family-protein	gnl\|CDD\|237903	PRK15078, PRK15078, polysaccharide export protein Wza; Provisional.	2.86535e-101
NZ_CP015992.1\|WP_069082050.1\|867809_869078_-\|UDP-N-acetyl-D-mannosamine-dehydrogenase	gnl\|CDD\|182940	PRK11064, wecC, UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional.	0
NZ_CP015992.1\|WP_069082047.1\|864268_865333_-\|polysaccharide-pyruvyl-transferase-family-protein	gnl\|CDD\|377253	pfam04230, PS_pyruv_trans, Polysaccharide pyruvyl transferase. Pyruvyl-transferases involved in peptidoglycan-associated polymer biosynthesis. CsaB in Bacillus anthracis is necessary for the non-covalent anchoring of proteins containing an SLH (S-layer homology) domain to peptidoglycan-associated pyruvylated polysaccharides. WcaK and AmsJ are involved in the biosynthesis of colanic acid in Escherichia coli and of amylovoran in Erwinia amylovora.	2.87002e-19
NZ_CP015992.1\|WP_069082057.1\|880262_880922_-\|DedA-family-protein	gnl\|CDD\|182775	PRK10847, PRK10847, DedA family protein.	2.47184e-92
NZ_CP015992.1\|WP_069082055.1\|877737_878340_-\|trypsin-like-peptidase-domain-containing-protein	gnl\|CDD\|379142	pfam13365, Trypsin_2, Trypsin-like peptidase domain. This family includes trypsin-like peptidase domains.	0.000122044
NZ_CP015992.1\|WP_069082059.1\|882772_883528_+\|ATP-binding-protein	gnl\|CDD\|366760	pfam01695, IstB_IS21, IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.	1.48312e-74

>NZ_CP015992.1|WP_069082051.1|869143_870271_-|UDP-N-acetylglucosamine-2-epimerase-(non-hydrolyzing)
MTIKTLCVFGTRPEAIKMAPLALALAADESFDAKVCVTGQHREMLDQVLGLFDIEPDFDLNIMKPGQDLTDVTSAILQGMKSVFAAFKPDVVLVHGDTATTFAASLAAYYQQIPVAHVEAGLRTGNTYSPWPEEANRKMTGALANIHFAPTTTSQNNLLREGIDPKTVIVTGNTVIDALLDVIARLDRDSQLQAQAAKPFEFLNLNRKTVLVTGHRRESFGGGFERICQALMDVAQQHPEVDIVYPVHLNPNVREPVNRLLTGIRNVHLIEPLDYLPFVYLMSRSHIILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVAAGTVKLVGTDTANIIRELHTLLNDSNAYRAMSYAHNPYGDGKACKRILNALLSTL
>NZ_CP015992.1|WP_069082050.1|867809_869078_-|UDP-N-acetyl-D-mannosamine-dehydrogenase
MPFQTISVVGLGYIGLPTAAVFASRKKKVIGVDVNQQAVDTINRGEIHIVEPDLDMAVHAAVVEGYLRATTVPEPADAFLIAVPTPFKGDHEPDLSYIESASKSIAPVLKKGDLVVLESTSPVGATEQMAAWLAEARPDLTFPQTHGEASDIRVAHCPERVLPGHVLRELVQNDRVIGGMSPKCCEVAVALYKAFVEGDCVLTNARTAEMCKLTENSFRDVNIAFANELSIICDKLDINVWELICLANRHPRVNILQPGPGVGGHCIAVDPWFIVSKTPEDAKLIRTAREVNDGKPEWVIEKVKLAIAEFLLSNPDKSAREVTVACLGLAFKADIDDLRESPALSIALKISETHKGPLIAVEPNINKLPSKLEEKFQLTGIKKTLSEADIIILLVDHKEFRDKQEKLASHHRIIDTRGVINS
>NZ_CP015992.1|WP_069082049.1|866468_867740_-|flippase
MNLNDLISKNQIFALTAKALEGSKVIITNLLIARFFEPDDFGRYSFILGITSLLAVIAEFRLQNVLVKEITCDSEPPSRLLGSALVANLIFAVIGILLVLAYSAYESDKTVAIGLAIYSISFLYKIPRTFRAQFLAEEKNILIAKCEIAASMATLSITLAFIAYEFSLLWIVFARSIDFLAIGILLTYYHKKNTPLKISYKSSTAKRLINLSAPLVFSGAAMILFQRLDIILVRHYLGDFSAGIYSSATTLMLMFSITPIVVSETLAPKMFKNINLENYPSVKQKFSDIIVTTGMAMSALMFTTAYFATTLIFGESYQDAKIPALILSITPLLTALGAASGQIIVADGNQNRAFIKSVVACIINTILNIALIPKYGIHGAAMSTVIGLFIANYAAHFFMDIYKYLFIIQSKSLFLPYKPRTQI
>NZ_CP015992.1|WP_069082048.1|865334_866453_-|FAD-binding-protein
MLEKKFSLLKLNKFKVECIADEYFSFTDTSELDEYARKNINNETPYFVLGGGSNVLFSKDLKGLVIHPQKKEIEKIDEDKGKVLVRAHAGLNWDEFVGFCSQRGWHGLENLTLIPGNVGAAPVQNIGAYGTEVSEWIQAVHCYDINKKRELTLTNKECSFSYRHSIFKESPELIILAVDFLLYKSQLQKAAYQHGRIKGYATVLTDILRAIPISIQSITFSGKNQWKPKFSFIKIRDLLALTSIPVELKRNLVRFIRLRTLPNPDIVGNVGCFFKSPIVTNQKAAFIECEIKNVQIFDYTQGYKKISAGDLIKACGWAGKKVGSVGVDAKRPIVLLNHGTRNGLDIYNLSQQIQQDVEAKFQIKLEPEAVIK
>NZ_CP015992.1|WP_069082047.1|864268_865333_-|polysaccharide-pyruvyl-transferase-family-protein
MKKVYTLTFQKVLNNGAALQAYALAKFLKDSNFQVEVIDYLPSYFLIQRYRPALGLKKTANKIKKICSFNQFANKHLPLTPKTYFSKKSLSQISDAHAIVCGSDQVWNKHLTNGTIDESFLLSFAPSHTKRIAYAASAGSSRIIETKDSVALLRSFDALGVREDILTDDIKSLDPGLTSQVVVDPSLLIKDYSQIENPKRVPSDEYIVTYVVGSGETLNKFNEYIKILKEKIKLPVYHIGAKPIESADYNLLDVGPDEWISFIKSAKFVGTNSFHGTAFSVNFEKQFLFFPHTVENLNTRQTTLLKRINLLDRLVPTPFDLEKLKIESIDYSLTNPKLLKIVKESKDFLLNALS
>NZ_CP015992.1|WP_069082046.1|863039_864266_-|hypothetical-protein
MKINLKTWLIIIYVSFAFDSALKFNAGVQLHAGLIAILLTNALFFFTRPSQIVSTIRKEFFFFLFLAYCTTAGMAYSKPGYLVILTYLAISANVLIFVNLTYRKWDHSFFLYFQIALIVTGLFQYALFNLFGTQISFINEEHYQKGSSVSLRLRGFFVEPNWFAIAITFNTFLLIGNDVISFIKRHYWLAALSAITIILNGSLATISILVIAYAAPLIKKNPAKGGIITLLLISLMYGVFAFRNEINQKGVNETVLNYNSRWLPLTRVIEHQKTQGITSMLFGNGLGSWGTEAVKNRLSVLVHEEEPSARDGSELPVFIFELGALGMLLLILDGIATFLRTPRKLTNIRGGILLFFVCLVFYPTLKFWMYMPYYFYMRTMAHATRKAPRTASNSIARDTEIGSSLAPN
>NZ_CP015992.1|WP_161490956.1|862051_863065_-|glycosyltransferase-family-4-protein
MEVAWHLINDPDPRRGGAQRILREAALNSEIILSQKSGRNTFYGKVFGKHSWIPFLIVKIIKKRPKTVFIHSRCFLPLSLILRAFKSKVIFYAHANYKHGNLLFRVFRCDQYIAVSDAVKKLLESNKILSSRITVIRNPYLAGKNVLQNHDKRSEHLNIACIGSLNPWKGVYLLADKLLKIAEYQKSKICLTVVGDGPEKESIANLSSRSKYFETRLLGFQEAPYEHISNISIVAIPSLEEGFGLVAIESIYQGKIVIYSDIPALREVCKDQSLCFPFSHSDQDSLIKAIRSSIEKSIDSSPPALMKDRSERILEEYGKDKFIQQQLAFRARLNNLL
>NZ_CP015992.1|WP_069082044.1|861289_862039_-|WecB/TagA/CpsF-family-glycosyltransferase
MKRIEFLGCPMDSSTTSESINRIKYSVVTGHFLQHVVVNVAKVVNMQSDAILRESVSACDIINIDGMGVVWGARLLGHRVPERVAGIDLFYELLAMSATSGFSVYLLGAKDDVVSKTATTVQNLYPGLNIAGYHHGYFWGDEEAMAQKIRESGAQLLFVAITSPQKENFINRWKYQLGVNFVMGVGGTFDVVAGKVKRAPLWMQNYGLEWLYRVTQEPGRMWKRYLTTNTKFAWLLIKEKAKQLTSRNR
>NZ_CP015992.1|WP_069082043.1|860762_861062_-|hypothetical-protein
MKKLLTLAAVAAFSTSLVAAETSTTADTGKTTAGTPGSTSGLTLSTPIAGGVTVGTGLAIGAAAIAVGIAASNSGGGGNDSTPGTGGTTGTSGTTGTTN
>NZ_CP015992.1|WP_069082042.1|859417_860524_-|polysaccharide-biosynthesis/export-family-protein
MNRALPLATLLGLTLQGCMFSPGQHMDSGNQVRKGSPESSRIELVPITPKLVAIESAMNGTQVAPELLSFQPGEYRIGAGDLIYITVWDHPELTAPSGPQQQIEANGRLVRPDGTLFYPYVGNVDAAGKTIEELRSLIASRLTSVVTEPQVDVSVLRFASQKVILSGAFSKTGPVPVTNTPLSLLDAVGQGGVQTGAADIAGLVLKRAGREYVIDLDTLNRKDSVLHNIYLRDGDQLHLPYNDNKKVYLLGEVNSARALSFKGSSMNLTDALGSVGGLRQETSSGKEVYVIRGVDDLQRDVAKVYQLNLKSPSAFIVAEHFKLQPQDVVYIGPADVTRWNRFISQVFPTANLLRTGVAIQDDLSNNSN
>NZ_CP015992.1|WP_083246043.1|872032_873352_-|undecaprenyl-phosphate-glucose-phosphotransferase
MGMLTLLLCALAKGNIGHIETQYRILALFTLLGSVPAYSLMRVYHKQHGYLVGVSRLLAGWLVLLSGLTVMAFVTKTSELFSREIIIIWAGAGYVIQACLFLPLHAISRRYHNKLQSERTSLIIGTGDLAQELADKLVRKRSEPLLGLVAADDHLHLDDSLYPLIGNLSHLRDLITEHRIRRLYIALPLSAAEQIEGLYIDLLDANVDVVWIPDLQSLKLLNHSVSDIAGLAAINLNESPLTSYPTAALTKAVLDRSVALLAILLLSPVLLGTALAVKLSSPGPALFKQKRHGWNGMVIKVWKFRSMRVHADTQVKQATRKDPRITRVGRFIRRTSIDELPQLFNVLQGCMSLVGPRPHAVAHNDYYTGKIDAYMARHRIKPGITGLAQISGCRGETETLDKMEKRVELDLAYINNWSFWLDIKILIKTPFTLLAKDIY
>NZ_CP015992.1|WP_069082052.1|874196_874703_-|transcription/translation-regulatory-transformer-protein-RfaH
MAGKPAPHRWYLIQCKPKQDARAEEHLVRQAFRCYRPTHCVTRLRGGRKRESVESLFPGYLFIQLDQVNDNWHPIRSTRGVSQLVCFGDQPAAIADELIKQLQQRLASPQPQEPCLSPGDRIRLKSAGLQEMEAIFLARDGSERVLILLQLLQRQHTLSVPRDSIDKL
>NZ_CP015992.1|WP_069082053.1|874804_877045_-|polysaccharide-biosynthesis-tyrosine-autokinase
MTTQHNLQVQVIRDDDDIDLLGLLGTLLDSKWIIVGITSFFTVLGAAYAVLTPPVYQANALVQVEEKKGGMAALSGISEMTEMFGGTSAAVTEIELLKSRAVLGQAVENLKLDIIVEPHYFPLFGQFLARRFQPVSEHEVAEPFFGLSSFAWGGEVLDVFQLDAPDAYLGKDLTLRADGNGTFTLLNDDDEVLLTGQVGEQLEQDGFKVQIAQLDANPSSLFSVTKQRRLTTILQYQEDLAASERGKESGIISLSLESENPAHATQVLDEVSRLYVLQNVQRNSAEAAQSLEFLQGQLPEVRKQLEKAEAQLNAYQTSARSVDITIETKAVLDQIVALETLISEQKLKRAEMERLFTRQHPSYQALITQMGQLEQQKRDLQKKVENLPETQQELLRLTRDMQVTTEIYTQLLNKSQELDIVRAGTVGNVRIIDAADANIEKPVKPKKALIVLIATLLGGLVAVSYVLARKALNRGVEDPDVIEQMGLPVYASIPHSKEQAAHELSFKGKGKGTASAGSLLLAVTNPADLAVESLRSLRTSLHFATLEAKNNILMISGPSPSVGKSFVSSNLAAIIAQTGQKVLLIDADMRKGYIHKMFQQEAENGLSELLTARINLDQAAYASEVENLHVITRGQIPPNPSELLMHANFTQLLEQASSRYDLVIIDTPPILAVTDAGLVGRQAGTSLIVTRFGMNAAKEILLTKRRFEQNGISLKGAIFNAVERKASAYGYGNYSYYQYEYKSDKA
>NZ_CP015992.1|WP_069082054.1|877069_877504_-|low-molecular-weight-phosphotyrosine-protein-phosphatase
MFKNILVVCVGNICRSPTAEALLKSKLAPRGINVGSAGIHALVGNPMDSTALEVLREHGGDHPEHQGRQLSREMLHQYDLVLAMEQGHIQRIAQMAPEARGKTFLLGKWQGNQDIPDPYRQQKPAFEHVYQLMAQGVESWSQKI
>NZ_CP015992.1|WP_069082055.1|877737_878340_-|trypsin-like-peptidase-domain-containing-protein
MVKPELASSTTNSYFPIFSGFPLPYFYMASAVQWNEEYAVTTAHTPLIPYETYRCSTGCDLVFFRHTAKAKIPSWRAAQPGESITSTGASPYLIAASGKGKVYPAPFINTDEDSGELYAIHDAPIAKGMSGGPVIAEDGSVVGINMGIYSVTLNDLSYHPGVRGAQRISVFIPYSVILREWTLLHARLKTTDKRSFAANE
>NZ_CP015992.1|WP_016490694.1|878826_879354_-|inorganic-diphosphatase
MSYSKIPAGKDLPNDIYVAIEIPANHAPIKYEIDKDSDCLFVDRFMATPMFYPANYGYIPNTLADDGDPLDVLVVTPYPVAPGSVIRARPVGVLHMTDEAGGDAKLLAVPHDKLSVLYKDVKEYTDLPALLLEQIKHFFENYKDLEKGKWVKVEGWGNADAARAEITKAVAAYQK
>NZ_CP015992.1|WP_069082056.1|879433_880252_-|zinc-dependent-peptidase
MWSYRSWRRRRILARNPVAPEQWATVQRRLPILDGLDETENQRLRERSVLFLHGKRISALPGVELSRDDRLTLAALAQLPLLHLPDLDWYQGFHELVLYPDDFVSPQRHRDAAGVEHEYEDERSGESWQFGPVILAWPGVQASGGWDGYNLVIHELAHKLDMLNGSPNGLPPLHRDMRQSDWALAMQTAFDALNAQLDRDPDAETPIDPYAAEDPAEFFAVASEYFFTAPDLLDQAFPAVYRQLQAFYRQDPLSRLKRLQITHPDYRDATNG
>NZ_CP015992.1|WP_069082057.1|880262_880922_-|DedA-family-protein
MDFNPIDLILHLDQYLNLLVTNYGTWIYAILFLVIFCETGLVVTPFLPGDSLLFIAGAVCATGGMDPLLLGGLLMLAAISGDSTNYLIGRTVGERLFSNPNSKIFRRDYLQRTHDFYDRHGGKTVTLARFLPIVRTFAPFVAGVGRMPYPRFFAFSVLGTLLWVGGLVTLGFFFGNVPFIKQHLSLMVIAIIGLSMLPMMIGFARSHFRPAAKDAEHSS
>NZ_CP015992.1|WP_069082058.1|881240_882755_+|IS21-family-transposase
MRKIREVLRLKFEVGLSARQIAVSLQVGRATIGDYLNRFAACGLTWPSALTDAELERQLFPPSPSVPSEQRPIPDWAWIHAELRRPGVTLALLWQEYRLSQPQGFQYSWFCDHYRAWQGKVDVVMRQEHRVGEKLFVDYAGQTVPIIDRRTGEIRQAQIFVAVLGASSYTFAEATWSQQLSDWLGSHARCFAFLGGVPAIVVPDNLRSAVSKTHRYEPDINPSYRDLAEHYAVAIVPARARKPRDKAKVEVGVQVVERWILAALRHRQFFSREELNTAIGALLVRLNQRPFKKLPGSRQSAFETLDQPALRALPEQPYVYAEWKKVRVHIDYHVEVDGHYYSVPYQLVKQQLEVRLTARTVECFHGNQRVASHVRAQLKGRHSTQVGHMPKSHREHAEWTPQRLVRWAEQTGPHTAGVIQHILERRSHPSHGYRACLGILRLGKAHGEDRLEAACQRALSLGACSYKSLESILRQGLERLPLPQQHLPLLPDNHENLRGPRYYH
>NZ_CP015992.1|WP_069082059.1|882772_883528_+|ATP-binding-protein
MLHHPTLDKLQNLRLHGMLKALSEQLTTPDISSLSFEERLGLLIDRELTEREDKRLSSRLRQARLRHNACIEDLDYRSPRGLDKGLILQLSSGQWLREGLNLIIGGPTGVGKTWLACALAHKACRDGFSVRYLRLPRLLEDLGLAHGDGRFAKLMSSYAKTDLLILDDWGLAPFTAEQRRDMLELLDDRYGQRSTLVTSQMPVENWHELIGDPTLADAILDRLVHNAYRLQLKGESMRKRTRKLTAPGQSD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

596175 : 651813

Stenotrophomonas_phage(22.22%)

integrase,transposase

attL 593616:593632|attR 630684:630700

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
593616:593632	attL	NA	NA	NA	NA
WP_069081842.1\|596175_597378_+\|integrase	tyrosine-type recombinase/integrase	B7SYF8	Stenotrophomonas_phage	1.5e-85	44.8
WP_069081843.1\|597510_598737_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.8e-49	47.1
WP_069081844.1\|598828_599677_-	hypothetical protein	NA	NA	NA	NA
WP_069081845.1\|600209_600410_+	AlpA family transcriptional regulator	A0A1V0E8E5	Vibrio_phage	2.2e-13	57.6
WP_069081846.1\|600732_601389_+	inovirus Gp2 family protein	NA	NA	NA	NA
WP_161490953.1\|603126_603264_-\|transposase	transposase	NA	NA	NA	NA
WP_080370411.1\|603279_603423_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_083245796.1\|603458_603776_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_023835624.1\|606861_607026_-	hypothetical protein	NA	NA	NA	NA
WP_069081849.1\|607036_607534_-	DNA repair protein RadC	NA	NA	NA	NA
WP_069081850.1\|607505_608456_-	hydrolase or metal-binding protein	NA	NA	NA	NA
WP_069081851.1\|608547_609552_-	YqaJ viral recombinase family protein	A6XMH8	Bacillus_virus	1.6e-48	39.7
WP_069081852.1\|609627_610596_-	DUF932 domain-containing protein	A0A0H4INH5	Stenotrophomonas_phage	6.5e-63	43.0
WP_069081853.1\|610689_611019_-	hypothetical protein	NA	NA	NA	NA
WP_069081855.1\|613210_614167_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_069081856.1\|614265_616350_-	hydantoinase/oxoprolinase family protein	NA	NA	NA	NA
WP_069081857.1\|616363_618109_-	hydantoinase B/oxoprolinase family protein	NA	NA	NA	NA
WP_069081858.1\|618336_619512_-	hypothetical protein	NA	NA	NA	NA
WP_069081859.1\|619578_620916_-	allantoin permease	NA	NA	NA	NA
WP_069081860.1\|621440_622142_-	DNA-binding transcriptional regulator CsiR	NA	NA	NA	NA
WP_069081861.1\|622324_623302_+	carbon starvation induced protein CsiD	NA	NA	NA	NA
WP_069086389.1\|623434_624685_+	L-2-hydroxyglutarate oxidase	NA	NA	NA	NA
WP_069081862.1\|624723_626172_+	NADP-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_069081863.1\|626261_627539_+	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	1.1e-30	29.2
WP_069081864.1\|627673_629074_+	GABA permease	NA	NA	NA	NA
WP_069081868.1\|631080_632061_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	7.4e-91	55.6
630684:630700	attR	NA	NA	NA	NA
WP_145928249.1\|632856_633123_+	hypothetical protein	NA	NA	NA	NA
WP_069081870.1\|635833_636127_-	hypothetical protein	NA	NA	NA	NA
WP_069081871.1\|636326_636728_-	response regulator	NA	NA	NA	NA
WP_069086390.1\|636921_642651_-	EAL domain-containing protein	G3MA91	Bacillus_virus	8.4e-25	34.6
WP_069081872.1\|642687_643236_-	response regulator	NA	NA	NA	NA
WP_069081873.1\|643232_644588_-	response regulator	NA	NA	NA	NA
WP_069081874.1\|644584_645874_-	PAS domain-containing protein	NA	NA	NA	NA
WP_083246038.1\|646064_646745_+	hypothetical protein	NA	NA	NA	NA
WP_069081878.1\|648854_649604_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	2.4e-81	60.7
WP_177343853.1\|651292_651583_+\|transposase	transposase	NA	NA	NA	NA
WP_083245801.1\|651522_651813_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_2

684652 : 690315

Escherichia_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069081897.1\|684652_685723_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	6.0e-102	52.8
WP_069081898.1\|685787_686666_+	glucose-1-phosphate thymidylyltransferase RfbA	A0A291LA53	Escherichia_phage	5.2e-112	68.1
WP_069081899.1\|686662_687205_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	2.9e-52	55.6
WP_069081900.1\|687207_688083_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	4.5e-31	33.5
WP_083246039.1\|688820_689174_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	4.5e-14	37.3
WP_069081902.1\|689514_690315_-	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	4.0e-34	36.8

DBSCAN-SWA_3

1861976 : 1929244

Bacillus_phage(25.0%)

protease,holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069082891.1\|1861976_1863035_+\|holin	phosphorylcholine phosphatase	NA	NA	NA	NA
WP_069082892.1\|1863201_1864494_+	phospholipase	NA	NA	NA	NA
WP_069082893.1\|1864662_1866996_-	alkaline phosphatase family protein	NA	NA	NA	NA
WP_069082894.1\|1867331_1868168_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_177343822.1\|1868297_1868684_+	DUF3509 domain-containing protein	NA	NA	NA	NA
WP_069082896.1\|1868759_1869083_-	hypothetical protein	NA	NA	NA	NA
WP_069082897.1\|1869368_1870283_+	hypothetical protein	NA	NA	NA	NA
WP_069082898.1\|1870290_1871226_-	DMT family transporter	NA	NA	NA	NA
WP_069082899.1\|1871351_1872290_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_069082900.1\|1872326_1872881_-	NAD/FAD-utilizing enzyme apparently involved in cell division	NA	NA	NA	NA
WP_069082901.1\|1873070_1873250_-	hypothetical protein	NA	NA	NA	NA
WP_069082902.1\|1873342_1873552_-	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	8.3e-16	58.1
WP_069082903.1\|1874117_1874876_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_069082904.1\|1875098_1875971_+	universal stress protein	NA	NA	NA	NA
WP_069082905.1\|1876638_1877406_+	serine/threonine-protein phosphatase	NA	NA	NA	NA
WP_069082906.1\|1877410_1878940_+	serine/threonine protein kinase	A0A2R8FF19	Brazilian_cedratvirus	2.9e-17	26.6
WP_069082907.1\|1879014_1879857_+	FHA domain-containing protein	NA	NA	NA	NA
WP_069082908.1\|1879902_1880493_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_069082909.1\|1880651_1880966_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_069082910.1\|1880962_1881727_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_069082911.1\|1881885_1882209_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_069082912.1\|1882268_1884125_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	8.1e-46	28.3
WP_069082913.1\|1884834_1885761_+	universal stress protein	NA	NA	NA	NA
WP_069086456.1\|1885906_1886131_-	hypothetical protein	NA	NA	NA	NA
WP_069082914.1\|1886135_1886840_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_069082915.1\|1887035_1888784_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.3e-18	31.5
WP_069082916.1\|1888884_1889736_+	CAP domain-containing protein	NA	NA	NA	NA
WP_069082917.1\|1889909_1890692_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_069082918.1\|1890778_1891672_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_069082919.1\|1891799_1892636_-	(S)-ureidoglycine aminohydrolase	NA	NA	NA	NA
WP_069082920.1\|1892821_1893706_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_069082921.1\|1893787_1894021_-	hypothetical protein	NA	NA	NA	NA
WP_083245850.1\|1894331_1896098_-	SulP family inorganic anion transporter	NA	NA	NA	NA
WP_069082922.1\|1896355_1897006_+	twin-arginine translocation pathway signal protein	NA	NA	NA	NA
WP_069082923.1\|1897138_1897654_-	phage antirepressor	A0A127KN97	Pseudomonas_phage	1.4e-11	35.0
WP_083245851.1\|1898504_1899227_+	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_161490962.1\|1899396_1899558_+	hypothetical protein	NA	NA	NA	NA
WP_161490963.1\|1899610_1900780_+	YcaO-like family protein	NA	NA	NA	NA
WP_069082924.1\|1900795_1902553_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	5.2e-10	30.2
WP_096368068.1\|1902733_1903087_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	3.5e-14	37.3
WP_083245853.1\|1903106_1903301_+	hypothetical protein	NA	NA	NA	NA
WP_069082058.1\|1903406_1904921_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	2.1e-148	53.2
WP_069082059.1\|1904938_1905694_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	2.4e-73	54.7
WP_096368068.1\|1905780_1906134_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	3.5e-14	37.3
WP_083245827.1\|1906153_1907653_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.0e-83	37.9
WP_145928423.1\|1907840_1909250_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	3.5e-81	39.3
WP_028628950.1\|1910098_1911346_-	ribonucleotide-diphosphate reductase subunit beta	K4K678	Caulobacter_phage	4.9e-31	28.7
WP_069082925.1\|1911616_1914514_-	ribonucleoside-diphosphate reductase subunit alpha	A0A2H4P767	Pseudomonas_phage	7.9e-181	46.1
WP_069082926.1\|1915226_1915952_+	response regulator	W8CYM9	Bacillus_phage	9.5e-35	34.8
WP_069082927.1\|1915996_1917613_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	1.3e-20	25.9
WP_069082928.1\|1917880_1918597_-	4'-phosphopantetheinyl transferase superfamily protein	NA	NA	NA	NA
WP_069082929.1\|1919012_1919618_+	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_069082930.1\|1919679_1920357_+	response regulator	NA	NA	NA	NA
WP_069082931.1\|1920353_1921733_+	sensor histidine kinase	NA	NA	NA	NA
WP_069082932.1\|1921831_1922977_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_069082933.1\|1923376_1924375_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_069082934.1\|1924696_1925992_+	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_069082935.1\|1926246_1927386_+	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_069086459.1\|1927563_1928745_+	CoA transferase	NA	NA	NA	NA
WP_069082936.1\|1928752_1929244_-\|protease	SprT family zinc-dependent metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_4

2685499 : 2692528

uncultured_Caudovirales_phage(85.71%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069083556.1\|2685499_2686780_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	3.7e-98	55.2
WP_069083557.1\|2686903_2688298_+	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_069083558.1\|2688282_2689296_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_069083559.1\|2689382_2690366_-	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	1.1e-145	77.6
WP_069083560.1\|2690362_2690698_-	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	6.8e-44	75.7
WP_069083561.1\|2690694_2690997_-	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	4.4e-26	63.0
WP_069083562.1\|2690996_2691353_-	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	1.4e-31	61.0
WP_069083563.1\|2691354_2691747_-	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	2.7e-52	77.5
WP_069083564.1\|2691859_2692528_-	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	1.2e-97	86.5

DBSCAN-SWA_5

3455661 : 3506013

uncultured_Caudovirales_phage(44.44%)

capsid,tail,holin,protease,integrase,plate,tRNA,portal,terminase,head,transposase

attL 3453057:3453071|attR 3505886:3505900

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3453057:3453071	attL	NA	NA	NA	NA
WP_069081451.1\|3455661_3456801_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_069084161.1\|3457101_3457710_-	flavin reductase family protein	NA	NA	NA	NA
WP_069084162.1\|3457781_3458291_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_069084163.1\|3459753_3459939_+	hypothetical protein	NA	NA	NA	NA
WP_069084164.1\|3459935_3460733_+	hypothetical protein	A0A0S2SY56	Pseudomonas_phage	2.7e-30	61.5
WP_069081355.1\|3460815_3462342_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.4e-120	50.8
WP_069081356.1\|3462403_3462739_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_069081357.1\|3462735_3463053_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_083245902.1\|3463206_3463491_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_028628036.1\|3463501_3463735_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_069084166.1\|3464005_3464977_-\|portal	phage portal protein	A0A2H4J922	uncultured_Caudovirales_phage	1.5e-152	80.3
WP_069084167.1\|3464976_3466737_-\|terminase	terminase ATPase subunit family protein	Q9ZXM5	Pseudomonas_virus	3.4e-296	83.6
WP_069084168.1\|3466881_3467721_+\|capsid	GPO family capsid scaffolding protein	A0A2H4J928	uncultured_Caudovirales_phage	1.3e-67	52.7
WP_069084169.1\|3467747_3468758_+\|capsid	phage major capsid protein, P2 family	A0A077KEQ8	Ralstonia_phage	1.2e-120	62.6
WP_069084170.1\|3468760_3469459_+\|terminase	terminase endonuclease subunit	Q9ZXM2	Pseudomonas_virus	4.1e-83	69.4
WP_069084171.1\|3469562_3470024_+\|head	head completion/stabilization protein	A0A2H4JCS4	uncultured_Caudovirales_phage	2.0e-38	51.9
WP_069084172.1\|3470023_3470230_+\|tail	tail protein X	A0A2H4J946	uncultured_Caudovirales_phage	4.6e-19	68.1
WP_069084173.1\|3470244_3470559_+\|holin	phage holin, lambda family	A0A2H4JFM8	uncultured_Caudovirales_phage	5.8e-21	53.7
WP_069084174.1\|3470555_3471383_+	N-acetylmuramidase family protein	Q9ZXL6	Pseudomonas_virus	1.7e-96	68.7
WP_069084175.1\|3471379_3471586_+	hypothetical protein	NA	NA	NA	NA
WP_069084176.1\|3471582_3472113_+\|tail	phage tail protein	A0A2H4J906	uncultured_Caudovirales_phage	1.1e-51	66.5
WP_069084177.1\|3472102_3472558_+	phage virion morphogenesis protein	A0A2H4J927	uncultured_Caudovirales_phage	6.6e-50	71.1
WP_069084178.1\|3472885_3473203_+	hypothetical protein	NA	NA	NA	NA
WP_083245903.1\|3473375_3475400_-	S8 family serine peptidase	NA	NA	NA	NA
WP_145928311.1\|3475387_3476368_-\|protease	trypsin-like serine protease	NA	NA	NA	NA
WP_069084179.1\|3476529_3477264_+	hypothetical protein	NA	NA	NA	NA
WP_069084180.1\|3477340_3477907_+\|plate	phage baseplate assembly protein V	A0A2H4JFJ8	uncultured_Caudovirales_phage	1.6e-45	53.0
WP_069084181.1\|3477903_3478248_+	GPW/gp25 family protein	A0A2H4JE52	uncultured_Caudovirales_phage	9.4e-33	63.7
WP_069084182.1\|3478244_3479249_+\|plate	baseplate J/gp47 family protein	S4TNY7	Salmonella_phage	4.7e-72	47.4
WP_069084183.1\|3479241_3480078_+\|tail	phage tail protein I	A0A193GYD1	Enterobacter_phage	5.0e-27	50.4
WP_069084184.1\|3480074_3482261_+\|tail	phage tail protein	G3MAH2	Bacillus_virus	3.1e-60	33.3
WP_069084185.1\|3482265_3483087_+	hypothetical protein	NA	NA	NA	NA
WP_069084186.1\|3483097_3483565_+	hypothetical protein	NA	NA	NA	NA
WP_069084187.1\|3483653_3484823_+\|tail	phage tail sheath protein	A0A2H4JCP8	uncultured_Caudovirales_phage	2.4e-173	76.0
WP_069084188.1\|3484916_3485432_+\|tail	phage major tail tube protein	A0A2H4J916	uncultured_Caudovirales_phage	3.9e-75	78.4
WP_069084189.1\|3485496_3485736_+	hypothetical protein	NA	NA	NA	NA
WP_069084190.1\|3485725_3486010_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_069084191.1\|3486101_3486410_+\|tail	phage tail assembly protein	Q9ZXK2	Pseudomonas_virus	1.6e-28	71.1
WP_083245906.1\|3486418_3486538_+\|tail	GpE family phage tail protein	Q9ZXK1	Pseudomonas_virus	8.5e-10	74.4
WP_069084192.1\|3486527_3489071_+\|tail	phage tail tape measure protein	Q9ZXK0	Pseudomonas_virus	5.7e-268	59.4
WP_069084193.1\|3489076_3489508_+\|tail	phage tail protein	A0A2H4JG54	uncultured_Caudovirales_phage	1.7e-60	78.3
WP_069084194.1\|3489504_3490512_+	phage late control D family protein	A0A2H4JAV0	uncultured_Caudovirales_phage	2.6e-107	60.2
WP_069084195.1\|3490805_3491048_+	hypothetical protein	NA	NA	NA	NA
WP_145928312.1\|3491249_3491408_+	type II toxin-antitoxin system MqsR family toxin	NA	NA	NA	NA
WP_096368068.1\|3491489_3491843_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	3.5e-14	37.3
WP_083245827.1\|3491862_3493362_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.0e-83	37.9
WP_083245907.1\|3493431_3493557_+	type II toxin-antitoxin system MqsR family toxin	NA	NA	NA	NA
WP_069084196.1\|3493559_3493964_+	type II toxin-antitoxin system MqsA family antitoxin	NA	NA	NA	NA
WP_069084197.1\|3494140_3495049_-	DUF2806 domain-containing protein	NA	NA	NA	NA
WP_083245908.1\|3495096_3495585_-	GIY-YIG nuclease family protein	A0A088F856	Sulfitobacter_phage	3.9e-08	43.7
WP_145928313.1\|3495636_3496203_-	hypothetical protein	NA	NA	NA	NA
WP_069084200.1\|3496199_3497129_-	hypothetical protein	NA	NA	NA	NA
WP_069084201.1\|3497171_3497573_-	hypothetical protein	NA	NA	NA	NA
WP_069084202.1\|3497640_3498006_-	helix-turn-helix transcriptional regulator	A0A2H4JFL3	uncultured_Caudovirales_phage	2.4e-18	45.0
WP_069084203.1\|3498090_3498330_+	DNA-binding protein	A0A2H4JE67	uncultured_Caudovirales_phage	1.7e-09	54.5
WP_069084204.1\|3498342_3498531_+	hypothetical protein	E5E3U0	Burkholderia_phage	9.1e-14	69.2
WP_069084205.1\|3498559_3498742_+	hypothetical protein	A4PE59	Ralstonia_virus	1.0e-06	52.6
WP_069084206.1\|3498793_3499063_+	hypothetical protein	NA	NA	NA	NA
WP_069084207.1\|3499067_3499355_+	ogr/Delta-like zinc finger family protein	Q9ZXJ1	Pseudomonas_virus	4.3e-15	49.5
WP_069084208.1\|3499357_3499720_+	hypothetical protein	NA	NA	NA	NA
WP_069084209.1\|3499783_3500026_+	hypothetical protein	NA	NA	NA	NA
WP_069084210.1\|3500022_3502821_+	toprim domain-containing protein	A0A2H4J936	uncultured_Caudovirales_phage	0.0e+00	65.7
WP_069084211.1\|3502840_3503113_+	pyocin activator PrtN family protein	A0A2K8HN48	Pseudomonas_phage	2.2e-29	71.3
WP_069084212.1\|3503105_3503732_-	hypothetical protein	NA	NA	NA	NA
WP_069084213.1\|3503773_3504895_-\|integrase	site-specific integrase	A0A2K8I325	Pseudomonas_phage	1.0e-152	70.8
WP_083245909.1\|3505002_3506013_+\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
3505886:3505900	attR	NA	NA	NA	NA

DBSCAN-SWA_6

3531673 : 3603523

uncultured_Caudovirales_phage(18.18%)

integrase,holin,transposase

attL 3531347:3531370|attR 3598935:3598958

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3531347:3531370	attL	NA	NA	NA	NA
WP_069084235.1\|3531673_3532645_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_069084236.1\|3532702_3533638_+	restriction endonuclease	NA	NA	NA	NA
WP_083245914.1\|3533672_3534068_+	hypothetical protein	NA	NA	NA	NA
WP_069084238.1\|3534412_3536113_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_069084239.1\|3536105_3537185_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.4e-27	33.3
WP_069084240.1\|3537206_3538313_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_069084241.1\|3538854_3539961_-	mandelate racemase/muconate lactonizing enzyme family protein	NA	NA	NA	NA
WP_069084242.1\|3540330_3541002_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_069084243.1\|3541112_3543230_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.2e-42	42.1
WP_069084244.1\|3543308_3544892_-	aldehyde dehydrogenase (NADP(+))	NA	NA	NA	NA
WP_069084245.1\|3545494_3546496_-	Ldh family oxidoreductase	NA	NA	NA	NA
WP_069084246.1\|3546573_3548259_-\|holin	choline dehydrogenase	A0A1V0S9J5	Catovirus	1.1e-52	29.6
WP_069084247.1\|3548273_3549773_-	aldehyde dehydrogenase	NA	NA	NA	NA
WP_069084248.1\|3550214_3551363_+	MFS transporter	NA	NA	NA	NA
WP_145928316.1\|3551428_3552163_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_177343837.1\|3552265_3554035_-	DUF521 domain-containing protein	NA	NA	NA	NA
WP_083245916.1\|3554184_3555684_-	APC family permease	NA	NA	NA	NA
WP_069084250.1\|3556127_3557756_-\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	8.7e-52	30.1
WP_161490977.1\|3557846_3559352_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_069084252.1\|3559706_3560486_-	ABC transporter permease	NA	NA	NA	NA
WP_069084253.1\|3560482_3561415_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.7e-23	26.1
WP_069084254.1\|3561561_3563205_-	acetolactate synthase large subunit	NA	NA	NA	NA
WP_083245917.1\|3563760_3564177_+	LysE family transporter	NA	NA	NA	NA
WP_069084257.1\|3565429_3565786_+	DNA binding protein	NA	NA	NA	NA
WP_177343838.1\|3565871_3566042_-	hypothetical protein	NA	NA	NA	NA
WP_083246063.1\|3566411_3567173_-	SEC-C domain-containing protein	NA	NA	NA	NA
WP_145928318.1\|3568811_3569396_-	hypothetical protein	NA	NA	NA	NA
WP_069084260.1\|3569462_3570206_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	1.3e-50	44.7
WP_069084261.1\|3570202_3571753_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	1.5e-90	39.1
WP_069084262.1\|3571961_3572288_-	hypothetical protein	NA	NA	NA	NA
WP_069084263.1\|3572444_3573452_+	hypothetical protein	NA	NA	NA	NA
WP_083245919.1\|3573835_3577114_-	hypothetical protein	A0A2H4JEI4	uncultured_Caudovirales_phage	2.5e-18	36.5
WP_145928319.1\|3577114_3577630_-	hypothetical protein	NA	NA	NA	NA
WP_069084265.1\|3577633_3579049_-	HlyD family type I secretion periplasmic adaptor subunit	NA	NA	NA	NA
WP_069084266.1\|3579045_3581196_-	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	1.2e-45	29.3
WP_069084267.1\|3581624_3582167_-	hypothetical protein	NA	NA	NA	NA
WP_069084268.1\|3582570_3588603_-	ATP-binding protein	NA	NA	NA	NA
WP_069084269.1\|3588595_3589270_-	hypothetical protein	NA	NA	NA	NA
WP_069084270.1\|3589517_3589997_+	hypothetical protein	NA	NA	NA	NA
WP_069084271.1\|3590024_3590831_+	TIGR02391 family protein	A0A1S5SBU1	Streptococcus_phage	1.3e-35	34.9
WP_083245920.1\|3590950_3593518_-	AAA family ATPase	NA	NA	NA	NA
WP_069084272.1\|3593644_3593962_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_069084273.1\|3593958_3594294_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_069084274.1\|3594355_3595903_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	3.5e-119	50.3
WP_069084275.1\|3596146_3596851_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_069084276.1\|3596843_3597101_-	thioredoxin family protein	NA	NA	NA	NA
WP_069084277.1\|3597097_3597520_-	heavy metal-responsive transcriptional regulator	NA	NA	NA	NA
WP_069084278.1\|3597524_3597788_-	thioredoxin family protein	NA	NA	NA	NA
WP_069084279.1\|3598811_3599519_+	DNA-binding protein	NA	NA	NA	NA
3598935:3598958	attR	NA	NA	NA	NA
WP_145928320.1\|3599519_3600611_-	hypothetical protein	NA	NA	NA	NA
WP_069084281.1\|3600933_3601608_+	hypothetical protein	NA	NA	NA	NA
WP_145928321.1\|3601600_3603523_+\|transposase	transposase family protein	NA	NA	NA	NA

DBSCAN-SWA_7

3760819 : 3811261

Pseudomonas_phage(22.22%)

integrase,tRNA,transposase

attL 3801463:3801514|attR 3811358:3811409

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_145928262.1\|3760819_3762022_-\|transposase	ISL3 family transposase	A9YX10	Burkholderia_phage	2.6e-109	53.2
WP_069084403.1\|3762162_3763344_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_069084404.1\|3763386_3764589_-	3-oxoadipyl-CoA thiolase	NA	NA	NA	NA
WP_069084405.1\|3764585_3766106_-	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
WP_069084406.1\|3766116_3767046_-	hypothetical protein	NA	NA	NA	NA
WP_069084407.1\|3767047_3767797_-	electron transfer flavoprotein subunit beta/FixA family protein	NA	NA	NA	NA
WP_069084408.1\|3767827_3768970_-	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_069084409.1\|3768979_3770176_-	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_069084410.1\|3770211_3771090_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_069084411.1\|3771155_3771932_-	enoyl-CoA hydratase	NA	NA	NA	NA
WP_069084412.1\|3772108_3773776_+	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	9.5e-38	29.0
WP_069084413.1\|3773810_3774578_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_069084414.1\|3774608_3775391_+	2-ketocyclohexanecarboxyl-CoA hydrolase	NA	NA	NA	NA
WP_069084415.1\|3775463_3776603_+	cyclohexanecarboxyl-CoA dehydrogenase	NA	NA	NA	NA
WP_069084416.1\|3776643_3777135_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_069084417.1\|3777249_3778008_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.6e-11	26.6
WP_069084418.1\|3778000_3778723_+	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	2.2e-07	24.5
WP_069084419.1\|3778828_3780040_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_069084420.1\|3780098_3780983_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_145928328.1\|3780979_3781963_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_069084422.1\|3782220_3783483_+	OprD family porin	NA	NA	NA	NA
WP_069084423.1\|3784202_3784811_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_069084424.1\|3785006_3786443_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_069084425.1\|3786800_3787556_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	1.6e-72	54.3
WP_069084426.1\|3787573_3789088_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	7.3e-146	53.2
WP_083246067.1\|3789285_3790749_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_069084427.1\|3790741_3791542_+	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	4.0e-34	36.8
WP_069084428.1\|3792376_3793576_+\|integrase	tyrosine-type recombinase/integrase	A0A059VF45	Pseudomonas_phage	3.2e-160	70.6
WP_016493505.1\|3793811_3794168_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_003282572.1\|3794148_3794451_-	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	1.4e-11	38.9
WP_069084429.1\|3794454_3796833_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_069084430.1\|3797010_3798027_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	2.7e-27	37.3
WP_069084431.1\|3798121_3798478_-	50S ribosomal protein L20	NA	NA	NA	NA
WP_069084432.1\|3798507_3798702_-	50S ribosomal protein L35	NA	NA	NA	NA
WP_177343860.1\|3798763_3799315_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	3.5e-13	34.7
WP_069084434.1\|3799314_3801237_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	1.8e-128	38.3
3801463:3801514	attL	NA	NA	NA	NA
WP_069084435.1\|3801821_3802088_-	hypothetical protein	A0A0U4JX18	Pseudomonas_phage	5.2e-23	61.4
WP_145928329.1\|3803170_3803851_+	hypothetical protein	NA	NA	NA	NA
WP_069084437.1\|3803968_3804235_-	hypothetical protein	A0A2H4J8E9	uncultured_Caudovirales_phage	1.1e-20	62.5
WP_069084438.1\|3804231_3804636_-	hypothetical protein	J7HXL1	Pseudomonas_phage	8.8e-14	58.3
WP_145928330.1\|3804669_3804972_+	hypothetical protein	NA	NA	NA	NA
WP_069084440.1\|3804974_3805478_+	hypothetical protein	NA	NA	NA	NA
WP_069084441.1\|3805465_3805717_+	hypothetical protein	A0A0U1UNR9	Pseudomonas_phage	2.0e-08	67.3
WP_069084442.1\|3805713_3806109_-	hypothetical protein	NA	NA	NA	NA
WP_069084443.1\|3806523_3806724_+	hypothetical protein	NA	NA	NA	NA
WP_069084444.1\|3806720_3806960_+	hypothetical protein	NA	NA	NA	NA
WP_069084446.1\|3807256_3808180_+	DNA cytosine methyltransferase	H6WSH6	Mycobacterium_phage	1.8e-22	37.5
WP_069084447.1\|3808176_3808410_-	hypothetical protein	NA	NA	NA	NA
WP_069084448.1\|3808508_3808715_-	hypothetical protein	NA	NA	NA	NA
WP_069084449.1\|3808963_3809632_-	DUF2971 domain-containing protein	NA	NA	NA	NA
WP_069084450.1\|3809729_3810023_-	hypothetical protein	NA	NA	NA	NA
WP_069084451.1\|3810145_3810385_-	hypothetical protein	NA	NA	NA	NA
WP_083246068.1\|3810832_3811261_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4J1K3	uncultured_Caudovirales_phage	3.6e-42	72.5
3811358:3811409	attR	NA	NA	NA	NA

DBSCAN-SWA_8

5855672 : 5862603

Pseudomonas_phage(66.67%)

integrase

attL 5855475:5855492|attR 5863908:5863925

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5855475:5855492	attL	NA	NA	NA	NA
WP_069086079.1\|5855672_5856896_+\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A1B0VMI6	Pseudomonas_phage	4.1e-171	75.1
WP_069086080.1\|5856980_5857697_+	hypothetical protein	NA	NA	NA	NA
WP_069086081.1\|5857760_5857979_+	AlpA family phage regulatory protein	A0A2H4J8C8	uncultured_Caudovirales_phage	1.1e-05	43.4
WP_083246020.1\|5857979_5858336_+	hypothetical protein	A0A1B0VRK7	Pseudomonas_phage	5.0e-29	64.6
WP_069086082.1\|5858470_5859343_+	toprim domain-containing protein	A0A1B0VML8	Pseudomonas_phage	1.4e-77	52.1
WP_069086083.1\|5859339_5861091_+	DUF927 domain-containing protein	A0A1B0VP75	Pseudomonas_phage	4.9e-109	40.8
WP_145928395.1\|5861637_5862603_+	hypothetical protein	A0A1S6KZY1	Salmonella_phage	5.7e-27	40.6
5863908:5863925	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage