CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP016631	Lactiplantibacillus plantarum strain LY-78 plasmid pLY7801, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP015308	Lactiplantibacillus plantarum strain LY-78 chromosome, complete genome	3 crisprs	DinG,DEDDh,cas3,csa3,cas2,cas1,cas9,WYL	0	17	6	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015308_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015308_1

192033-192334

Orphan

Consensus_repeat	Method
GCTACTGCTAAGGCTCAAAGTACAGCTGACAATGCGTTTAGCCAAGC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP015308_1

>merge|NZ_CP015308|1|192033-192334|CRISPRCasFinder
AAGATTATCAATGCTCAAAATACGGCTGATAATGCGGCTAGTCAAGCAGGAAATGCTGATAGCGCTGCTTTAATTGCACAGTCTACAGCGAATGCCGCTAAATCAGCCGCAGATAGCAATTACAACTACGCCAATTCAGAAATAGCCGTCCAGTCTAATGCTACTGCTAAGGCTCAAAGTACAGCTGACAATGCGTTTAGCCAAGCTCAGGCAGTTGGTAGCCAAGCTAGTGCTGGGATAAGCAACAACTCTACAGCTACTGCTAAGGCTCAAAGTACAGCTGATAATGCGTTTAGCCAAGC

>NZ_CP015308|1|1|192033-192334|CRISPRCasFinder
AAGATTATCAATGCTCAAAATACGGCTGATAATGCGGCTAGTCAAGC	AGGAAATGCTGATAGCGCTGCTTTAATTGCACAGTCTACAGCGAATGCCGCTAAATCAGCCGCAGATAGCAATTACAACTACGCCAATTCAGAAATAGCCGTCCAGTCTAAT
GCTACTGCTAAGGCTCAAAGTACAGCTGACAATGCGTTTAGCCAAGC	TCAGGCAGTTGGTAGCCAAGCTAGTGCTGGGATAAGCAACAACTCTACA
GCTACTGCTAAGGCTCAAAGTACAGCTGATAATGCGTTTAGCCAAGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015308.1\|WP_069137375.1\|196476_197592_+\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|119382
NZ_CP015308.1\|WP_069137033.1\|194742_194994_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015308.1\|WP_069137028.1\|183128_183314_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015308.1\|WP_053338923.1\|202946_203738_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224041
NZ_CP015308.1\|WP_069137034.1\|195142_196171_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015308.1\|WP_069137031.1\|189613_191992_+\|phage-tail-protein	unknown	unknown	gnl\|CDD\|377677
NZ_CP015308.1\|WP_069137021.1\|178464_179070_+\|HK97-family-phage-prohead-protease	unknown	unknown	gnl\|CDD\|309640
NZ_CP015308.1\|WP_069137029.1\|183345_187704_+\|C40-family-peptidase	unknown	unknown	gnl\|CDD\|381605
NZ_CP015308.1\|WP_069137027.1\|181980_182634_+\|phage-tail-protein	unknown	unknown	gnl\|CDD\|309671
NZ_CP015308.1\|WP_069137024.1\|180827_181175_+\|phage-head-closure-protein	unknown	unknown	gnl\|CDD\|377521
NZ_CP015308.1\|WP_069137026.1\|181584_181965_+\|DUF806-family-protein	unknown	unknown	gnl\|CDD\|368546
NZ_CP015308.1\|WP_069137025.1\|181177_181585_+\|HK97-gp10-family-phage-protein	unknown	unknown	gnl\|CDD\|273775
NZ_CP015308.1\|WP_069137030.1\|187777_189547_+\|phage-tail-family-protein	unknown	unknown	gnl\|CDD\|368574
NZ_CP015308.1\|WP_063488422.1\|182709_183084_+\|phage-tail-assembly-chaperone	unknown	unknown	gnl\|CDD\|311073
NZ_CP015308.1\|WP_187337693.1\|194997_195159_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015308.1\|WP_069137036.1\|197875_198253_+\|holin	unknown	unknown	gnl\|CDD\|377377
NZ_CP015308.1\|WP_003644508.1\|199496_200708_+\|FtsW/RodA/SpoVE-family-cell-cycle-protein	unknown	unknown	gnl\|CDD\|223843
NZ_CP015308.1\|WP_069137035.1\|197592_197889_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015308.1\|WP_003644505.1\|203718_204903_+\|LCP-family-protein	unknown	unknown	gnl\|CDD\|224235
NZ_CP015308.1\|WP_003645636.1\|205054_205627_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP015308.1\|WP_069137375.1\|196476_197592_+\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|119382	cd06522, GH25_AtlA-like, AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.	1.92404e-70
NZ_CP015308.1\|WP_053338923.1\|202946_203738_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224041	COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism].	2.63777e-96
NZ_CP015308.1\|WP_069137031.1\|189613_191992_+\|phage-tail-protein	gnl\|CDD\|377677	pfam06605, Prophage_tail, Prophage endopeptidase tail. This family is of prophage tail proteins that are probably acting as endopeptidases.	6.18724e-13
NZ_CP015308.1\|WP_069137021.1\|178464_179070_+\|HK97-family-phage-prohead-protease	gnl\|CDD\|309640	pfam04586, Peptidase_S78, Caudovirus prohead serine protease. Family of Caudovirus prohead serine proteases also found in a number of bacteria possibly as the result of horizontal transfer.	2.61627e-47
NZ_CP015308.1\|WP_069137029.1\|183345_187704_+\|C40-family-peptidase	gnl\|CDD\|381605	cd13402, LT_TF-like, lytic transglycosylase-like domain of tail fiber-like proteins and similar domains. These tail fiber-like proteins are multi-domain proteins that include a lytic transglycosylase (LT) domain. Members of the LT family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, and the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL). LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.	2.37038e-44
NZ_CP015308.1\|WP_063488422.1\|182709_183084_+\|phage-tail-assembly-chaperone	gnl\|CDD\|311073	pfam06896, Phage_TAC_3, Phage tail assembly chaperone proteins, TAC. This is a family of phage tail tube assembly chaperone proteins from some Siphoviridae viruses.	1.04977e-32
NZ_CP015308.1\|WP_069137024.1\|180827_181175_+\|phage-head-closure-protein	gnl\|CDD\|377521	pfam05521, Phage_H_T_join, Phage head-tail joining protein.	8.77216e-11
NZ_CP015308.1\|WP_069137026.1\|181584_181965_+\|DUF806-family-protein	gnl\|CDD\|368546	pfam05657, DUF806, Protein of unknown function (DUF806). This family consists of several Siphovirus and Lactococcus proteins of unknown function. The viral sequences are thought to be tail component proteins.	1.76695e-55
NZ_CP015308.1\|WP_069137025.1\|181177_181585_+\|HK97-gp10-family-phage-protein	gnl\|CDD\|273775	TIGR01725, hypothetical_protein, phage protein, HK97 gp10 family. This model represents an uncharacterized, highly divergent bacteriophage family. The family includes gp10 from HK022 and HK97. It appears related to TIGR01635, a phage morphogenesis family believed to be involved in tail completion. [Mobile and extrachromosomal element functions, Prophage functions].	6.40949e-06
NZ_CP015308.1\|WP_069137030.1\|187777_189547_+\|phage-tail-family-protein	gnl\|CDD\|368574	pfam05709, Sipho_tail, Phage tail protein. This family consists of several Siphovirus and other phage tail component proteins as well as some bacterial proteins of unknown function.	7.40278e-06
NZ_CP015308.1\|WP_069137027.1\|181980_182634_+\|phage-tail-protein	gnl\|CDD\|309671	pfam04630, Phage_TTP_1, Phage tail tube protein. This is a family of phage tail tube proteins from Myoviridae.	1.36566e-75
NZ_CP015308.1\|WP_003644505.1\|203718_204903_+\|LCP-family-protein	gnl\|CDD\|224235	COG1316, LytR, Transcriptional regulator [Transcription].	8.65168e-43
NZ_CP015308.1\|WP_069137036.1\|197875_198253_+\|holin	gnl\|CDD\|377377	pfam04531, Phage_holin_1, Bacteriophage holin. This family of holins is found in several staphylococcal and streptococcal bacteriophages. Holins are a diverse family of proteins that cause bacterial membrane lysis during late-protein synthesis. It is thought that the temporal precision of holin-mediated lysis may occur through the buildup of a holin oligomer which causes the lysis.	1.47137e-07
NZ_CP015308.1\|WP_003644508.1\|199496_200708_+\|FtsW/RodA/SpoVE-family-cell-cycle-protein	gnl\|CDD\|223843	COG0772, FtsW, Bacterial cell division membrane protein [Cell division and chromosome partitioning].	2.11917e-75

>NZ_CP015308.1|WP_069137031.1|189613_191992_+|phage-tail-protein
MALNNQYLILDPNLKRIGTLTVDGATKFSNDSVKIQLADADTTSTSYDDDVNVGTKDSYTGTINLNAQSKKFDHQGQLDVIQGQPDSDKVVAGNNLAYYDALSGHWYVMRIYSVEESNTAAVKHVTTANFTNLCLYNLAHHYPVAITASDSSIQTAFNQCFNATGWTLDYQTTNVMTPSIDIDGKTKASTLLQTLIQTYDVEIDPYVEIDSQGNITKKVCVITDQLNANVVYNEAIFGKNMTSLKRTTVSNPITKLIPYGANGNTIGLVNDGKSYIVDDEANQTYNPDWQSGLYYEGVVTANSIEDPAGLKAWAEEMLQLYNHPRTYYEVNVTSKFNPPLGATIRFKDELIKPALDASGRVIQRTISFANPYGNTVGFGEYVTVPVATPAWMQGYQSAINSAIEKAKEDASSVKPVALTPDGNNFTDTTQTKRLILQAWEGNTNISAYIDNKGFIWHRYNTDGTLDTSFNQTGYLIQAPYSAVGTLRGTIETSYIQNEPEIKLETSAIRSLGSFNPDDSALGITDAAQYMCPLSNGQYITSRAVNQSTTGDVMFVLHDTNFNPISKMIVSHGGHGSSFSIEEADGAIYIWSATKPNLNVNEYAISRIPYIANTTLDNDDNRITRFCTVNRYIRVSVDFKHGYVLCGYDNGKHDVLRLDEIKQGNYNVLYSFNVANYGFDWNRQTYQSQGIDFPYVYFHSGGYNMKDPRMVYAVNVVHGGQEFASNYLLDMNLGLTDDVIEPETCNIIYSQTNQPELLVTFNCKYQGDYLQRVFVIPIEERLPMTKKGDELSG
>NZ_CP015308.1|WP_069137030.1|187777_189547_+|phage-tail-family-protein
MTLQRDDFEYAGLNSRDDLQVEMGNVVLPSAPAMAEQATDIPAMYGNQFNGTDFTSRTISIPVSIYCADNQDRFNQVMHNLSGLLLSDDPSDNGKEYPLVFGFEPKVTYWGHITAISDPTPINTGMYDMTLTITFVQSDPRATLPQVEKPLNNGLNTITVDGTARTEPVIQVIPKRDLKYIGFSLNGGQFGLGPESPGDQATAVQPYTKVVDDPLGTMAMWTNDANAIGNMKTGETYTYQGHSAIKTSTNVMRPGVNSNGYDFGPIPTTGEDRWYGPAYRYTGMTQSLTDWRVRTGIHQFKYSGTHNGRAMGRVEVLLLDPNGNTIGRFGMRDMAYGAKPIARLQICEPGSTLEYGDRYTDLYYGSGPAGSFTNKPDQKIQIKTGTTTKTVTKYGRSRNGKVTKRTVKETVDTYTTVVNKEEDSALAGAWPILDITKRGQVFTWSITQYSTRTGRPFLDPNIHMLVHGTYVDTQNKYQTALGGIGSVFLKHPITEDSYKIAYRNPFMSMTDLQIWQVNKVDPTKPTYIANAGEEIVMDCESDTVTVNGKLVSPVWSTDFPKLKPGVNGLSMIGDLDDAQMTLKYLPRIL
>NZ_CP015308.1|WP_069137029.1|183345_187704_+|C40-family-peptidase
MAKKVVAGEMTGRVNLDSTEAVKSLKQLTAEVKASTSGWKAQEVALNSAGKYQEATAAKVDGLAKSMELQKSKIDELKKRQSGLNQDTKDGALEYTKLTDEINKANRSYDSMGGQLDRAKNRLQYYNSGLADLQKGYKQSTALSESYVKRLEAEGKQEDANKARLSGLKQAYSNIQAQYKTQSDELDKIRKASGDTSDAYKRQQVRVNETATSMAKLKSETNELDSAMNKAKPTAFTRMLDSAKSKLGLVRDEEKKTNNETKHFALGYVIGNTISNAASSAVGYIKNVTEQGYKLAEAGGTIKKQWTNLGLSDSEATKMTKQIGDIRSKANMSGGAIDQMQKKFYAMTNSTTKARAMTEVLASYGSAAGKSGDQIAQLSQGVAKLSGSAKVTASLFKRNFGQVPELQKAIVKASGMSTSAFNKQLAAGKITGSQLQGYMVKAAKTSGKAWSEFGETTKGKMAAIQGTYTNLKVAFAKPLVSGVEKAIDGVSKKKGALDGVKKSLTGLVGTLGKKTGQYVGDVISFLVKNEKPIEKTGGAIASIVGSLAKGVWSAIAGTLKLIGGHSKDASKGMNGVADATAKIAKHKTAIENVGKAIMVYLAVSKLKGIVSTISGVAGGIGKVIGTMTRLAKSEKLATAAQWLFNAAMDANPIGIAVIAIAALTAGLVLAYKHIKPFREWVNKTAKAVINFGKGIAKWGANVGKSVGKALGNMGKKWNGFKKSFKKSWNKHWSDAGKNLKGAWNGSLKHTREFFSSVGKKWDGWKSSFKKSWSHSWNNHWDTMRSNLHSYWNKDLSHTKVFGKSMGGWLSTFKTSFSKGWSSLGTGVRNIFKGLWKDLKGFAKDGINDVIDLINGGINAVDAVIHTFGGKKKTIADLSHVHFAEGTGMFSGQRKPITRPTMAMLNDGNDSPETGNKEMVMLPNGDSGIVQGRNTKMMLPAGTEVLNASETAMLMSMQGVTKYANGTGVGGFFGDILNSVTSGISGVTSWVSKKVGSLEKFFKTAENIIAHPIKSLENLFSWSSKGVSGVMSNIGHGLFNGVEKQAKTWWSTLWGGVSDSLDSGASSSTLVNAMEKYGSTNKYVYGAEGPSAFDCSGLVEYTLKKLGISFPRTSGEQYKASKHVSNPKPGDLVFFGPGGSDHVGVYTGNGEFYSAENEKDGMGISKVHGGGYGSFAGYGRVPGLSDSDSSDKSSKSSGLLGTIKKQVGSGFWKFISKLADEFGDRGSSNPGGSGVQRWKPDVIKALKKNGFEASASQVSAWMKVIARESNGDPSVVNNWDSNAKMGMPSMGLVQTIRPTFEAYKFPGHNNPLNGYDDLLAGIHYMKAKYGSGASAFARVSGPEGYENGGIINTNQLIEVAEHNKPEMVLPLTNKSRANQLIAQASQVVNGNNGSQIASTNSESNEKLDKLISLMSAILGNMGSVQAVIAKSDVVNAVKSDNKTASQYSQMMGY
>NZ_CP015308.1|WP_069137028.1|183128_183314_+|hypothetical-protein
MKNQQEDFNLLAQQLLTEGLSPKDFDDSSFFSLMETLNARKKEDRAELVDPLEAINQTYGL
>NZ_CP015308.1|WP_063488422.1|182709_183084_+|phage-tail-assembly-chaperone
MKINAKNYFKINKTADVTPTNNIIRLATKVQIGMLESQDTEKEVTELDAMKNGLELQDKMTNFVQRVMGYTDKQMETINDTISIERFGEGVGYLIMRLNGISDDDIKLSEQKQRKAIEDAKSSK
>NZ_CP015308.1|WP_069137027.1|181980_182634_+|phage-tail-protein
MSKHNIVKATFALLDDNGDLIKDPTKGLSADGIYVADHNGEGFSQINVTAIEAAGVAGWGNGQIKRVSYGKSMPTLALTALDLDFRINQMLKGYTQSANTGAWVRQLPKPHVAMITESQSLDGDISIYECFNNIEFVEEGSNNGTDTNSQVAYSTVLNGSVLAPLKPNIFLAANGVQQPYMIAKSTDTGFDLNKLMAETFGGYTPSTGGTTGGTTTH
>NZ_CP015308.1|WP_069137026.1|181584_181965_+|DUF806-family-protein
MLLPVSQVSSLVNALNLTWVDKVYLNEIPNEDLDNTTSTVILLQETDSSPAYLANSTFKGLAMGVEIQIFYKVNLEDDFNPLEAEIALMKALKQAGWLIVSSQHHTTDPDTNQVTKTIYVTKNEML
>NZ_CP015308.1|WP_069137025.1|181177_181585_+|HK97-gp10-family-phage-protein
MANDDMAGQLESWLKNVHKLVPDESEQEKITAAGAKKLADNLTEATKNKHYSSHKDKKYGHMADNISYNSNDIDGEHDGSSIVGWTNKFHDMNARRLNDGTKYIKADHFVDDNLADSQDDVFNAMLDEYKKGDDD
>NZ_CP015308.1|WP_069137024.1|180827_181175_+|phage-head-closure-protein
MALNKFTPASFNRKLQIGTTKTVQNPINGTSKQTFVVTASLWCAPYTRSIASSYQLTAEQLEQVVVVIRHNSTVKEGIKCQYQGDLYSVVNDSMDDSNSYLTYDYLTLKLVTKGA
>NZ_CP015308.1|WP_069137021.1|178464_179070_+|HK97-family-phage-prohead-protease
MELSATKIHNDENVRSIYIQDLKTRDLSSDGTTAIGQVSGYAVVFGKPSEDMGFTEYISPDAFNGVNMNSVIALYDHNLDNILGRVDSGSLELKVDQNGVLFTLNMPNTTLGRDVYENIKNGNLKGCSFGFTIADDDWEFDNSDNVIHTVNQIDQLVEISITALPAYTQTSVSVSRGLKQFNNDQQYRLKAGFWLDLLEKE
>NZ_CP015308.1|WP_069137033.1|194742_194994_+|hypothetical-protein
MDSILITNYKPDYTNNIMTISIQINTLGISSQVSITMDDFNTAIAGGAGGTDRVKLKVLNTLIDSLTALKPVTTTTTTTTKEA
>NZ_CP015308.1|WP_187337693.1|194997_195159_+|hypothetical-protein
MNIDAQALINKLTSNYAQAIAVKEQQLAMAQVQIDQLNAKLAEKEAPKDGENA
>NZ_CP015308.1|WP_069137034.1|195142_196171_+|hypothetical-protein
MAKTLSFTDTSPQTVKIGDTTTSFTLICGNDNVATDLTKATSITVKLGNNSGYLKSATVDPTSLTDPTTGQVTVNFNADLMTSLTAGSYAIEVWVVDPTGTSIYPSDGSTGFTIANNIQSANGSTITTITFDDFVKELNKAASTIAKGDKGDTGTVDNTGLISAPAFQSLQTQVNNSAVGTNLLTGTGYHTVTGSNAYGYLSNETTDDLLVLFKGLEGQAVTVSVDYEYSGFIAGSSSNRIGWETAIEADTTTHSGPWYYPNNDSGSGRMSSTFVVPKNITKVWSAMGYIQFSGSGTGALSHLKLEKGSVATDWCPNPAEILTQSDYAKIKAAIVALGGALS
>NZ_CP015308.1|WP_069137375.1|196476_197592_+|LysM-peptidoglycan-binding-domain-containing-protein
MAFLMVNVTSQAARMDMVDVSNNNGYMSTTEYVSMRNEFGVKALTVKISEGTTFKDGYAASNIANGQAAGLYVNGYHFAHYKTKAQAIAKADFAGQAAKAARLPVGAVLATDVESAEEQGILSQAANDRNNAAFMKEIQKFGYRADIYTSGSWANNKMTIKGKTGWVAGYPYVMSGQKWYTNNNAWQWSGAARFRISYGGFDVSQLYTDYYTAGQKSTVKPTDPNAVNDNNQEANKNTSKPSNSVKWVKESKNYTLKTAVKLRTGTSTASSVIAILPAGTTVKTDQAIIQNGYRWVRQPRFNGYGYLATGPASNTLEYVKSGATHTYYTVKSGDSWWAIAQRNSLSMTTLASQNGKTIYTTIYPGQRLVVR
>NZ_CP015308.1|WP_069137035.1|197592_197889_+|hypothetical-protein
MHTLLGLGWDEWGSIVAIVTSICVLANWILNKTVRIPLNNLGKRLSRFTDESLKVRQQNAEAMNAIENRVIKVEDRLDGHDIEFKHLYEKEAKGNEKN
>NZ_CP015308.1|WP_069137036.1|197875_198253_+|holin
MKKISFKNADGSLNGKLIAGIISLLIVLIQQVLAVFGIKFAGDWSAIVAVINTVLTILGMLGVITDVQTVTAPTVKSDEESQIEATANQTADELQAPTSTVAVVNSSASSDTETASESASQAGEK
>NZ_CP015308.1|WP_003644508.1|199496_200708_+|FtsW/RodA/SpoVE-family-cell-cycle-protein
MNNRELGRWQEHKHIGDYGWGIILCVIILCCIGMWAVYYACLHDLKVIDPVRTTMMQCLWYLVGALIATTMLHLSEKQLMQWAPIGYSIGMLLLILLLVFYSREYYVQTGAKSWFAIGTLTFQPVEVMKPLYILMMGRLIVQDQQWGPHNNFNADWRLTRRLVIYTFPIIVALKIINDFGTTLVFLTIFIGMLIVSPCRFSFLWRVLLVAGSIGVVLILLATSSTGQSLLSHIGFKLYQFDRINTWLNPSNGVSDQSYQLWQSMRAVGVGGLTGNGVTHNAVYVPVRESDMIFSVVGETTGFIGCSVLLIVYMYLFYLIFRSAFASRRRFYVYVSTGVAVMLAFHMFENIGMTIGLLPLTGIPLPFVSQGGSAIIGDFMGVGLVLATQYPNVRSIFSVPRIFH
>NZ_CP015308.1|WP_053338923.1|202946_203738_+|ABC-transporter-ATP-binding-protein
MKKAVLLDVDHVSKSFILSKQRQSELILEAVSLQVQTHQFISIIGSSGVGKSTLLRMIAGIIRPSYGAITFDGNLVTAPNRRMSMVFQNFALFPWLTVRQNIMFGLESQLNSDCQYVDNQIDNLINLIGLKGLKNAYPYELSGGMKQRVGFARALAVEPELLLLDEPFSALDVLTGQRLGQDLITLWERRKFKMQAIVLITHNISEAVRLSDVIYVLGGKPAQIMNTYQIKTPRNQRTEQQIRAKTMAITDQFKRDMNEMRGD
>NZ_CP015308.1|WP_003644505.1|203718_204903_+|LCP-family-protein
MKCGGTEFMRRRQLPKWQRKRLIVLVTSCITFMLVAFTIQGIRLFDMLHSFHESRVIKSHHNLTQQPVSTFLLMGLDNSGKRKLSTTRTDGMMVVIVNHKTKTMTLCSLLRDTFVKIHSQQYHGYQRIESAYTYGGDAAAIATVEHYLNLPIDYYLTVNWDGFIRAIDDIGPVEVNVDRDFIGQDYWGKPEKFKAGLQSMSGARALAYARERHIDNDQHRGFRQQAVFYAMVKRLNQEGLSSKGAKVVGDLKDQMRTNLTNHDMLTLFKSRKTFKRYRVKRLTFQWRTFDVAGRSMVEVYPDSRVQVSRQLQAAAGLRPDLPSQTFTTNGHYRYASDESVESKADEAKADTHYGQSHVYVGHAGNTTIGKLPAAVPLKNGFRVSDRTETMYTVH
>NZ_CP015308.1|WP_003645636.1|205054_205627_+|helix-turn-helix-domain-containing-protein
MVTEKLAIILGLEKTNLTKSTCFKACGIARSTFIRCQNFYMQDGLEGLKEQHNWIRYISEIKRQAISAYLNDESSLWDIQIRFGLRSTRRLEDRISELLVHIMSRKITFEERIRIVEYITVSEHAYSRAAKHYNVSYQQIRFWMLKTTTNGYIALKDRLGWTKPIEKMTEVERLRLKKRQLKIQIKEQEV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015308_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015308_2

849119-854247

Orphan

Consensus_repeat	Method
GAATCNGANTCNCTNTCNGANTCNGANTCACTNTC	CRT

56 spacers

The CRISPR arrays of NZ_CP015308_2

>merge|NZ_CP015308|2|849119-854247|CRT
GAATCACTGTCTGAGTCCGAGTCACTGTCGGAATCCGAATCACTATCCGAGTCGGAATCACTGTCGGAATCCGAGTCGCTGTCGGAATCCGAATCGCTATCCGAATCCGAATCACTGTCCGAATCTGAGTCGCTGTCCGAATCCGAATCACTATCCGAGTCGGAATCACTGTCAGAGTCCGAATCGCTGTCAGAGTCCGAATCGCTGTCGGAATCCGAATCGCTGTCCGAATCCGAATCACTATCCGAGTCTGAATCGGAGTCACTATCGGAATCGCTGTCTGAGTCGGAATCACTATCCGAATCCGAGTCACTGTCGCTATCCGAATCACTGTCAGAGTCCGAATCGCTGTCAGAGTCCGAATCGCTGTCAGAGTCCGAATCGGAGTCACTATCGGAATCCGAGTCACTGTCGCTATCCGAATCACTGTCAGAGTCTGAGTCGCTGTCCGAGTCGGAATCGCTATCGGAATCCGAGTCGCTGTCGGAATCGGAATCACTGTCTGAGTCGGAATCACTATCGGAATCCGAATCGCTGTCGCTATCTGAGTCACTGTCGGAGTCTGAGTCTGAATCGGAATCACTGTCCGAATCGGAATCGCTATCAGAGTCGGAATCGGAGTCACTATCTGAGTCTGAGTCGCTGTCTGAGTCTGAATCGGAATCACTATCAGAGTCGGAGTCACTGTCGCTATCCGAATCACTGTCAGAATCGGAATCACTGTCTGAGTCGGAATCGCTGTCGGAATCACTATCAGAGTCGGAGTCACTGTCCGAATCGGAATCACTATCAGAGTCAGAATCACTATCGGAATCTGAGTCGCTGTCCGAATCACTATCCGAGTCCGAATCACTGTCAGTATCTGAGTCGCTATCGGAATCGGAATCGCTATCAGAGTCGGAATCGCTGTCGCTATCGGAATCACTATCCGAGTCCGAATCACTATCGGAATCCGAGTCACTATCCGAGTCGGAATCACTGTCTGAATCCGAATCACTATCCGAGTCGGAGTCACTGTCGGAATCAGAATCACTATCCGAGTCCGAATCGGAGTCGGAATCGCTGTCGGAATCTGAGTCACTGTCGCTGTCCGAGTCGGAATCGGAATCACTATCCGAATCCGAATCGCTGTCGGAATCGGAATCACTGTCTGAGTCGGAATCACTATCCGAGTCGGAGTCACTGTCGGAATCGGAATCGCTATCCGAATCCGAATCACTGTCGGAATCTGAGTCGCTGTCGGAATCAGAATCACTATCCGAGTCCGAATCGCTGTCGGAGTCTGAGTCGCTGTCGCTATCCGAATCACTGTCCGAATCGGAATCACTATCAGAGTCTGAATCGCTGTCGGAATCGGAATCACTGTCTGAGTCGGAATCACTATCGGAATCCGAATCGCTGTCGCTATCCGAATCACTGTCTGAGTCAGAATCACTATCAGAGTCTGAATCGCTGTCGGAATCGGAATCACTGTCTGAGTCGGAATCACTATCGGAATCCGAATCGCTGTCGCTATCCGAATCACTGTCTGAGTCAGAATCACTATCAGAGTCTGAGTCACTGTCGGAATCGGAGTCGCTATCCGAGTCTGAATCACTGTCAGAGTCTGAATCACTATCAGAGTCTGAGTCGCTGTCAGAATCGGAATCGCTGTCGCTATCTGAGTCACTGTCCGAGTCTGAGTCGCTGTCGCTATCCGAATCACTGTCAGAATCGGAATCGCTATCAGAGTCTGAATCGCTGTCGGAATCGGAGTCACTATCTGAGTCTGAATCGCTGTCGGAGTCTGAGTCGGAATCACTGTCAGAATCGGAATCACTGTCGCTATCCGAATCACTGTCAGAATCGGAATCACTATCTGAGTCTGAGTCACTGTCACTGTCCGAATCGGAATCACTGTCTGAGTCGGAATCGCTGTCGGAATCGGAGTCGCTATCAGAGTCGGAATCACTATCAGAGTCTGAGTCACTGTCGGAATCTGAATCACTATCAGAGTCAGAATCACTATCGGAATCGGAGTCACTGTCGGAGTCGGAATCACTATCAGAGTCAGAATCACTATCGGAATCGGAGTCACTGTCGGAGTCGGAATCACTGTCGCTATCTGAATCGCTGTCGGAATCCGAATCACTATCGGAATCGGAGTCGCTATCGGAGTCGGAATCACTGTCTGAGTCTGAGTCACTATCGGAATCGGAATCGCTATCAGAGTCTGAATCGCTGTCGCTATCTGAATCACTATCAGAGTCCGAATCACTGTCGGAATCCGAATCACTATCAGAGTCGGAGTCACTATCAGAGTCGGAATCACTGTCGCTGTCCGAGTCGGAATCGCTATCGGAGTCTGAGTCACTGTCGCTATCCGAATCACTGTCTGAGTCAGAATCACTGTCTGAATCTGAGTCACTGTCGCTATCCGAATCACTGTCTGAGTCCGAATCACTATCGGAATCCGAATCACTGTCTGAATCTGAATCACTATCCGAATCCGAATCGCTGTCGGAATCTGAATCACTGTCGCTATCTGAATCGCTGTCGCTATCCGAATCACTGTCGGAATCCGAGTCGCTATCAGAGTCAGAATCACTATCGGAATCTGAGTCACTGTCGGAATCGCTGTCGCTATCCGAATCACTGTCTGAGTCAGAATCACTGTCGGAATCCGAGTCACTGTCAGAATCGGAATCACTGTCGCTATCTGAATCACTATCCGAATCGGAATCACTGTCGGAATCCGAGTCACTATCCGAATCGGAGTCGCTGTCGGAATCCGAATCACTATCCGAGTCGGAGTCACTGTCTGAGTCAGAATCACTATCCGAGTCGGAGTCACTGTCGCTGTCCGAATCCGAGTCACTGTCTGAGTCTGAATCACTGTCAGAATCAGAATCACTATCCGAGTCGGAGTCAGAATCACTGTCTGAGTCTGAGTCACTGTCGGAATCTGAGTCACTGTCGCTATCCGAATCACTGTCTGAGTCCGAGTCACTGTCTGAGTCTGAATCGCTGTCAGAATCCGAATCACTATCGGAGTCGGAATCACTGTCTGAGTCTGAGTCACTATCCGAATCGGAATCACTATCGGAATCTGAATCACTATCCGAGTCAGAATCGGAGTCACTGTCAGAATCGGAGTCACTATCGGAATCTGAGTCACTGTCGCTATCAGAGTCGGAATCACTATCAGAATCAGAATCGCTGTCAGAATCTGAGTCGCTGTCGGAGTCTGAGTCACTGTCGGAGTCAGAATCGGAATCGCTATCCGAATCCGAATCACTGTCCGAATCCGAGTCTGAATCGCTGTCGGAATCTGAGTCACTGTCGGAGTCCGAGTCACTGTCGGAGTCCGAGTCACTGTCGGAATCTGAATCGCTGTCCGAGTCTGAATCGCTATCGGAATCCGAGTCGCTGTCCGAGTCCGAATCACTATCAGAGTCTGAGTCACTGTCGCTATCCGAATCACTGTCTGAATCGGAATCGCTGTCCGAGTCTGAATCACTATCCGAATCCGAGTCGCTGTCCGAGTCCGAATCACTATCCGAATCCGAGTCGCTGTCCGAGTCCGAATCACTATCCGAATCCGAATCGCTGTCGGAGTCCGAATCACTGTCTGAATCGGAATCACTATCGGAGTCGGAGTCACTGTCGCTATCCGAATCACTGTCGGAATCGGAGTCGCTGTCGGAATCCGAATCACTGTCTGAATCTGAGTCGCTATCAGAGTCTGAATCGCTGTCGGAATCGGAGTCACTATCTGAGTCTGAATCGCTGTCTGAGTCGGAGTCACTGTCGGAATCCGAATCACTATCCGAATCCGAGTCACTGTCGGAGTCCGAATCACTGTCCGAATCCGAGTCTGAATCGCTGTCGGAATCTGAGTCACTGTCTGAGTCGGAGTCACTGTCGCTGTCCGAATCACTATCGGAATCTGAGTCACTATCCGAGTCGGAATCACTGTCAGAATCGGAGTCACTGTCGCTGTCCGAATCACTATCGGAATCTGAGTCACTATCCGAGTCGGAATCACTGTCAGAGTCGGAATCGCTATCGGAATCCGAATCACTGTCGGAGTCCGAATCACTATCCGAGTCTGAATCACTATCGGAATCCGAATCGCTGTCGGAGTCCGAATCACTGTCTGAATCGGAATCACTATCGGAGTCGGAGTCACTGTCGCTATCCGAATCACTGTCCGAGTCCGAATCACTGTCTGAATCGGAGTCGCTGTCCGAGTCCGAATCGCTGTCGGAGTCCGAATCACTGTCGGAATCTGAGTCGCTATCGGAGTCGGAATCACTGTCGGAATCTGAGTCGCTATCAGAGTCGGAATCACTGTCAGAATCGGAGTCGCTATCCGAATCGGAATCACTGTCCGAGTCAGAATCACTGTCAGAATCGGAGTCGCTATCCGAATCGGAATCACTGTCCGAGTCCGAGTCACTGTCGCTATCTGAATCACTGTCGGAGTCGGAGTCACTGTCTGAATCCGAATCACTATCCGAATCTGAGTCGGAATCGCTGTCGGAGTCACTATCCGAATCGGAATCACTATCAGAGTCGGAGTCACTGTCGGAGTCGGAATCACTGTCCGAATCTGAGTCACTGTCGCTGTCCGAATCACTATCGGAATCTGAGTCACTATCCGAGTCGGAATCGCTGTCGGAGTCGGAATCACTGTCGCTATCTGAATCACTGTCGCTATCTGAATCACTGTCAGAGTCGGAATCACTATCGGAATCTGAGTCACTGTCAGAGTCGGAATCACTGTCGGAATCTGAGTCACTATCGCTATCCGAGTCGGAATCACTGTCGCTATCTGAATCGCTGTCCGAGTCCGAGTCACTGTCAGAATCGGAGTCGCTATCGGAGTCGGAGTCGCTGTCCGAGTCCGAGTCGCTATCGGAATCCGAATCACTGTCAGAGTCGGAATCACTGTCGGAATCTGAGTCGCTGTCGCTATCCGAATCACTATCAGAATCCGAGTCACTGTCGGAATCCGAATCACTATCAGAATCCGAATCACTATCAGAATCCGAGTCGCTGTCTGAGTCAGAATCACTGTCGGAATCCGAATCACTGTCAGAGTCGGAATCACTGTCGCTATCCGAATCACTGTCGCCGTCAGAATC

>NZ_CP015308|2|1|849119-854247|CRT
GAATCACTGTCTGAGTCCGAGTCACTGTC	GGAATCCGAATCACTATCCGAGTCGGAATCACTGTCGGAATCCGAGTCGCTGTCGGAATCCGAATCGCTATCCGAATCCGAATCACTGTCCGAATCTGAGTCGCTGTCCGAATCCGAATCACTATCCGAGTCGGAATCACTGTCAGAGTCC
GAATCGCTGTCAGAGTCCGAATCGCTGTC	GGAATCCGAATCGCTGTCCGAATCCGAATCACTATCCGAGTCTGAATCGGAGTCACTATCGGAATCGCTGTCTGAGTCGGAATCACTATCCGAATCCGAGTCACTGTCGCTATCCGAATCACTGTCAGAGTCC
GAATCGCTGTCAGAGTCCGAATCGCTGTC	AGAGTCCGAATCGGAGTCACTATCGGAATCCGAGTCACTGTCGCTATCCGAATCACTGTCAGAGTCTGAGTCGCTGTCCGAGTCGGAATCGCTATCGGAATCCGAGTCGCTGTCGGAATCG
GAATCACTGTCTGAGTCGGAATCACTATC	GGAATCCGAATCGCTGTCGCTATCTGAGTCACTGTCGGAGTCTGAGTCTGAATCGGAATCACTGTCCGAATCGGAATCGCTATCAGAGTCGGAATCGGAGTCACTATCTGAGTCTGAGTCG
CTGTCTGAGTCTGAATCGGAATCACTATC	AGAGTCGGAGTCACTGTCGCTATCCGAATCACTGTCAGAATCGGAATCACTGTCTGAGTCGGAATCGCTGTCGGAATCACTATCAGAGTCG
GAGTCACTGTCCGAATCGGAATCACTATC	AGAGTCAGAATCACTATCGGAATCTGAGTCGCTGTCCGAATCACTATCCGAGTCCGAATCACTGTCAGTATCTGAGTCGCTATCGGAATCGGAATCGCTATCAGAGTCG
GAATCGCTGTCGCTATCGGAATCACTATC	CGAGTCCGAATCACTATCGGAATCCGAGTCACTATCCGAGTCGGAATCACTGTCTGAATCCGAATCACTATCCGAGTCG
GAGTCACTGTCGGAATCAGAATCACTATC	CGAGTCCGAATCGGAGTCGGAATCGCTGTCGGAATCTGAGTCACTGTCGCTGTCCGAGTCGGAATCGGAATCACTATCCGAATCC
GAATCGCTGTCGGAATCGGAATCACTGTC	TGAGTCGGAATCACTATCCGAGTCGGAGTCACTGTCGGAATCGGAATCGCTATCCGAATCCGAATCACTGTCGGAATCT
GAGTCGCTGTCGGAATCAGAATCACTATC	CGAGTCCGAATCGCTGTCGGAGTCTGAGTCGCTGTCGCTATCCGAATCACTGTCCGAATCGGAATCACTATCAGAGTCT
GAATCGCTGTCGGAATCGGAATCACTGTC	TGAGTCGGAATCACTATCGGAATCCGAATCGCTGTCGCTATCCGAATCACTGTCTGAGTCAGAATCACTATCAGAGTCT
GAATCGCTGTCGGAATCGGAATCACTGTC	TGAGTCGGAATCACTATCGGAATCCGAATCGCTGTCGCTATCCGAATCACTGTCTGAGTCAGAATCACTATCAGAGTCT
GAGTCACTGTCGGAATCGGAGTCGCTATC	CGAGTCTGAATCACTGTCAGAGTCTGAATCACTATCAGAGTCTGAGTCGCTGTCAGAATCGGAATCGCTGTCGCTATCT
GAGTCACTGTCCGAGTCTGAGTCGCTGTC	GCTATCCGAATCACTGTCAGAATCGGAATCGCTATCAGAGTCTGAATCGCTGTCGGAATCG
GAGTCACTATCTGAGTCTGAATCGCTGTC	GGAGTCTGAGTCGGAATCACTGTCAGAATCGGAATCACTGTCGCTATCCGAATCACTGTCAGAATCG
GAATCACTATCTGAGTCTGAGTCACTGTC	ACTGTCCGAATCGGAATCACTGTCTGAGTCGGAATCGCTGTCGGAATCGGAGTCGCTATCAGAGTCG
GAATCACTATCAGAGTCTGAGTCACTGTC	GGAATCTGAATCACTATCAGAGTCAGAATCACTATCGGAATCGGAGTCACTGTCGGAGTCGGAATCACTATCAGAGTCA
GAATCACTATCGGAATCGGAGTCACTGTC	GGAGTCGGAATCACTGTCGCTATCTGAATCGCTGTCGGAATCCGAATCACTATCGGAATCGGAGTCGCTATCGGAGTCGGAATCACTGTCTGAGTCTGAGTCACTATCGGAATCG
GAATCGCTATCAGAGTCTGAATCGCTGTC	GCTATCTGAATCACTATCAGAGTCCGAATCACTGTCGGAATCCGAATCACTATCAGAGTCGGAGTCACTATCAGAGTCGGAATCACTGTCGCTGTCCGAGTCG
GAATCGCTATCGGAGTCTGAGTCACTGTC	GCTATCCGAATCACTGTCTGAGTCAGAATCACTGTCTGAATCTGAGTCACTGTCGCTATCCGAATCACTGTCTGAGTCC
GAATCACTATCGGAATCCGAATCACTGTC	TGAATCTGAATCACTATCCGAATCCGAATCGCTGTCGGAATCTGAATCACTGTCGCTATCTGAATCGCTGTCGCTATCC
GAATCACTGTCGGAATCCGAGTCGCTATC	AGAGTCAGAATCACTATCGGAATCTGAGTCACTGTCGGAATCGCTGTCGCTATCCGAATCACTGTCTGAGTCA
GAATCACTGTCGGAATCCGAGTCACTGTC	AGAATCGGAATCACTGTCGCTATCTGAATCACTATCCGAATCG
GAATCACTGTCGGAATCCGAGTCACTATC	CGAATCGGAGTCGCTGTCGGAATCCGAATCACTATCCGAGTCG
GAGTCACTGTCTGAGTCAGAATCACTATC	CGAGTCGGAGTCACTGTCGCTGTCCGAATCC
GAGTCACTGTCTGAGTCTGAATCACTGTC	AGAATCAGAATCACTATCCGAGTCGGAGTCA
GAATCACTGTCTGAGTCTGAGTCACTGTC	GGAATCTGAGTCACTGTCGCTATCC
GAATCACTGTCTGAGTCCGAGTCACTGTC	TGAGTCTGAATCGCTGTCAGAATCCGAATCACTATCGGAGTCG
GAATCACTGTCTGAGTCTGAGTCACTATC	CGAATCGGAATCACTATCGGAATCTGAATCACTATCCGAGTCAGAATCG
GAGTCACTGTCAGAATCGGAGTCACTATC	GGAATCTGAGTCACTGTCGCTATCAGAGTCGGAATCACTATCAGAATCA
GAATCGCTGTCAGAATCTGAGTCGCTGTC	GGAGTCTGAGTCACTGTCGGAGTCAGAATCGGAATCGCTATCCGAATCCGAATCACTGTCCGAATCCGAGTCT
GAATCGCTGTCGGAATCTGAGTCACTGTC	GGAGTCCGAGTCACTGTCGGAGTCCGAGTCACTGTCGGAATCTGAATCGCTGTCCGAGTCT
GAATCGCTATCGGAATCCGAGTCGCTGTC	CGAGTCCGAATCACTATCAGAGTCTGAGTCACTGTCGCTATCCGAATCACTGTCTGAATCGGAATCGCTGTCCGAGTCT
GAATCACTATCCGAATCCGAGTCGCTGTC	CGAGTCCGAATCACTATCCGAATCCGAGTCGCTGTCCGAGTCC
GAATCACTATCCGAATCCGAATCGCTGTC	GGAGTCCGAATCACTGTCTGAATCGGAATCACTATCGGAGTCGGAGTCACTGTCGCTATCC
GAATCACTGTCGGAATCGGAGTCGCTGTC	GGAATCCGAATCACTGTCTGAATCTGAGTCGCTATCAGAGTCT
GAATCGCTGTCGGAATCGGAGTCACTATC	TGAGTCTGAATCGCTGTCTGAGTCG
GAGTCACTGTCGGAATCCGAATCACTATC	CGAATCCGAGTCACTGTCGGAGTCCGAATCACTGTCCGAATCCGAGTCT
GAATCGCTGTCGGAATCTGAGTCACTGTC	TGAGTCGGAGTCACTGTCGCTGTCC
GAATCACTATCGGAATCTGAGTCACTATC	CGAGTCGGAATCACTGTCAGAATCGGAGTCACTGTCGCTGTCC
GAATCACTATCGGAATCTGAGTCACTATC	CGAGTCGGAATCACTGTCAGAGTCGGAATCGCTATCGGAATCCGAATCACTGTCGGAGTCC
GAATCACTATCCGAGTCTGAATCACTATC	GGAATCCGAATCGCTGTCGGAGTCCGAATCACTGTCTGAATCGGAATCACTATCGGAGTCGGAGTCACTGTCGCTATCC
GAATCACTGTCCGAGTCCGAATCACTGTC	TGAATCGGAGTCGCTGTCCGAGTCCGAATCGCTGTCGGAGTCCGAATCACTGTCGGAATCT
GAGTCGCTATCGGAGTCGGAATCACTGTC	GGAATCTGAGTCGCTATCAGAGTCGGAATCACTGTCAGAATCG
GAGTCGCTATCCGAATCGGAATCACTGTC	CGAGTCAGAATCACTGTCAGAATCG
GAGTCGCTATCCGAATCGGAATCACTGTC	CGAGTCCGAGTCACTGTCGCTATCTGAATCACTGTCGGAGTCG
GAGTCACTGTCTGAATCCGAATCACTATC	CGAATCTGAGTCGGAATCGCTGTCG
GAGTCACTATCCGAATCGGAATCACTATC	AGAGTCGGAGTCACTGTCGGAGTCGGAATCACTGTCCGAATCTGAGTCACTGTCGCTGTCC
GAATCACTATCGGAATCTGAGTCACTATC	CGAGTCGGAATCGCTGTCGGAGTCG
GAATCACTGTCGCTATCTGAATCACTGTC	GCTATCTGAATCACTGTCAGAGTCG
GAATCACTATCGGAATCTGAGTCACTGTC	AGAGTCGGAATCACTGTCGGAATCTGAGTCACTATCGCTATCCGAGTCG
GAATCACTGTCGCTATCTGAATCGCTGTC	CGAGTCCGAGTCACTGTCA
GAATCGGAGTCGCTATCGGAGTCGGAGTC	GCTGTCCGAGTCCGAGTCGCTATCG
GAATCCGAATCACTGTCAGAGTCGGAATC	ACTGTCGGAATCTGAGTCGCTGTCGCTATCCGAATCACTATCA
GAATCCGAGTCACTGTCGGAATCCGAATC	ACTATCAGAATCCGAATCACTATCAGAATCCGAGTCGCTGTCT
GAGTCAGAATCACTGTCGGAATCCGAATC	ACTGTCAGAGTCGGAATCACTGTCG
CTATCCGAATCACTGTCGCCGTCAGAATC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015308.1\|WP_003643194.1\|866105_867488_+\|amino-acid-permease	unknown	unknown	gnl\|CDD\|236904
NZ_CP015308.1\|WP_053338818.1\|839163_841590_-\|leucine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234743
NZ_CP015308.1\|WP_011101349.1\|843654_845181_-\|accessory-Sec-system-glycosyltransferase-Asp1	unknown	unknown	gnl\|CDD\|340855
NZ_CP015308.1\|WP_013355428.1\|867819_868794_+\|ferrochelatase	unknown	unknown	gnl\|CDD\|366291
NZ_CP015308.1\|WP_011101348.1\|845191_846700_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340855
NZ_CP015308.1\|WP_053338814.1\|862370_863090_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015308.1\|WP_003643181.1\|842052_842736_+\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239486
NZ_CP015308.1\|WP_033609889.1\|863165_864662_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340855
NZ_CP015308.1\|WP_053338819.1\|836969_838640_-\|polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|240529
NZ_CP015308.1\|WP_069137086.1\|871880_872399_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP015308.1\|WP_169484465.1\|860969_862160_-\|methionine-adenosyltransferase	unknown	unknown	gnl\|CDD\|235374
NZ_CP015308.1\|WP_003643189.1\|859332_860835_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341045
NZ_CP015308.1\|WP_003644218.1\|865062_865992_-\|homocysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|181899
NZ_CP015308.1\|WP_003643183.1\|843427_843625_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015308.1\|WP_003644231.1\|836221_836962_-\|16S-rRNA-pseudouridine(516)-synthase	unknown	unknown	gnl\|CDD\|211327
NZ_CP015308.1\|WP_003644232.1\|835248_836085_+\|NAD(P)H-hydrate-dehydratase	unknown	unknown	gnl\|CDD\|238576
NZ_CP015308.1\|WP_016511911.1\|870929_871766_+\|metallophosphoesterase-family-protein	unknown	unknown	gnl\|CDD\|378975
NZ_CP015308.1\|WP_027822136.1\|846726_848361_-\|glycosyl-transferase-family-1	unknown	unknown	unknown
NZ_CP015308.1\|WP_013355436.1\|842804_843332_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|377744
NZ_CP015308.1\|WP_003644215.1\|868765_870091_+\|Nramp-family-divalent-metal-transporter	unknown	unknown	gnl\|CDD\|234815

Protein	Function_ID	Function_description	E-value
NZ_CP015308.1\|WP_003643194.1\|866105_867488_+\|amino-acid-permease	gnl\|CDD\|236904	PRK11387, PRK11387, S-methylmethionine permease.	0
NZ_CP015308.1\|WP_033609889.1\|863165_864662_-\|glycosyltransferase	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	2.92738e-88
NZ_CP015308.1\|WP_011101349.1\|843654_845181_-\|accessory-Sec-system-glycosyltransferase-Asp1	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	4.16681e-107
NZ_CP015308.1\|WP_013355428.1\|867819_868794_+\|ferrochelatase	gnl\|CDD\|366291	pfam00762, Ferrochelatase, Ferrochelatase.	7.70113e-117
NZ_CP015308.1\|WP_003643181.1\|842052_842736_+\|phosphatase-PAP2-family-protein	gnl\|CDD\|239486	cd03392, PAP2_like_2, PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase.	1.93944e-45
NZ_CP015308.1\|WP_011101348.1\|845191_846700_-\|glycosyltransferase	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	8.80379e-70
NZ_CP015308.1\|WP_053338818.1\|839163_841590_-\|leucine--tRNA-ligase	gnl\|CDD\|234743	PRK00390, leuS, leucyl-tRNA synthetase; Validated.	0
NZ_CP015308.1\|WP_053338819.1\|836969_838640_-\|polysaccharide-biosynthesis-protein	gnl\|CDD\|240529	cd13124, MATE_SpoVB_like, Stage V sporulation protein B, also known as Stage III sporulation protein F, and related proteins. The integral membrane protein SpoVB has been implicated in the biosynthesis of the peptidoglycan component of the spore cortex in Bacillus subtilis. This model represents a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	3.0581e-131
NZ_CP015308.1\|WP_069137086.1\|871880_872399_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.27968e-08
NZ_CP015308.1\|WP_169484465.1\|860969_862160_-\|methionine-adenosyltransferase	gnl\|CDD\|235374	PRK05250, PRK05250, S-adenosylmethionine synthetase; Validated.	0
NZ_CP015308.1\|WP_003643189.1\|859332_860835_-\|MFS-transporter	gnl\|CDD\|341045	cd17502, MFS_Azr1_MDR_like, Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including various Saccharomyces cerevisiae proteins such as azole resistance protein 1 (Azr1p), vacuolar basic amino acid transporter 1 (Vba1p), vacuolar basic amino acid transporter 5 (Vba5p), and Sge1p (also known as Nor1p, 10-N-nonyl acridine orange resistance protein, and crystal violet resistance protein). MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.26448e-72
NZ_CP015308.1\|WP_003644218.1\|865062_865992_-\|homocysteine-S-methyltransferase	gnl\|CDD\|181899	PRK09485, mmuM, homocysteine methyltransferase; Provisional.	2.70803e-161
NZ_CP015308.1\|WP_003644231.1\|836221_836962_-\|16S-rRNA-pseudouridine(516)-synthase	gnl\|CDD\|211327	cd02553, PseudoU_synth_RsuA, Pseudouridine synthase, Escherichia coli RsuA like. This group is comprised of eukaryotic and bacterial proteins similar to Escherichia coli RsuA. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi). No cofactors are required. E.coli RsuA makes psi516 in 16S RNA. Psi at this position is not generally conserved in other organisms.	6.60255e-87
NZ_CP015308.1\|WP_003644232.1\|835248_836085_+\|NAD(P)H-hydrate-dehydratase	gnl\|CDD\|238576	cd01171, YXKO-related, B.subtilis YXKO protein of unknown function and related proteins. Based on the conservation of the ATP binding site, the substrate binding site and the Mg2+binding site and structural homology this group is a member of the ribokinase-like superfamily.	2.72812e-84
NZ_CP015308.1\|WP_016511911.1\|870929_871766_+\|metallophosphoesterase-family-protein	gnl\|CDD\|378975	pfam12850, Metallophos_2, Calcineurin-like phosphoesterase superfamily domain. Members of this family are part of the Calcineurin-like phosphoesterase superfamily.	4.17797e-10
NZ_CP015308.1\|WP_013355436.1\|842804_843332_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|377744	pfam06962, rRNA_methylase, Putative rRNA methylase. This family contains a number of putative rRNA methylases. Note that many family members are hypothetical proteins.	1.66853e-67
NZ_CP015308.1\|WP_003644215.1\|868765_870091_+\|Nramp-family-divalent-metal-transporter	gnl\|CDD\|234815	PRK00701, PRK00701, divalent metal cation transporter MntH.	2.2402e-148

>NZ_CP015308.1|WP_027822136.1|846726_848361_-|glycosyl-transferase-family-1
MQKSTVTKLKQALIATGNLKDYGTSTVTLALSVSDHRHRAQVRFYRCDSFKQAWIAVAQQLAKTPQASWVRLEAVQSTQKLPRETFEKRLAATFRMNYWRYGISFDADFKTALLEMESNGQAFFRPSKAHRIGKNRSGSWVDYDRVEPYLDKREGALPVDIRKTENVWVFTTAGVFTDGQKIWNLSEQEDCGKGVRVVTDEQSELQSAIEHGETFLINQLKDNGKFVYGYFPARQRVLSNYNVVRHFSSLYALLEAIPFTKRTEDCAKVKLAIQWGLKNATIEKEGAIFVDDNGELKLGGQALLILALSKYQDVTKDDTFMPVLMKAFKGVHFFQEPSGKLIHVLNPDLTVKAAYRIIYYEGEVAFALSRLYELTHDKNVMDLVKQILDYMVANDYGKYHDHWISYAINEALLVFPDNRDYMKLGLKNVFSHLKFIEERDTTYPTLLELVDAAVKMTDMIKRSGNEDLIAPYDLVRLRQVLRYRALYEITTGCFLPEIAMYLYNPQKFIGGFYARHDNFRTRIDDCEHFLSGLINYYNYTYRQA
>NZ_CP015308.1|WP_011101348.1|845191_846700_-|glycosyltransferase
MFYFINEYILGKNSSVEHAAINRVKLFNHYKAPAQIVTKMYDRLLHQTMGTFQLANQQVLNMFDYFQQTTDVPTKVLHTDDMHLPVEYAVEVGANFSKIFNGDEHVSNVGFIPGTIGRVFYQEFFDNQGNLSSTDLWDWRGFKSSTQYFGQNGKLVLERFYNLQGETVIEQYYVPDTNGNPLASRLILKNYRDQAERFFQDANHLFRFFLAELSHLDKQTTTFISDRPGTSVKPLLELQDDSHKYVTVPIYQAKDINDPIHSPLDGFLTPAFDNLQHFDGFITATESQAQHLRTRFPKAKVTVLPTVTTSPLAQSKLRPITARPKQLLYVGRLAPDRQLDQLIRTIALVKQQVKEIQCDFYGYGDPEYLKTLNKLVEELKLTNNVHLLDYHPDLETRYDDYQLLLNTDIVDGGPMSMPEAMSHGIPVISYRFNYGPKDWIDDGHDGFIVDPGNQLALRDRVIELMTDTKKLTAFSEAAFKKLHTSQTDLKVWHRWQQLLGIK
>NZ_CP015308.1|WP_011101349.1|843654_845181_-|accessory-Sec-system-glycosyltransferase-Asp1
MYYFLNDNMQFSKSGIEQAEINRLTLFKKHHVAAKIVTRVFAMNLHDVLEGANIADADFVNLFDFFCGSQSVKRQRFDLADFEVPADAIKTRKDNQIQVMERGKLIMIIYLRAGTEAVSNVQYFDVNGRTLKMSWWDTRGFKCLEQLFDWDGKIAQEAYFGPDGLIHVEKLHLLNHAGQERITWRVLNYNEQSHTFNGMNELTRYFYDELNQLNDEQNVFICDRTVECAWGLFNMTTSAKKVLHLHNNHVSDAKDIMHSTLNNNYANALNNWAAWDAVISATPEQTKDVEARFGKDIPAFTIPVGYVDNATLKAAPVKFDQRQKDLVVQVARLAPEKQQNHSIEAFVEVHKHFPDAKLELWGYANGDIEKQLHAQVAAAHLEDVVLFKGYTTDVNAVYNRAQLGLLPSRAEGFSLMLLEAQAHGLPMVANDVKYGPSDIIQDHKSGILTTDGDVQQLTKTILELLKNQGQLAQYSAQAYENAKRYSEEAVFKQWQALLDYFKPAKVTA
>NZ_CP015308.1|WP_003643183.1|843427_843625_-|hypothetical-protein
MLMIMTIYGTVKMFTRMIVYCGIGGLVLIVRHHNRKKRRNEMDEGTKRIMRNTPKDENGKYPWEK
>NZ_CP015308.1|WP_013355436.1|842804_843332_+|class-I-SAM-dependent-methyltransferase
MNQVVNPGDHVIDATVGNGHDTVYLAKLVGTTGRVDGFDIQSAAIEATTTALDKAALTHQVTLWQTGHEHIADKIAADQPIKCAVFNLGYLPGGDKQIITKPTTTLTAIKAIQERLVTNGLIILLVYAGHPGGATEAQAVLDYVTNLDQHQFQVLQYQFINQVHVPPYLLAIQKR
>NZ_CP015308.1|WP_003643181.1|842052_842736_+|phosphatase-PAP2-family-protein
MAIIYLSEESVLKQRSWQRSDSLILLIFIGWLGWTAAVWQRAPWLTHFDTTVANFWHHSPQWFQHAMVTYTQLGNPHTITIITLIIGLALWLGHNPRGAVFFWVTTWLIAGYGNYLIKQVIMRPRPTAWRLVQIGGYSYPSGHSTTTTVLIGSLLVLAFDYWHRNALTGWLTALGITAILLMMISRVIVGVHYPSDTIGGLLLGSVLLYISARFSMRYRHGPLRLRP
>NZ_CP015308.1|WP_053338818.1|839163_841590_-|leucine--tRNA-ligase
MAYNHKVIERKWQHYWKENKTFKTLDTTDKKKYYALDMFPYPSGQGLHVGHPEGYTATDIMSRFKRMQGYNVLHPMGWDAFGLPAEQYALKTGHNPKDFTAKNIKNFKRQIRSLGFSYDWDREVNTTDPSYYKWTQWIFEQLYKKGLAYESETLVNWAPDMMGGTVVSNEEVVDGKTERGGYDVYRVPMKQWSLKITAYADRLIDDLDDIDWPENIKEQQRNWIGRSVGASIRFKVAGQPDDTEIEVFSTRPDTLFGASYMVLAPEHDLVEQLTTPEQADSIKAYKAKIASKSDLERTDLNKDKTGVFTGSYGINPVNGEKLPIWIADYVLASYGTGAIMAVPAHDDRDFEFAQKFDLPIKPVIAGDNDYDQQAYTGDGEHINSGFVDGLAKQPAIDKMIDWLGEHHAGEKKVNYRLRDWIFSRQRYWGEPIPVIHWEDGETTLVPEDELPLRLPATKNLEPSGTGESPLANIDDWVNVVDENGRKGKRETNTMPQWAGSSWYFLRYVDPHNREALADYDKLKYWSPVDLYVGGAEHAVLHLLYARFWHKFLYDLGVVPTKEPFQKLVNQGMILGDNHEKMSKSRGNVVNPDDIVDQYGADTLRLYEMFMGPLEASIPWSTDGLHGANKWIERVWRLMIDENNRVRDRITTINDGKLTKIYNETVKKVTEDYEAMRFNIAISQMMVFVNEAYKVDDLPIIYIEGFVKLLSPIAPHLSEELWSLLGHDDTITYATWPTYDESKLVEDTVQIVLQVNGKVRSHAEVAKDMGKDELEKLALADEKIQEFTAGKTVRKVIAIPGKLVNVVAN
>NZ_CP015308.1|WP_053338819.1|836969_838640_-|polysaccharide-biosynthesis-protein
MSEESKANQPQNAHVNSEAEAHQKMVRGSAWMTAGSLFSRVLGAIYIIPWVIWMGADYTQGNALYAKGYNIYSFFLLIAIGGIPSAISKQLSEYNAMNEYAVGQRLFKRGLLLTSAFGIIGAIILWFGAGLISTAFGGYDANLIPVLHALAIALVILPSMSLTRGFFQGYQQMAPSAISQFVEQVFRVIYMLGATYFIMRVAHGDWVNAVTQSTFAAFVGAAASFLLLGWYYFRKRPELNALAAQSENKLVIPVWQLFRDIIIQAIPFIVIDTATTVFNLLDQATFQPMMRLVYHLGTKQIDTLYAYFAFNANKLVMIIVSLASAIAVTVVPILSESLASHNMRNIRKQLEDSIILFLFIMIPGALGMAAVAQPLNTLFYSYDQIGTLILQISAFTAIALGFFTVISALMQGLSRNRDIIRYYLIGLLVKIVIQLPCIYFLSTAGPLVATAIGMMVASLMAMYDLEVNFGIRYVKLLPKINRILVYSILTYVTARLVVYGLNFVLNEHSKTQSFLIVALAVIAGGAVYVCLALRSRMADLMIGTKAAGLRRKLRIK
>NZ_CP015308.1|WP_003644231.1|836221_836962_-|16S-rRNA-pseudouridine(516)-synthase
MRVDKFLHAMRIGTRTQVRRLIKDGHITANGEPVISGKQQINPGSDTVFLDDVQVRYQQYFYYVMNKPVGVITATTDSAAKTVMDLFNTTDFRDDLFPVGRLDKDTEGILVITNDGTLSHDLLSPNHHVTKVYEAEVTGEITAAQLANFNDGITLKDGTELQPAQAEIVQFHEIENFTTIRIMIHEGKYHQVKRMVGTLGERVVGLRRIKFGSLTLPVGLLAGNYRALTDDELTALKADANQPVGE
>NZ_CP015308.1|WP_003644232.1|835248_836085_+|NAD(P)H-hydrate-dehydratase
MQPITTEIVSRTIIKRPADSHKGNYGRIMLIGGNQNFGGAIIMAATAATYSGAGLVTVATDPSNFTSLHARLPEAMVIDYHQTDTLLNLLAGMDVIVIGPGLGTDTVADQLLTAVLAATHVPQRLVIDGSALTLLAQQARPLPATDIVVTPHQMEWQRLSGIAIKDQTPTANHDAQQRLGVTAVVKAHRTTVYTDERVWFNPGGTPAMATGGMGDTLAGMIGGFVSQFHNFTDAVLSAVYLHSAIADDLAATRYVVLPHQISARIPTYMHRFSQIERP
>NZ_CP015308.1|WP_003643189.1|859332_860835_-|MFS-transporter
MQQRKTNVMAVTVAIYVATFMSAIEGTIVSTALPTIVGDLHGVSLMNWVFSIYLLTNAMMTPIYGKLTDLVGRKPVMQAGLIIFIIGSMMSGLSNSMPVLIFWRAIQGIGAGALMPVSMTIIADIYSFERRAKVLGFNSSAWGIASVLAPLIGGLIVDKLSWHWIFFINVPVGLITLFLFQFYLREPKRHNNVKIDYLGSFWLMLFLLCLMLSFQLLGNATISWVAVGTAWIISALSLWLFIRRESRTDEPVISMDLFKNHTFIIQNAVAALVSGFLMAVEVYIPTWTQGILGVPASLAGFAVTPSSLMWIVGSFVTGRLLAKWAPRRILYLSLAFILVTSICLAWLPVNTAFPWFFLITAIGGVGFGITITATTVTSQHLVPAENVGVATSFNTLSRTIGQTLMISIFGIALNVGMNQGIQHHAGTNMAMMNKLINPQTATQLPSHLLPTLHRILYTGLHWVYLIGLGLVILAFIVNSLDRGPQKTAAQHAADLNQNQD
>NZ_CP015308.1|WP_169484465.1|860969_862160_-|methionine-adenosyltransferase
MVSERHLFTSESVSEGHPDKIADQISDAILDAMLAQDPQARVAVETSVTTGLVLVFGEVSTKAYVDIQKVVRDTIKSIGYVDGQYGFDGDNCAVLVSLDEQSPDIAQGVDDSLETRSGDADPLDQIGAGDQGMMFGYAINETPELMPLPIALSHRLMRKIAALRKDGTIKWLRPDAKAQVTVEYDEDNQPKRIDTVVLSTQHDPDVDLDTIRQTVIDQVIKAVLPADLLDDQTKYLVNPTGRFVIGGPQGDAGLTGRKVIVDTYGGFAHHGGGAFSGKDATKVDRSASYAARYIAKNVVAAGLADQVEVQLAYAIGVAEPVSIAVDTAGTGKVSDEALINAIRENFDLRPAGIIKMLDLQRPIYRQTAAYGHFGRTDIDLPWEHTDKVDALKAAFK
>NZ_CP015308.1|WP_053338814.1|862370_863090_+|hypothetical-protein
MIRIGKLHIKRDYIALAIFTIVQSIISWWAALDYGRSFQTASFSAAQLPLIGYTLAVAAAVFIILDRRIAPQWSLIAIGITVAFAFTNIIAKESELLYLLLTCSAWLLVMAVPRFGMQNYFGLVVFGVIMTFTIPVAVFDLQNNYLSTTFLWKLTPMLASYVFLYVPSFSRQRQINQLISAITGLLLVITIFLQPLTWQTIVAILITIAVWLSQQSFGRTRLHLMINVAVQLVLILLLY
>NZ_CP015308.1|WP_033609889.1|863165_864662_-|glycosyltransferase
MYYFVGTGLGLKLTGIEKAQLNRLALFDAAGYQARCVYVTYNPRLHEHAARFGAEGKCFSLYDFFQGTMPEAVTKIHHDWMHYWQAVCHFKVIQVPNTTDFRVLGTDGQYLMYVHFVDAGRQQLDYVNYFDNQGVKVRREFYDNRGFLSRTSFLVKHQEVHTEVYYDLQGQVKIIKQYDITGPEPKLRLITLKNYQQRDFFFNTEQAFQTFFFNELATADDVYFCDRNRQTAAALGHTRPAIRVCSVLHSTHLRIGEDVVSGHLKSVYRYVLAHPDQFHRIIVSTEHQKRDLLARYDNLPPVVVIPVGYTTVHPVKIDGRDPHRIISVARYSPEKQLPHQLEVVRRLVGEFPDLTLQLFGHGQKIEMQMRQFIQANQLEKNIVIRGFLPNLAEEYQRASLALMTSVEEGFSLATMEAESYGVPVIGYRIAYGPEDIIEDGVNGYLVTPNDVDELTMKVRQYLQHPERQAQLITNAYNSATRYSKQTIIEKWRQLIAAL
>NZ_CP015308.1|WP_003644218.1|865062_865992_-|homocysteine-S-methyltransferase
MLSLTEQLNRGPVVSDGAMATELEKRGVATNSALWSATAMLDHPDAIQAVHQSYLDAGAKIMTTNTYQANVPAFEQAGIAAAQARQLIQQAVTIAHTARDASHVTDAVIAGSIGPYGAYLADGSEYTGAYQLTPSAYQDFHRERLALIMAAGVDVLALETMPRLDEVQALVQLITTTWPQQPYWVSFSIKDPQTLCDGTSLAAAAKWVAAQPNVVAVGVNCTTLENIAPALTTLKAAVAVPLIVYPNSGDQYDPVTKTWQETHLSHQFASFVPQWLAAGARIIGGCCRTTPKDIATVARALSVSDSAKL
>NZ_CP015308.1|WP_003643194.1|866105_867488_+|amino-acid-permease
MSKQTHLSRQMESRHVLMISLGGVIGTGLFLSSGYTIHQAGPIGTLLAYTIGAILVYLVMLCLGELSVAMPYTGAFHVYAKKYIGPGTGFTVAILYWLTWTIALGSEFTAAGLIMQTWFPHIATWIWSLVFMVVIFTVNALSVRWFAEAEFWFASIKVIAIIAFIVLGGLAMVGILPLHGHTSAPFLSNYTRNGWFPNGFGGVFTTMLTVNFAFSGTELIGITAGETKDPAHTIPTAIKTTLWRLIIFFIGSMSVMAALIPYKQAGVTQSPFVLVFKAIGIPYAADLMNFVVLTAIMSAANSGLYASTRMLWSLANEGTIPKVFKRTTKRDVPLVALITSMLGGILALLSSVYAAGSVYLVLVSISGLAVVIVWMAIALSEINFRKTYLKSGQSLDQLTFKTPGYPVVPWLAFILSGLSCILIWFDPNQRIALYYTIPFVAICYLGYYLNQRYRRTHAAK
>NZ_CP015308.1|WP_013355428.1|867819_868794_+|ferrochelatase
MHPGLLLVNLGSPASPRTKDVKAYLQEFLSDPSVIEMPAALWQPLLRGIILPTRSWRSATFYQDSWLPQGSPLIVYSQAICQQVQAALPDWDVRLAMTYGQPDIGATLKAMVADGCEKPIILPLFPQYTQSTHGGIHRQVEATGLPHTFIDSFYDQPTYIHLLATKVWQSYQAHHYDAVIFSYHSIPTAMVRHGDPYQRECEATTKAVLTERPELPADKVITAYQSKFGPMPWLKPYLKNELMQLVELGKRNVLVVTPSFVVDCLETLEEDYVQNYQTFRASGGDRFDLVPPMNKDTGFSQFLADLAIQKQEASNHAIASSSKS
>NZ_CP015308.1|WP_003644215.1|868765_870091_+|Nramp-family-divalent-metal-transporter
MQSHRHQSLEEINQSVAVPDVHQTAFWRKFLAYSGPGALVAVGYMDPGNWLTSLAGGGQFQYRLLAVLALAIIVAMFMQGLAIRLGVVARQDLAQAIASKLPRPVRYAAWILNEVAMMATDMTGVIGTAIALKMLFGLPLLAGILLTIADVLVVLLFLRFGIRRVEVIVLVAILTVGIIFGIEVGRAHVQFGNVLLGLVPTPLIVKNHTALVLSLGILGATIMPHNLYLHSSLAQSRRYDYHNPAQVTEALRFANWDSTVHLIAAFLINALLLVLGGTLFFGHTNALASLQAVFDGLKSTTVVGALASQVMSWLFALALLITGLISSITSTLAGQIVMEGYLHIRLPLWQRRLLTRAVTLIPILIIGMLVGFSDAAFENLIIYAQVALSIALPFTLLPLVALTNDASLMKTHVNRPTVTWLGYGLAGIITVLNIYLVYSLF
>NZ_CP015308.1|WP_016511911.1|870929_871766_+|metallophosphoesterase-family-protein
MVKIAVLSDVHGNATALEAVLADAQKQHVDEYWTVGDMTVRGPESERCLTLLDRVHPTAYVLGNHEENYQKVMAANPNTFTKPKQIMATVLTAFDRRQLSSTHFERLLNLPMTVIKHVGPLTIRLQHVLPTVASGHALAPTASQANFDQAAEGDVDIVIYAHTHQPIMRYATTGQLILNAGTVGLPTAINPHLRQPRANYLLLTIDETGLQHIDYRAVDFDWQRAITIAQNTHLPYFEFYEQTLRTNTYQYAPSAVAAYNTQHDMAREARKILLENRH
>NZ_CP015308.1|WP_069137086.1|871880_872399_+|GNAT-family-N-acetyltransferase
MYFKKATLDDLDTIIDILSDGRNQLAEAGVNQWQGDYPSRKQITADIMQGSAYLFNADDNATVGAVAVVPSPDETYDTAKAEWLNTTAPYVVIHRVAIHSSHAGHGYATQLFEKIIAHIAADHPEIKSIRIDTHADNQPMQHLIAKMNFKRVGEMVGVYHVDDVCYVYEKML

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015308_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015308_3

1823736-1824036

TypeII

Consensus_repeat	Method
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CRT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	PILER-CR
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CRISPRCasFinder

4 spacers

csa3,cas2,cas1,cas9

The CRISPR arrays of NZ_CP015308_3

>merge|NZ_CP015308|3|1823736-1824036|CRT,PILER-CR,CRISPRCasFinder
CGTGAAACTGTTTTTGATGTGGCCGCTATTCAAGACAAACGTTCTATGCTTCGTTTCCTCAGCATCGTTCTAAACCTGTTTGATATGACTACTATTCAAGACTAATCGGCGTGGTGAAGATTTCGCCGACGTGTTCTAAACCTGTTTGATATGACTACTATTCAAGACAGCCAATGAATGACTACGCTAAAGACGTTTGTTCTAAACCTGTTTGATATGACTACTATTCAAGACTACGGTACTCAATTACGATTAGATAATACAAGTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

>NZ_CP015308|3|2|1823736-1824036|CRT
CGTGAAACTGTTTTTGATGTGGCCGCTATTCAAGAC	AAACGTTCTATGCTTCGTTTCCTCAGCATC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAATCGGCGTGGTGAAGATTTCGCCGACGT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AGCCAATGAATGACTACGCTAAAGACGTTT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TACGGTACTCAATTACGATTAGATAATACAA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

>NZ_CP015308|3|1|1823802-1824036|PILER-CR
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAATCGGCGTGGTGAAGATTTCGCCGACGT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AGCCAATGAATGACTACGCTAAAGACGTTT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TACGGTACTCAATTACGATTAGATAATACAA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

>NZ_CP015308|3|2|1823802-1824036|CRISPRCasFinder
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAATCGGCGTGGTGAAGATTTCGCCGACGT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AGCCAATGAATGACTACGCTAAAGACGTTT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TACGGTACTCAATTACGATTAGATAATACAA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015308.1\|WP_071542797.1\|1817006_1817291_+\|LytTR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197918
NZ_CP015308.1\|WP_003641721.1\|1836967_1838167_-\|putative-hydroxymethylpyrimidine-transporter-CytX	unknown	unknown	gnl\|CDD\|274096
NZ_CP015308.1\|WP_027821588.1\|1826117_1830194_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374653
NZ_CP015308.1\|WP_027821590.1\|1831289_1831997_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015308.1\|WP_011100897.1\|1818398_1818872_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP015308.1\|WP_027821589.1\|1830482_1831265_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP015308.1\|WP_003641730.1\|1819652_1819847_+\|PspC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377200
NZ_CP015308.1\|WP_011100896.1\|1818984_1819587_+\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|377026
NZ_CP015308.1\|WP_003643663.1\|1815385_1816618_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340949
NZ_CP015308.1\|WP_015379645.1\|1814995_1815295_-\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP015308.1\|WP_027821587.1\|1825017_1825923_-\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
NZ_CP015308.1\|WP_011100898.1\|1817830_1818253_-\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|107228
NZ_CP015308.1\|WP_027821583.1\|1817287_1817743_+\|DUF3021-domain-containing-protein	unknown	unknown	gnl\|CDD\|378668
NZ_CP015308.1\|WP_011100895.1\|1819889_1820648_-\|nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|350158
NZ_CP015308.1\|WP_046037886.1\|1834309_1835902_-\|HIRAN-domain-containing-protein	unknown	unknown	gnl\|CDD\|214906
NZ_CP015308.1\|WP_003641724.1\|1833723_1834194_+\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|240033
NZ_CP015308.1\|WP_069137226.1\|1824734_1825040_-\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|226043
NZ_CP015308.1\|WP_003641725.1\|1832126_1833491_-\|amino-acid-permease	unknown	unknown	gnl\|CDD\|182694
NZ_CP015308.1\|WP_053339208.1\|1820932_1823671_+\|cation-transporting-P-type-ATPase	unknown	unknown	gnl\|CDD\|319775
NZ_CP015308.1\|WP_003641722.1\|1836145_1836886_-\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|224982

Protein	Function_ID	Function_description	E-value
NZ_CP015308.1\|WP_071542797.1\|1817006_1817291_+\|LytTR-family-transcriptional-regulator	gnl\|CDD\|197918	smart00850, LytTR, LytTr DNA-binding domain. This domain is found in a variety of bacterial transcriptional regulators. The domain binds to a specific DNA sequence pattern.	6.75435e-19
NZ_CP015308.1\|WP_003641721.1\|1836967_1838167_-\|putative-hydroxymethylpyrimidine-transporter-CytX	gnl\|CDD\|274096	TIGR02358, purine-cytosine_transport_protein, putative hydroxymethylpyrimidine transporter CytX. On the basis of a phylogenomic study of thiamine biosythetic, salvage, and transporter genes and a highly conserved RNA element THI, this protein family has been identified as a probable transporter of hydroxymethylpyrimidine (HMP), the phosphorylated (by ThiD) form of which gets joined (by ThiE) to hydroxyethylthiazole phosphate to make thiamine phosphate. [Transport and binding proteins, Nucleosides, purines and pyrimidines, Biosynthesis of cofactors, prosthetic groups, and carriers, Thiamine].	1.0046e-146
NZ_CP015308.1\|WP_027821588.1\|1826117_1830194_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|374653	pfam16592, Cas9_REC, REC lobe of CRISPR-associated endonuclease Cas9. The REC lobe of Cas9 - the CRISPR-associated endonuclease Cas9 - includes the REC1 and REC2 domains. REC1 forms an elongated, alpha-helical structure consisting of 25 alpha helices and two beta-sheets, whereas REC2 inserted within REC1 adopts a six-helix bundle structure. The REC lobe and the NUC lobe of Cas9 fold to present a positively charged groove at their interface which accommodates the negatively charged sgRNA:target DNA heteroduplex. CRISPR (clustered regularly interspaced short palindromic repeat)-Cas system occurs naturally in bacteria as a defense against invasion by phages or other mobile genetic elements. Cas9 is targeted to specific genomic locations by sgRNAs or single guide RNAs, in order to complex with invading DNA in order to cleave it and render it inactive.	2.66373e-128
NZ_CP015308.1\|WP_011100897.1\|1818398_1818872_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	0.000255443
NZ_CP015308.1\|WP_027821589.1\|1830482_1831265_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.18043e-25
NZ_CP015308.1\|WP_003641730.1\|1819652_1819847_+\|PspC-domain-containing-protein	gnl\|CDD\|377200	pfam04024, PspC, PspC domain. This family includes Phage shock protein C (PspC) that is thought to be a transcriptional regulator. The presumed domain is 60 amino acid residues in length.	2.12668e-17
NZ_CP015308.1\|WP_011100896.1\|1818984_1819587_+\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	2.2024e-30
NZ_CP015308.1\|WP_003643663.1\|1815385_1816618_-\|MFS-transporter	gnl\|CDD\|340949	cd17391, MFS_MdtG_MDR_like, Multidrug resistance protein MdtG and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli multidrug resistance protein MdtG, Streptococcus pneumoniae multidrug resistance efflux pump PmrA, and similar multidrug resistance (MDR) transporters from bacteria. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtG confers resistance to fosfomycin and deoxycholate. PmrA serves as an efflux pump for various substrates and is associated with fluoroquinolone resistance. MdtG-like MDR transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.1962e-140
NZ_CP015308.1\|WP_015379645.1\|1814995_1815295_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	2.33489e-13
NZ_CP015308.1\|WP_027821587.1\|1825017_1825923_-\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	6.41428e-89
NZ_CP015308.1\|WP_011100898.1\|1817830_1818253_-\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|107228	cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18.5, HSP 18.55 and HSP 19.3. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Transcription of the genes encoding Lp HSP 18.5, 18.55 and 19.3 is regulated by a variety of stresses including heat, cold and ethanol. Early growing L. plantarum cells contain elevated levels of these mRNAs which rapidly fall of as the cells enter stationary phase. Also belonging to this group is Bifidobacterium breve (Bb) HSP20 and Oenococcus oenis (syn. Leuconostoc oenos) (Oo) HSP18. Transcription of the gene encoding BbHSP20 is strongly induced following heat or osmotic shock, and that of the gene encoding OoHSP18 following heat, ethanol or acid shock. OoHSP18 is peripherally associated with the cytoplasmic membrane.	2.67238e-43
NZ_CP015308.1\|WP_027821583.1\|1817287_1817743_+\|DUF3021-domain-containing-protein	gnl\|CDD\|378668	pfam11457, DUF3021, Protein of unknown function (DUF3021). This is a bacterial family of uncharacterized proteins.	1.50722e-25
NZ_CP015308.1\|WP_011100895.1\|1819889_1820648_-\|nucleoside-phosphorylase	gnl\|CDD\|350158	cd09007, NP-I_spr0068, uncharacterized subfamily of the nucleoside phosphorylase-I family. This subfamily is composed of uncharacterized members including Streptococcus pneumoniae hypothetical protein spr0068. The nucleoside phosphorylase-I (NP-I) family members accept a range of purine nucleosides as well as the pyrimidine nucleoside uridine. The NP-1 family includes phosphorolytic nucleosidases such as purine nucleoside phosphorylase (PNP, EC. 2.4.2.1), uridine phosphorylase (UP, EC 2.4.2.3), and 5'-deoxy-5'-methylthioadenosine phosphorylase (MTAP, EC 2.4.2.28), and hydrolytic nucleosidases such as AMP nucleosidase (AMN, EC 3.2.2.4) and 5'-methylthioadenosine/S-adenosylhomocysteine (MTA/SAH) nucleosidase (MTAN, EC 3.2.2.16). Members of the NP-I family display different physiologically relevant quaternary structures: hexameric (trimer-of-dimers arrangement of Shewanella oneidensis MR-1 UP); homotrimeric (human PNP and Escherichia coli PNPII or XapA); hexameric (with some evidence for co-existence of a trimeric form) such as E. coli PNPI (DeoD); or homodimeric such as human and Trypanosoma brucei UP. The NP-I family is distinct from nucleoside phosphorylase-II, which belongs to a different structural family.	7.05874e-91
NZ_CP015308.1\|WP_046037886.1\|1834309_1835902_-\|HIRAN-domain-containing-protein	gnl\|CDD\|214906	smart00910, HIRAN, The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p. HIRAN is found as a standalone protein in several bacteria and prophages, or fused to other catalytic domains, such as a nuclease of the restriction endonuclease fold and TDP1-like DNA phosphoesterases, in the eukaryotes. It has been predicted that this protein functions as a DNA-binding domain that probably recognises features associated with damaged DNA or stalled replication forks.	4.41904e-17
NZ_CP015308.1\|WP_003641724.1\|1833723_1834194_+\|NUDIX-hydrolase	gnl\|CDD\|240033	cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	8.22877e-58
NZ_CP015308.1\|WP_069137226.1\|1824734_1825040_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	2.65887e-25
NZ_CP015308.1\|WP_003641725.1\|1832126_1833491_-\|amino-acid-permease	gnl\|CDD\|182694	PRK10746, PRK10746, putative transport protein YifK; Provisional.	0
NZ_CP015308.1\|WP_053339208.1\|1820932_1823671_+\|cation-transporting-P-type-ATPase	gnl\|CDD\|319775	cd02080, P-type_ATPase_cation, P-type cation-transporting ATPase similar to Exiguobacterium aurantiacum Mna, an Na(+)-ATPase, and Synechocystis sp. PCC 6803 PMA1, a putative Ca(2+)-ATPase. This subfamily includes the P-type Na(+)-ATPase of an alkaliphilic bacterium Exiguobacterium aurantiacum Mna and cyanobacterium Synechocystis sp. PCC 6803 PMA1, a cation-transporting ATPase which may translocate calcium. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP015308.1\|WP_003641722.1\|1836145_1836886_-\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	gnl\|CDD\|224982	COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only].	4.48973e-88

>NZ_CP015308.1|WP_053339208.1|1820932_1823671_+|cation-transporting-P-type-ATPase
MIKDDNQSLTSNEEQNDTQNPPDADNLWQLDESALAAKYATDPENGLSTAEAAERLQHNGRNELETKRTSRFVQFIKQFNNSIIYILAAAAVLTFFMHHYSDSIVIGLVIIANAIIGYVQERQAGNALERIREMLISKNFVIRDGKKLEIDARELVVGDLVNLEAGDAVPADMRLISADNFNVQESVLTGETNPVEKQEEPMTETTLALADRKNMVYASTAVTSGSAVGIVTATAEDTEIGHIQQSVSDVKQTTTPLMRNLNSLGVGLSIAIVVAAVLLFLLGMVMDTYSLPTLLIAVITMVVGSMPEGLPASTSVVLAMGTRQMTKKNVIVKSLPAVETLGAVDIVNTDKTGTLTKNEMTVTKVVTPEHTFDVTGVGYDDNGGVNFDGHLKLNGNKVDWHQDNAMEWLVKIAGQTTDAELHFENNRWELTGEPTDGALTTLYRKMTGHDPEVEEVDSLPFDSAFRFSARLADLDGQRLLMVKGSPATVLRLTDQANQTAYWDDAMDDLTADGLRVVALAYQEVDDDVTTIDAQAIGGLHLAGLVGIIDPPREEAATAIAELRQAGVQVKMITGDHPDTAMAIANKLNLAANVKAITGPEIDAMDDQQLQAHIDDYNVFARATPNNKLRIVRAQQANNHVVSMTGDGVNDAPALKQADIGVAMGIKGTEVAKESADMVLADDDFADIVAAVREGRHVFDNIRKTIRFLLPTSFAEGLVVIISILMGHELPLYPTQLLWINMVSALTIQFAFIFEPPEAGIMARGPRNVKSGLLSKLDYFEIGYVSFLISGLGIFAYNYLTALGLPNVVGSTMSLNIIIFGKIFYLFNLRNDHPVISKYFFQNKMAFYIIGILILLQLGIIYLPFMQSVFHTTSINFWYGWGIPIICGIVVLIVTEVGKFIRFRWMGKDGVID
>NZ_CP015308.1|WP_011100895.1|1819889_1820648_-|nucleoside-phosphorylase
MTDKLTLLQYDPNPTAMVGPDVDGRFTVPAKLLYIFSGDDYFQQFVTRYHGHRLGQFNTITKVSWVYQIGYRGQKLAVAQAPLGSPAATMYLEMLIDFGARTVIAVGSCGALTALPEEQLLIPTVALRDEGTSFHYLAAADWVPLDPKVIQVLGTTLTKACLPWQMVKTWTTDAFFRETVSKVKAARQQGCQVVEMECSALAACSAFRQVSFGQLLYTADTLAQLEHYDPRHWGAGGVLAAIELAVESLAAY
>NZ_CP015308.1|WP_003641730.1|1819652_1819847_+|PspC-domain-containing-protein
MKIDIHRSATDRVIAGVIGGIAEHFNWNTNVTRLLFVVLAITPMFPGIIAYLILWLLMKDPIKD
>NZ_CP015308.1|WP_011100896.1|1818984_1819587_+|NAD(P)H-dependent-oxidoreductase
MFKIAIILGSTRSQANGRALLNHLKLIIDQLPTHSPIHYQFLDLANYQLPFFDEPEPPMANPHRELPANQQQWLTDMASADGYIILTPEYNHAMPAGLKNAFDFLAFEGARKPAKIISYSDNMRGGQFGAAALVPVLQRLGIVVLPKPTPIGNVPQTLQSNGHFIDNAPLSKRYDHTLHQALTEITYYTTVLTTTPFPTD
>NZ_CP015308.1|WP_011100897.1|1818398_1818872_-|MarR-family-transcriptional-regulator
MTTPLVSQLMTELNQFLTQDSVDDQEKRWAMQQTTDPQLQAALKQLSTTDIKIMAYLGRRGASRAKSLPAPTELSQATISRGLTKLSRLKLATKYRDLTNNKEILVRLTTLGEAVADLHTQLDATIAAKAQAIADDYSDAELRRFVSLMRRIREIKI
>NZ_CP015308.1|WP_011100898.1|1817830_1818253_-|Hsp20/alpha-crystallin-family-protein
MANTLMNRNDFGMLDPFERMARSFWAPLENMDQVLKTDINETDDQYQVKVDVPGIDKQDVKLDYRDNVLSIKVQKDSFVDHEDQDQNIVMNERHTGTLQRQYMLPNVAANKITASQADGVLTITLPKTQPSANDGQIEIQ
>NZ_CP015308.1|WP_027821583.1|1817287_1817743_+|DUF3021-domain-containing-protein
MKRLWHTLLIGAIGGIVIGYLMALGFSTFFNTTYLFPSNPTFVSHWSSPLAATQLSTLLWILIGEVWAFSSWLFEIETWSITKQTIAHCLCSFLGMTPLAILCGWFPLNVRWFGFYTLVYTGAYIGLWLIEMALARIKVIQLNQQLTNQRS
>NZ_CP015308.1|WP_071542797.1|1817006_1817291_+|LytTR-family-transcriptional-regulator
MPLQSVSRFYTANKRLYCETTTGAYLVHSHLHTLMDQLPPHQFLRISSSEIVRIACVKNFTLTKWGSFQVNLTTGTTTYASRRYTQQIRKAAQL
>NZ_CP015308.1|WP_003643663.1|1815385_1816618_-|MFS-transporter
MDDAERERGPWHRNLIVLWFCTFVAGMAFSEIMPFLSLFVSQLGDFTKAQITFYSGLAFAADYAISAISAPLWGIIADKKGRKIMLLRASLGMAVAMGLMGFVTNVWQLVALRALQGVFAGFISNAQALVASQTPRKYSGRALSTLITGAVSGQLFGPVIGGLLAQLFSIRNTFFITAGLLMVAFLLSLFFVQEHFKPVAHHREPGDSRNPLAAFQNPRLIIVMLCSTAIVQFGNASIAPIISLYVRELMHYRGPITVVAGIIAALPGISNIFSAPRLGRYGDQHGSGKVLLFGYIFAVIMYFPQGIVTSVVALGILRFAIGISDGALYPEIQTVLTKNTPVHLTSTIFSYNQSFQAIGNMFGALLGGLVAGWFNYNAVFIMTALLLLINLGLILWLVPDIWKNGKRAVS
>NZ_CP015308.1|WP_015379645.1|1814995_1815295_-|winged-helix-turn-helix-transcriptional-regulator
MNIEISKQDQADQQRVAIFKALADANRLRIIRVLYQAQREMTCSEVGAQLNISKSTVSYHFKTLRLVGLTNTRRKAQTKYLSLQLATFDRFLPGFLATL
>NZ_CP015308.1|WP_069137226.1|1824734_1825040_-|CRISPR-associated-endonuclease-Cas2
MRLIVMFDVPMDTSEERPAYRHFHKALVREGFLMMQYSTYVRVCVNKKAAEFVEKRIAPLAPKGGKVQTMTVTEKQYQAMHYIQGTPSNDILNSAERTIVI
>NZ_CP015308.1|WP_027821587.1|1825017_1825923_-|type-II-CRISPR-associated-endonuclease-Cas1
MGWRNVIITQHAKVSYSMNRILVQTSSDKYAVPISDIQLLLVGTTQAVITSAALCALAEAHVKVIFTDHQGEPISETNDYYPTRRTADLVRQQVTWPEARIATLWTKNVGSKILNQIQVIDFVGGDTQTLVDELDKLELNDVTNREAVVANKYFSLLFGAQFYRRDFSPINAALNYGYAVLLSMVNREIVLNGYLTCIGIHHENNENEFNLGSDLMEPFRPIVDQWVSQQRFKDFTPDIKIGLVSLLDLEIGFNGHQTIVSHAITEYVAACLHYLSGETEELKIEVKLPNEVSSDAINSHV
>NZ_CP015308.1|WP_027821588.1|1826117_1830194_-|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MKEPYGVGLDIGTNSVGWTVVDASGHVRKIKGQTGIGVRLFKEGAAAADRRGFRTTRRRLKRVKWRLRLLREFFDQPISKVDINFFARRKYSDISPRDPNYNGLEKTLFNDRSDQDFYHDYPTIYHLREALMTQHRKFDVREIYLAIHHIVKYRGNFLRNDAATAYRSGTLDLQQHFETLNHLFSQADLELNLNLTTDVALLDSIKQTLVRTDISRSDRQKLIMPLLAVLTGATTAEKKRQKAVVTEFAKALVGNKTKIDVLTLTDIDATEAKDWAFSLEENQDKLPGIEDRFSEVGQQIIDEVIRLYASVNLAQLIPEGKRFSQSMVEKYKRHGEDLKLLKAYIRSQSDAKRGRAIRATYDQYIDGVKSKQVTQEAFQKALGKFVDADVDLNSWAAQIKQAIDSEQFMPKLRIKQNGAIPYQVQQNELDQIISNQKEYYPWLGEENPVIKRRGKFPYKLDELVGFRVPYYVGPLITKEMQAATANAGFAWMVRKADGPITPWNFDDKVDRVASATAFIQRMQTTDTYLIGEEVLPARSLIYQRFMVLNELNNIRVDDGQLTPRQKQRLYNQVFKKHKRVTAKNIQDNLVAAGEFPTAPRITGLADPKVFNSSLSTYHDLKQVLPEAMSDVRKQADIEKIILWSTIFEDSTIFKQKLTEISWLTAAQLKQLGQLRYRGWGQLSRKLLTGLKDDNNRSIMDGLWETNANFMQLRSQPAIENQIKSANQANLTTADLQDTINELYTSPQNKKAIREVMVVLADIKDAMHGQTPNWIFVEAARGGGVAGRRTQSRSKQIVAAYQGTAQAIVSDQVQRELKEKIKNKANFNTRLVLYFLQNGRDLYTGDAINIDRLSEYDIDHILPQSLVKDDSLDNRVLTNARINREKNDTFASEKFGKKMGAKWKEMHRMGLMTKRKLDHLLMRPDEISKYATGFINRQLVETRQVIKLVEELINAEYPSTAIVSVKANLTHQFRQTFDFPKIREVNDYHHAFDAALTAFIGTYLLKRYPKLERFFVYGKFAKQPVNLTRFNVIRKLAKTDTPITDIDTGEVLWDKLTDIKYFETLYDYKRLLVTREVSENYGAMFDQTLLKASDNGKRLIRKKQSFDTAIYGGYTGKTLAYMAIVKVSTKKDVQYQVVGVPTTMVTQIEQLEQQGMTNKQAVTKVIEPLIAANNKKMLTYEVLLPKVRFEQVVRDRIKGQTHRFALGTDTYYHNIQELYLPLTLQRAFLGKQNESEVQLNQNLLTVFDATLAQVNRYFPLYEMNKFKKILNSARDQIELLEAKNQFVKNKLVLGKQGILTNMFIGLHANASYGDLKVLGVKTDFGKLQVPGGIKLTGDAEIIYQSPTGLFERKISLKDL
>NZ_CP015308.1|WP_027821589.1|1830482_1831265_-|alpha/beta-hydrolase
MRFITSDHVQLDYTDEGQGQPIVILTGFGGAKDIWRAQIPVLIQAGYRVINLDGRCQGLSEHTAKGLRMSRRAVDAHELIEKLQLKQPILLGNSMGAATWFAYVSLYGDTGIKALIDVDQTPRMINTPHWQYGFKQVQWQDIPDYFRMPLGHSTFKHIDDATYARVKAVEAQAPFDAKLMFPLLVNHAVQDWRDVIRQLTVPFLIIAGAKSPFFNPDFAAVTAQMALRGQSVVIPEAGHIVMAEQSVAFNKALLEFLATC
>NZ_CP015308.1|WP_027821590.1|1831289_1831997_-|hypothetical-protein
MVKQGHYAKVSKQKRLRQLKQRRQAQEKRAIMPEMVSEFLQVRYHLTQAAKQRPAMRQMMQRFMAQWLAAGQAELSDNGQTTWSVVALTKQTLQTFNRQLPWQGYALVDQEMARWTAFLNKEVPAVPLSERITLTEALSPATWQACLSEQLAINALLALTGDSRQLGQITTEQVRQLQTSIQTATGIDWEKVAQLLDSTVIAQNTLSKAGLDDKTRQWLEKLKKLTPQDFNDHVE
>NZ_CP015308.1|WP_003641725.1|1832126_1833491_-|amino-acid-permease
MQRKLSTGQMQMIALGGTIGVGLFMGSSSTIKWTGPSVLIAYIVSGAFLYLIMRALGEMLYVDPNTGSFAKFASEYIHPVFGYLTAWSNIFQFVVVGMSEMIALGGYCRYWWPNLPDWIPGLIAIVFLCAANLISVKMFGTLETWFSLIKVVTIILMIIAGLGLIIFGIGNGGHPIGISNLWTHGGFFTGGVKGFVFALAIVLASYQGIELIGVTAGEAENPQSTIVKAIRSTVARILIFYVGAIFVIVSIYPWDKLSQIGSPFVQTFAKIGITAAASIINFVVITASLSGTNSGIYSASRMTYTLAESHQLPRKMTLLNRHGVPFYSVIAIATGILIGVVLNVVLPMFFKDASEIFVMVYSSSVLPGMVPWFVILVSQIAFRKQNAAKMANHPFKMPLSPYSNYLTLAFLALTLVFMFINPETRYSILVGVVFLVIMTLIYFRKYAGNKEETL
>NZ_CP015308.1|WP_003641724.1|1833723_1834194_+|NUDIX-hydrolase
MANYIKEIRALVGHKPIILNTAAGILVNDQQQVLLNLRTDTHNWSLPGGYLEYGETYATACVREYKEDSGIDVEVVDRIGIFDKGETAYPNGDVAQTISALFLVKPIGGHVLTQATDETLKLDYFDFDNLPPLLNQQNADMIHAAQEYLQTHSATK
>NZ_CP015308.1|WP_046037886.1|1834309_1835902_-|HIRAN-domain-containing-protein
MERIEAGMSVMTLKKQTYRVIAVINQGQELLVRAHEPETADIEIIPVTTVVQVTEQNSTGDAAVALDTVTVVGERYVDDIVATLTTLRVGMAVLLQRESGNQYDDNAISVWTLQHAKLGYIARYQNQPYAALMDQGQRLYGIVTVLDQQKQHLELMLWRTTAVPSPIEALQIRQRLAKPRTNLGAVPTHSLQTPLGTIVMMCNGHPIKYQQVPLSPWLTPADELHVTKRYLLTPDWSQVPPDSLITCQVTAKADVVQRWQNEHISAAVLTNASSFYVVGISAQTKTGLNDNLVDDAAQPAVIYRVGQVSAHMQAGFMVSWAPFGDPRVQPALKLALHFSSQPLVPYHPVTPSRTNATFTQQELAALLVSALPNYQGGQRLEPSVTAITVEKLRQTLGDQTYHALANYQRHVQLVAGSTEGVNETLLQALIHAVTYHELTTMHYYQPTVGMVDQVIYPIQLFSTTTKDEDDAQLVGCLALYNYETFEIQQVPLTAIARIAIIADPEHPQTTPETESPDWLRIFLHGWNDDF
>NZ_CP015308.1|WP_003641722.1|1836145_1836886_-|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein
MVKPIIGIAPGVVTVNSQMFPGRVRDYVNRDYLKSVTDNGGVPLVLPVTTDATTIERYVGMIDGLLLCGGADVAPLTYGEEPQPKLGGVDPERDQYEIALIRATHAVGKPVLGICRGLQILNVCYGGNLYQDMSELPAGQGTLKHMQGQLAAYGMHHVKVVPGTTLAEYLGTTSDAITVNSFHHQAVKQVATGFQVVAQSADQVVEAIEATAGGLQLGVQWHPEMMQQVNSVQARLFAAFMRACVA
>NZ_CP015308.1|WP_003641721.1|1836967_1838167_-|putative-hydroxymethylpyrimidine-transporter-CytX
MKHDGIFRSQFLLWLGAAISIAEILTGTLMAPLGLTRGLAAIVLGHLIGCGLFLVPAGYLGAKLHQSALASAQLAFGRGGVLLASGLNALQLVGWTAVMIVNAQLAMNSISGKLFGFRSPLLMATIVAILIIAWLLMGSQLLFKINNAVVGLLVLGTVLMLVMVFMAPTTSQSVSTTSMTFGQAVELNVTMALSWLPLIGDYTQRVDRPLPVALVSAGGYMLGSLVMFVTGLLVVLRTGQTDITALLTRSGLGLVALLIIVFSTVTTTFLDTYSAATSLANLTDSRYVNRLAVGVTVVGLLIALTVAMTYYQNFLYLIGSVFTPLYAIIFVTYFVRHATLPYWLNFCWWVVGIVAYYQLQAIDFIGGTTLLVLVGLSIAVWLTGIIVKPTELEYRELSH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP015308_2	2.52\|853948\|19\|NZ_CP015308\|CRT	853948-853966	19	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2356-2374	0	1.0
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19916-19940	1	0.96
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155713-155737	1	0.96
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3130-3154	1	0.96
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2800-2824	1	0.96
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154465-154489	1	0.96
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156427-156451	1	0.96
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17840-17864	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18578-18602	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19322-19346	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155713-155737	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155995-156019	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21073-21097	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21181-21205	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21271-21295	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21289-21313	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21307-21331	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21361-21385	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21091-21115	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15460-15484	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15568-15592	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15694-15718	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15748-15772	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15766-15790	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15802-15826	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15892-15916	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15910-15934	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15478-15502	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15586-15610	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15622-15646	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15712-15736	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9595-9619	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9631-9655	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9739-9763	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9883-9907	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9991-10015	2	0.92
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9649-9673	2	0.92
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151317-151341	2	0.92
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151918-151942	2	0.92
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153259-153283	2	0.92
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153739-153763	2	0.92
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154363-154387	2	0.92
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156451-156475	2	0.92
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157303-157327	2	0.92
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1150-1174	2	0.92
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2278-2302	2	0.92
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3298-3322	2	0.92
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3418-3442	2	0.92
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153241-153265	2	0.92
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153721-153745	2	0.92
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156433-156457	2	0.92
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157501-157525	2	0.92
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2806-2830	2	0.92
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1420-1444	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151402-151426	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151510-151534	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151618-151642	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151672-151696	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153289-153313	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153307-153331	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153769-153793	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153889-153913	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154303-154327	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155683-155707	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157333-157357	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157495-157519	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1108-1132	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1306-1330	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1414-1438	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2572-2596	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2818-2842	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3274-3298	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3778-3802	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16658-16682	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16700-16724	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16868-16892	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16970-16994	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17828-17852	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17870-17894	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17942-17966	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18194-18218	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18326-18350	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18350-18374	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18938-18962	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19070-19094	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19310-19334	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19352-19376	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19424-19448	2	0.92
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19676-19700	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3394-3418	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3706-3730	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1768-1792	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1954-1978	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3166-3190	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153253-153277	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153733-153757	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154357-154381	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154519-154543	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154789-154813	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155005-155029	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155185-155209	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155239-155263	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155419-155443	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155455-155479	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156235-156259	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154273-154297	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155485-155509	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155521-155545	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155845-155869	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156265-156289	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156301-156325	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156445-156469	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156637-156661	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156787-156811	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157585-157609	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154537-154561	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154807-154831	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1126-1150	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	982-1006	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1144-1168	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16748-16772	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17744-17768	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18506-18530	2	0.92
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19226-19250	2	0.92
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16448-16472	3	0.88
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17126-17150	3	0.88
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152026-152050	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16490-16514	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16508-16532	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16670-16694	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17012-17036	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17168-17192	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17186-17210	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17528-17552	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18140-18164	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19622-19646	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153241-153265	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153721-153745	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154261-154285	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157141-157165	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21055-21079	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21127-21151	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21145-21169	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21199-21223	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21235-21259	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21325-21349	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21343-21367	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15442-15466	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15550-15574	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15676-15700	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15820-15844	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15856-15880	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15928-15952	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15946-15970	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9613-9637	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9685-9709	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9703-9727	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9757-9781	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9793-9817	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9829-9853	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9847-9871	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9901-9925	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9937-9961	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2224-2248	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3382-3406	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3694-3718	3	0.88
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3748-3772	3	0.88
NZ_CP015308_2	2.38\|852928\|49\|NZ_CP015308\|CRT	852928-852976	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151408-151456	3	0.939
NZ_CP015308_2	2.39\|853006\|25\|NZ_CP015308\|CRT	853006-853030	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155731-155755	3	0.88
NZ_CP015308_2	2.39\|853006\|25\|NZ_CP015308\|CRT	853006-853030	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156643-156667	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153913-153937	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156661-156685	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153103-153127	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153973-153997	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155461-155485	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155509-155533	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155581-155605	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156241-156265	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156289-156313	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156325-156349	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156739-156763	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156889-156913	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157195-157219	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157591-157615	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157627-157651	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	13-37	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	988-1012	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1096-1120	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1024-1048	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1060-1084	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2086-2110	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	49-73	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1546-1570	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1678-1702	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1720-1744	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1816-1840	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1960-1984	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2356-2380	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2710-2734	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3046-3070	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3172-3196	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3532-3556	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3712-3736	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21091-21115	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15478-15502	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15586-15610	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15712-15736	3	0.88
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9649-9673	3	0.88
NZ_CP015308_2	2.47\|853618\|25\|NZ_CP015308\|CRT	853618-853642	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153235-153259	3	0.88
NZ_CP015308_2	2.47\|853618\|25\|NZ_CP015308\|CRT	853618-853642	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153715-153739	3	0.88
NZ_CP015308_2	2.47\|853618\|25\|NZ_CP015308\|CRT	853618-853642	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17462-17486	3	0.88
NZ_CP015308_2	2.47\|853618\|25\|NZ_CP015308\|CRT	853618-853642	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18776-18800	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151534-151558	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151570-151594	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153655-153679	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153673-153697	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153691-153715	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154399-154423	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155851-155875	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156307-156331	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156793-156817	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156829-156853	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156961-156985	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156997-157021	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157645-157669	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151882-151906	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153211-153235	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153829-153853	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154261-154285	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154279-154303	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154381-154405	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154471-154495	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154741-154765	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154939-154963	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155137-155161	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155371-155395	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155461-155485	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156013-156037	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156103-156127	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156241-156265	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156415-156439	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156577-156601	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156739-156763	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156889-156913	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157141-157165	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157159-157183	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157267-157291	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157429-157453	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157627-157651	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1006-1030	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	988-1012	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1816-1840	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1852-1876	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1942-1966	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2224-2248	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2578-2602	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2770-2794	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3280-3304	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3382-3406	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3694-3718	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3748-3772	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3766-3790	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3784-3808	3	0.88
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	952-976	3	0.88
NZ_CP015308_2	2.50\|853816\|25\|NZ_CP015308\|CRT	853816-853840	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152044-152068	3	0.88
NZ_CP015308_2	2.50\|853816\|25\|NZ_CP015308\|CRT	853816-853840	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154507-154531	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151251-151275	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151366-151390	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151438-151462	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151474-151498	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151492-151516	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151726-151750	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151948-151972	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152020-152044	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152056-152080	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153361-153385	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153379-153403	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153415-153439	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153469-153493	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153487-153511	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153505-153529	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154021-154045	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154165-154189	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154753-154777	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154969-154993	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155149-155173	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155203-155227	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155383-155407	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155539-155563	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155557-155581	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155575-155599	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155953-155977	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155971-155995	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155989-156013	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156043-156067	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156145-156169	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156217-156241	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156391-156415	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156769-156793	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156919-156943	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157225-157249	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157243-157267	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157459-157483	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1090-1114	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1468-1492	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1522-1546	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1672-1696	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1918-1942	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1936-1960	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1990-2014	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2200-2224	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2854-2878	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3526-3550	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3604-3628	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3760-3784	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18638-18662	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21157-21181	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21373-21397	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1090-1114	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15778-15802	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9715-9739	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9859-9883	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	10003-10027	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	MT521994	Gordonia phage Magel, complete genome	34171-34195	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	MG962368	Gordonia phage Gravy, complete genome	33940-33964	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	MN585988	Gordonia Phage Odesza, complete genome	33962-33986	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	MG962369	Gordonia phage Kerry, complete genome	33940-33964	3	0.88
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NC_048817	Gordonia phage Tanis, complete genome	34113-34137	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1018-1042	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1054-1078	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3292-3316	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1144-1168	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1396-1420	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1540-1564	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1612-1636	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1810-1834	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2026-2050	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2080-2104	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2116-2140	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2608-2632	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2632-2656	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3448-3472	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3544-3568	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154393-154417	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156181-156205	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157153-157177	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157621-157645	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151528-151552	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151564-151588	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151798-151822	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151876-151900	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151894-151918	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153043-153067	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153871-153895	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153985-154009	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154003-154027	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154375-154399	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154483-154507	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154591-154615	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154735-154759	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154933-154957	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155023-155047	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155131-155155	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155257-155281	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155365-155389	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155503-155527	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155725-155749	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156283-156307	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156409-156433	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156463-156487	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156517-156541	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156553-156577	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156601-156625	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156655-156679	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156733-156757	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156883-156907	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156955-156979	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157063-157087	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157081-157105	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157099-157123	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157261-157285	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157297-157321	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157369-157393	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157387-157411	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157423-157447	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157639-157663	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1162-1186	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16076-16100	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16208-16232	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16340-16364	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17366-17390	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17516-17540	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17582-17606	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18098-18122	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18242-18266	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18680-18704	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18830-18854	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19580-19604	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19724-19748	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19784-19808	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19904-19928	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20090-20114	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21085-21109	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15472-15496	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15580-15604	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15706-15730	3	0.88
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9643-9667	3	0.88
NZ_CP015308_2	2.25\|851938\|31\|NZ_CP015308\|CRT	851938-851968	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155731-155761	4	0.871
NZ_CP015308_2	2.25\|851938\|31\|NZ_CP015308\|CRT	851938-851968	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156643-156673	4	0.871
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16070-16094	4	0.84
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16202-16226	4	0.84
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16334-16358	4	0.84
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16742-16766	4	0.84
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17360-17384	4	0.84
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17510-17534	4	0.84
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17576-17600	4	0.84
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17738-17762	4	0.84
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18092-18116	4	0.84
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18236-18260	4	0.84
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18500-18524	4	0.84
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18674-18698	4	0.84
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18824-18848	4	0.84
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19220-19244	4	0.84
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19574-19598	4	0.84
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19718-19742	4	0.84
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19778-19802	4	0.84
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19898-19922	4	0.84
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19970-19994	4	0.84
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20084-20108	4	0.84
NZ_CP015308_2	2.27\|852058\|25\|NZ_CP015308\|CRT	852058-852082	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3064-3088	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153655-153679	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153673-153697	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153691-153715	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154189-154213	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154225-154249	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154243-154267	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154399-154423	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155749-155773	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155977-156001	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156307-156331	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156829-156853	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156847-156871	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156997-157021	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157015-157039	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157033-157057	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157087-157111	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157123-157147	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157483-157507	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157573-157597	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1006-1030	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1132-1156	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1402-1426	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1510-1534	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1756-1780	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2560-2584	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2806-2830	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1024-1048	4	0.84
NZ_CP015308_2	2.37\|852874\|25\|NZ_CP015308\|CRT	852874-852898	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1078-1102	4	0.84
NZ_CP015308_2	2.38\|852928\|49\|NZ_CP015308\|CRT	852928-852976	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153157-153205	4	0.918
NZ_CP015308_2	2.39\|853006\|25\|NZ_CP015308\|CRT	853006-853030	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154279-154303	4	0.84
NZ_CP015308_2	2.39\|853006\|25\|NZ_CP015308\|CRT	853006-853030	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1774-1798	4	0.84
NZ_CP015308_2	2.39\|853006\|25\|NZ_CP015308\|CRT	853006-853030	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3064-3088	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151281-151305	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153139-153163	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153811-153835	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154417-154441	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154453-154477	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154525-154549	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154597-154621	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154795-154819	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155011-155035	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155029-155053	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155191-155215	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155245-155269	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155263-155287	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155425-155449	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155617-155641	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155653-155677	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156085-156109	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156187-156211	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156559-156583	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157051-157075	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157069-157093	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1042-1066	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1132-1156	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1600-1624	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1870-1894	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2242-2266	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2410-2434	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2674-2698	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3136-3160	4	0.84
NZ_CP015308_2	2.45\|853492\|25\|NZ_CP015308\|CRT	853492-853516	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3454-3478	4	0.84
NZ_CP015308_2	2.47\|853618\|25\|NZ_CP015308\|CRT	853618-853642	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19652-19676	4	0.84
NZ_CP015308_2	2.47\|853618\|25\|NZ_CP015308\|CRT	853618-853642	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20114-20138	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151372-151396	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151606-151630	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153175-153199	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153277-153301	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153295-153319	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153637-153661	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153757-153781	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153775-153799	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154009-154033	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154153-154177	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154189-154213	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154225-154249	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154243-154267	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154525-154549	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154795-154819	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155011-155035	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155191-155215	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155245-155269	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155425-155449	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155491-155515	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155527-155551	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155731-155755	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155749-155773	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156049-156073	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156271-156295	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156523-156547	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156607-156631	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156643-156667	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156757-156781	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156847-156871	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156907-156931	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157015-157039	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157033-157057	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157087-157111	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157123-157147	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157483-157507	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157573-157597	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	31-55	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1114-1138	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1132-1156	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1402-1426	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1510-1534	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1582-1606	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1756-1780	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1870-1894	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1978-2002	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2122-2146	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2206-2230	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2242-2266	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2428-2452	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2560-2584	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2692-2716	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2824-2848	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2992-3016	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3136-3160	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3262-3286	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3400-3424	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3514-3538	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3676-3700	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	970-994	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1006-1030	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1024-1048	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1078-1102	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1132-1156	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19916-19940	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	NC_005241	Cupriavidus necator H16 megaplasmid pHG1, complete sequence	200543-200567	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	NZ_CP039289	Cupriavidus necator H16 plasmid pHG1, complete sequence	200542-200566	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	NC_025424	Bacillus phage Waukesha92, complete genome	35558-35582	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	NZ_CP004871	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB46, complete sequence	1334-1358	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	NZ_CP011352	Bacillus thuringiensis strain YC-10 plasmid pYC4, complete sequence	11994-12018	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	NZ_CP013060	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-5, complete sequence	31212-31236	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	NZ_CP038639	Cupriavidus oxalaticus strain X32 plasmid unnamed4, complete sequence	338807-338831	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	NZ_CP010095	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB47, complete sequence	1334-1358	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	MK843319	Bacillus phage vB_BthS-TP21T, complete genome	9389-9413	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	KT970646	Bacillus phage phiS58, complete genome	9389-9413	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	HE614281	Staphylococcus phage SpaA1 complete genome	10075-10099	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	NC_018277	Staphylococcus phage SpaA1, complete genome	10075-10099	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	KT970645	Bacillus phage phi4J1, complete genome	9398-9422	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	NC_048628	Bacillus phage BceA1 complete genome	10075-10099	4	0.84
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	AY894696	Bacillus thuringiensis phage MZTP02 phage-related protein and hypothetical proteins genes, complete cds	9992-10016	4	0.84
NZ_CP015308_2	2.50\|853816\|25\|NZ_CP015308\|CRT	853816-853840	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151642-151666	4	0.84
NZ_CP015308_2	2.50\|853816\|25\|NZ_CP015308\|CRT	853816-853840	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151696-151720	4	0.84
NZ_CP015308_2	2.50\|853816\|25\|NZ_CP015308\|CRT	853816-853840	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155509-155533	4	0.84
NZ_CP015308_2	2.50\|853816\|25\|NZ_CP015308\|CRT	853816-853840	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156289-156313	4	0.84
NZ_CP015308_2	2.50\|853816\|25\|NZ_CP015308\|CRT	853816-853840	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157357-157381	4	0.84
NZ_CP015308_2	2.50\|853816\|25\|NZ_CP015308\|CRT	853816-853840	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157519-157543	4	0.84
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151654-151678	4	0.84
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151708-151732	4	0.84
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153343-153367	4	0.84
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154339-154363	4	0.84
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154951-154975	4	0.84
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155437-155461	4	0.84
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156619-156643	4	0.84
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157405-157429	4	0.84
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157441-157465	4	0.84
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157531-157555	4	0.84
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1270-1294	4	0.84
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3112-3136	4	0.84
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3412-3436	4	0.84
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21247-21271	4	0.84
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15868-15892	4	0.84
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_CP049837	Gordonia terrae strain RL-JC02 plasmid pPAE01, complete sequence	65055-65079	4	0.84
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9805-9829	4	0.84
NZ_CP015308_2	2.53\|853996\|25\|NZ_CP015308\|CRT	853996-854020	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9949-9973	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1000-1024	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1594-1618	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1864-1888	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2236-2260	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2272-2296	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2668-2692	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2782-2806	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3040-3064	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3742-3766	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151600-151624	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151636-151660	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151690-151714	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153007-153031	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153133-153157	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153325-153349	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153451-153475	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153853-153877	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153907-153931	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153967-153991	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154075-154099	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154111-154135	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154147-154171	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154183-154207	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154237-154261	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154255-154279	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154411-154435	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154447-154471	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154627-154651	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154861-154885	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155611-155635	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155647-155671	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156007-156031	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156127-156151	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156319-156343	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156481-156505	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156499-156523	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157027-157051	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157045-157069	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157135-157159	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157189-157213	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157351-157375	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157477-157501	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157513-157537	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157567-157591	4	0.84
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1018-1042	4	0.84
NZ_CP015308_3	3.2\|1823838\|30\|NZ_CP015308\|CRT,PILER-CR,CRISPRCasFinder	1823838-1823867	30	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	284024-284053	4	0.867
NZ_CP015308_2	2.47\|853618\|25\|NZ_CP015308\|CRT	853618-853642	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156007-156031	5	0.8
NZ_CP015308_2	2.47\|853618\|25\|NZ_CP015308\|CRT	853618-853642	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151528-151552	5	0.8
NZ_CP015308_2	2.47\|853618\|25\|NZ_CP015308\|CRT	853618-853642	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151564-151588	5	0.8
NZ_CP015308_2	2.47\|853618\|25\|NZ_CP015308\|CRT	853618-853642	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155845-155869	5	0.8
NZ_CP015308_2	2.47\|853618\|25\|NZ_CP015308\|CRT	853618-853642	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156787-156811	5	0.8
NZ_CP015308_2	2.47\|853618\|25\|NZ_CP015308\|CRT	853618-853642	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156955-156979	5	0.8
NZ_CP015308_2	2.47\|853618\|25\|NZ_CP015308\|CRT	853618-853642	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20030-20054	5	0.8
NZ_CP015308_2	2.47\|853618\|25\|NZ_CP015308\|CRT	853618-853642	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2800-2824	5	0.8
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154099-154123	5	0.8
NZ_CP015308_2	2.49\|853762\|25\|NZ_CP015308\|CRT	853762-853786	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154135-154159	5	0.8
NZ_CP015308_2	2.50\|853816\|25\|NZ_CP015308\|CRT	853816-853840	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153859-153883	5	0.8
NZ_CP015308_2	2.50\|853816\|25\|NZ_CP015308\|CRT	853816-853840	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155461-155485	5	0.8
NZ_CP015308_2	2.50\|853816\|25\|NZ_CP015308\|CRT	853816-853840	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156133-156157	5	0.8
NZ_CP015308_2	2.50\|853816\|25\|NZ_CP015308\|CRT	853816-853840	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156241-156265	5	0.8
NZ_CP015308_2	2.50\|853816\|25\|NZ_CP015308\|CRT	853816-853840	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21235-21259	5	0.8
NZ_CP015308_2	2.50\|853816\|25\|NZ_CP015308\|CRT	853816-853840	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15856-15880	5	0.8
NZ_CP015308_2	2.50\|853816\|25\|NZ_CP015308\|CRT	853816-853840	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9793-9817	5	0.8
NZ_CP015308_2	2.50\|853816\|25\|NZ_CP015308\|CRT	853816-853840	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9937-9961	5	0.8
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153235-153259	5	0.8
NZ_CP015308_2	2.56\|854194\|25\|NZ_CP015308\|CRT	854194-854218	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153715-153739	5	0.8
NZ_CP015308_2	2.25\|851938\|31\|NZ_CP015308\|CRT	851938-851968	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2908-2938	6	0.806
NZ_CP015308_2	2.34\|852640\|43\|NZ_CP015308\|CRT	852640-852682	43	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3046-3088	6	0.86
NZ_CP015308_2	2.40\|853060\|43\|NZ_CP015308\|CRT	853060-853102	43	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3298-3340	6	0.86
NZ_CP015308_2	2.40\|853060\|43\|NZ_CP015308\|CRT	853060-853102	43	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3172-3214	6	0.86
NZ_CP015308_2	2.40\|853060\|43\|NZ_CP015308\|CRT	853060-853102	43	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1150-1192	6	0.86
NZ_CP015308_3	3.2\|1823838\|30\|NZ_CP015308\|CRT,PILER-CR,CRISPRCasFinder	1823838-1823867	30	AB981169	Ralstonia phage RSY1 DNA, complete genome	19536-19565	6	0.8
NZ_CP015308_3	3.2\|1823838\|30\|NZ_CP015308\|CRT,PILER-CR,CRISPRCasFinder	1823838-1823867	30	NC_049432	Ralstonia phage RsoM1USA, complete genome	13669-13698	6	0.8
NZ_CP015308_3	3.2\|1823838\|30\|NZ_CP015308\|CRT,PILER-CR,CRISPRCasFinder	1823838-1823867	30	NZ_CP039965	Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence	1133280-1133309	6	0.8
NZ_CP015308_2	2.40\|853060\|43\|NZ_CP015308\|CRT	853060-853102	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154363-154405	7	0.837
NZ_CP015308_2	2.40\|853060\|43\|NZ_CP015308\|CRT	853060-853102	43	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1870-1912	7	0.837
NZ_CP015308_2	2.40\|853060\|43\|NZ_CP015308\|CRT	853060-853102	43	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3712-3754	7	0.837
NZ_CP015308_2	2.25\|851938\|31\|NZ_CP015308\|CRT	851938-851968	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154279-154309	8	0.742
NZ_CP015308_2	2.40\|853060\|43\|NZ_CP015308\|CRT	853060-853102	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156451-156493	8	0.814
NZ_CP015308_2	2.55\|854122\|43\|NZ_CP015308\|CRT	854122-854164	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154825-154867	8	0.814
NZ_CP015308_2	2.55\|854122\|43\|NZ_CP015308\|CRT	854122-854164	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155791-155833	8	0.814
NZ_CP015308_2	2.23\|851794\|43\|NZ_CP015308\|CRT	851794-851836	43	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16724-16766	9	0.791
NZ_CP015308_2	2.23\|851794\|43\|NZ_CP015308\|CRT	851794-851836	43	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17720-17762	9	0.791
NZ_CP015308_2	2.23\|851794\|43\|NZ_CP015308\|CRT	851794-851836	43	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18482-18524	9	0.791
NZ_CP015308_2	2.23\|851794\|43\|NZ_CP015308\|CRT	851794-851836	43	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19202-19244	9	0.791

1. spacer 2.52|853948|19|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

cgagtccgagtcactgtca	CRISPR spacer
cgagtccgagtcactgtca	Protospacer
*******************

2. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.96

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgaatcgctgtctgagtct	Protospacer
************************

3. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
cgagtctgaatcgctgtcggagtcg	Protospacer
****** ******************

4. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcggaatcactgtcg	Protospacer
.************************

5. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagagtcggaatcgctgtcg	Protospacer
******************.******

6. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagagtccgaatcactgtcg	Protospacer
************ ************

7. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcggagtcggaatcactgtcg	Protospacer
******.******************

8. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctgtctgagtca	Protospacer
*********.**************.

9. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctgtctgagtct	Protospacer
*********.**************

10. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctgtctgagtca	Protospacer
*********.**************.

11. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
cgagtctgaatcgctgtcggagtcg	Protospacer
.***************** ******

12. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtccgagtcgctgtctgagtcg	Protospacer
******.**.***************

13. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgaatcactgtctgagtct	Protospacer
************.***********

14. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgaatctgaatcgctgtctgagtct	Protospacer
***.********************

15. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgaatctgaatcgctgtctgagtct	Protospacer
***.********************

16. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctgtctgagtct	Protospacer
*********.**************

17. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctgtctgagtct	Protospacer
*********.**************

18. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctgtctgagtct	Protospacer
*********.**************

19. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgaatcactgtctgaatcg	Protospacer
************.********.***

20. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgaatcactgtctgagtct	Protospacer
************.***********

21. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgaatcactgtctgagtct	Protospacer
************.***********

22. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgaatcactgtctgagtct	Protospacer
************.***********

23. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctgtctgagtct	Protospacer
*********.**************

24. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctgtctgagtct	Protospacer
*********.**************

25. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgaatctgaatcgctgtctgagtct	Protospacer
***.********************

26. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgaatctgaatcgctgtctgagtct	Protospacer
***.********************

27. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctgtctgagtct	Protospacer
*********.**************

28. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgaatcactgtctgaatcg	Protospacer
************.********.***

29. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgaatcactgtctgaatcg	Protospacer
************.********.***

30. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctgtctgaatcg	Protospacer
*********.***********.***

31. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgaatcactgtctgaatcg	Protospacer
************.********.***

32. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgaatcgctatctgagtct	Protospacer
***************.********

33. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgaatcactgtctgagtct	Protospacer
************.***********

34. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgaatctgaatcgctgtctgagtct	Protospacer
***.********************

35. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgaatctgaatcgctgtctgagtct	Protospacer
***.********************

36. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctgtctgagtct	Protospacer
*********.**************

37. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 2, identity: 0.92

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgaatcactgtctgaatcg	Protospacer
************.********.***

38. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgagtcagaatcactgtcagaatcg	CRISPR spacer
cgagtcagagtcactgtcagaatcc	Protospacer
*********.**************

39. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgagtcagaatcactgtcagaatcg	CRISPR spacer
cgagtcagagtcactgtcagaatcc	Protospacer
*********.**************

40. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcggaatcactgtcagaatcg	Protospacer
 *****.******************

41. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcggaatcactgtcagaatcg	Protospacer
 *****.******************

42. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcggaatcactgtcagaatcg	Protospacer
 *****.******************

43. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgagtcagaatcactgtcagaatcg	CRISPR spacer
ggagtcggaatcactgtcagaatcg	Protospacer
 *****.******************

44. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgagtcagaatcactgtcagaatcg	CRISPR spacer
cgagtccgaatcactgtcggaatcg	Protospacer
****** ***********.******

45. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.92

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtccgaatcactgtcagaatcg	Protospacer
 ***** ******************

46. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgagtcagaatcactgtcagaatcg	CRISPR spacer
cgagtccgaatcactgtcagaatcc	Protospacer
****** *****************

47. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgagtcagaatcactgtcagaatcg	CRISPR spacer
ggagtcggaatcactgtcagaatcg	Protospacer
 *****.******************

48. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgagtcagaatcactgtcagaatcg	CRISPR spacer
cgagtcagagtcgctgtcagaatcg	Protospacer
*********.**.************

49. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggaatcgctgtcagagtcg	Protospacer
 *****************.******

50. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggaatcgctgtcagagtcg	Protospacer
 *****************.******

51. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtcggaatcactgtcggagtcg	Protospacer
 ***********.************

52. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
cgagtccgaatcgctgtcggaatcg	Protospacer
****** **************.***

53. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggaatcgctgtcggagtcc	Protospacer
 ***********************

54. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
cgagtcagagtcgctgtcggagtcg	Protospacer
******.**.***************

55. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgaatccgagtcgctgtcg	Protospacer
*********.***********.***

56. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgaatccgagtcgctgtcg	Protospacer
*********.***********.***

57. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgaatccgagtcgctgtcg	Protospacer
*********.***********.***

58. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcagagtccgagtcgctgtcg	Protospacer
****** **************.***

59. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcggagtccgagtcgctgtcg	Protospacer
****** **************.***

60. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcggagtccgagtcgctgtcg	Protospacer
****** **************.***

61. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcggagtccgagtcgctgtcg	Protospacer
****** **************.***

62. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgaatccgagtcgctgtcg	Protospacer
*********.***********.***

63. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcagagtccgagtcgctgtcg	Protospacer
****** **************.***

64. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcagagtccgagtcgctgtcg	Protospacer
****** **************.***

65. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcagagtccgagtcgctgtcg	Protospacer
****** **************.***

66. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgagtccgaatcgctgtcg	Protospacer
***************.*****.***

67. spacer 2.53|853996|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcagagtccgagtcgctgtcg	Protospacer
****** **************.***

68. spacer 2.53|853996|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgagtcagagtcgctgtcg	Protospacer
************ ********.***

69. spacer 2.53|853996|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgagtcagagtcgctgtcg	Protospacer
************ ********.***

70. spacer 2.53|853996|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgagtcagagtcgctgtcg	Protospacer
************ ********.***

71. spacer 2.53|853996|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcggagtccgagtcgctgtcg	Protospacer
****** **************.***

72. spacer 2.53|853996|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcagagtccgagtcgctgtcg	Protospacer
****** **************.***

73. spacer 2.53|853996|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgagtcagagtcgctgtcg	Protospacer
************ ********.***

74. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtcagagtcgctatcg	Protospacer
******.***** ************

75. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtcagagtcgctatcg	Protospacer
******.***** ************

76. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtcagagtcgctatcg	Protospacer
******.***** ************

77. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtcagagtcgctatcg	Protospacer
******.***** ************

78. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtcagagtcgctatcg	Protospacer
******.***** ************

79. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtcagagtcgctatcg	Protospacer
******.***** ************

80. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtcagagtcgctatcg	Protospacer
******.***** ************

81. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtctgagtcgctatcg	Protospacer
******.*****.************

82. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtcagagtcgctatcg	Protospacer
******.***** ************

83. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtcagagtcgctatcg	Protospacer
******.***** ************

84. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtcagagtcgctatcg	Protospacer
******.***** ************

85. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtcagagtcgctatcg	Protospacer
******.***** ************

86. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtcagagtcgctatcg	Protospacer
******.***** ************

87. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtcagagtcgctatcg	Protospacer
******.***** ************

88. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtcagagtcgctatcg	Protospacer
******.***** ************

89. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtctgagtcgctatcg	Protospacer
******.*****.************

90. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcggaatcactgtcc	Protospacer
.***********************

91. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcggaatcactgtcc	Protospacer
.***********************

92. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcactgtcg	Protospacer
.*********** ************

93. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcactgtcg	Protospacer
.*********** ************

94. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcactgtcg	Protospacer
.*********** ************

95. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcggaatcactgtca	Protospacer
.***********************.

96. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcggaatcactgtca	Protospacer
.***********************.

97. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcggaatcactgtca	Protospacer
.***********************.

98. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcggaatcactgtca	Protospacer
.***********************.

99. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcggaatcactgtca	Protospacer
.***********************.

100. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcggaatcactgtca	Protospacer
.***********************.

101. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcggaatcactgtca	Protospacer
.***********************.

102. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcggaatcactgtca	Protospacer
.***********************.

103. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcggaatcactgtca	Protospacer
.***********************.

104. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcggaatcactgtca	Protospacer
.***********************.

105. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcggaatcactgtca	Protospacer
.***********************.

106. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcggagtcactgtcg	Protospacer
.**************.*********

107. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagaatcggaatcactgtcg	Protospacer
.********.***************

108. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagagtcggaatcgctgtcc	Protospacer
******************.*****

109. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcggaatcgctgtcg	Protospacer
.*****************.******

110. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagaatcggaatcactgtcg	Protospacer
.********.***************

111. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagagtcggaatcgctgtcc	Protospacer
******************.*****

112. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcggagtcggaatcactgtca	Protospacer
******.*****************.

113. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcggagtcactgtcg	Protospacer
.**************.*********

114. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcggaatcgctgtcg	Protospacer
.*****************.******

115. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcactgtcg	Protospacer
.*********** ************

116. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagagtccgaatcgctgtcg	Protospacer
************ *****.******

117. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagagtccgaatcgctgtcg	Protospacer
************ *****.******

118. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcggaatcactgtca	Protospacer
.***********************.

119. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcactgtcg	Protospacer
.*********** ************

120. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagagtccgaatcactgtca	Protospacer
************ ***********.

121. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtctgaatcactgtcg	Protospacer
.*********** ************

122. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtctgaatcactgtcg	Protospacer
.*********** ************

123. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtctgaatcactgtcg	Protospacer
.*********** ************

124. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtctgaatcactgtcg	Protospacer
.*********** ************

125. spacer 2.27|852058|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

ggaatctgagtcactgtcgctatcc	CRISPR spacer
tgaatctgaatcactgtcgctatct	Protospacer
 ********.**************.

126. spacer 2.27|852058|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

ggaatctgagtcactgtcgctatcc	CRISPR spacer
tgaatctgaatcactgtcgctatct	Protospacer
 ********.**************.

127. spacer 2.27|852058|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggaatctgagtcactgtcgctatcc	CRISPR spacer
cgaatccgagtcgctgtcgctatcc	Protospacer
 *****.*****.************

128. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctatctgagtca	Protospacer
*********.*****.********.

129. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctatctgagtct	Protospacer
*********.*****.********

130. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtcagagtcgctgtctgagtca	Protospacer
****** **.**************.

131. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtcagagtcgctgtctgagtct	Protospacer
****** **.**************

132. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctatctgagtca	Protospacer
*********.*****.********.

133. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctatctgagtct	Protospacer
*********.*****.********

134. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtcagagtcgctgtctgagtct	Protospacer
****** **.**************

135. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctatctgagtct	Protospacer
*********.*****.********

136. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctatctgagtct	Protospacer
*********.*****.********

137. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
agagtcggaatcgctgtcagagtcg	Protospacer
 ***** *********** ******

138. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
agagtcggaatcgctgtcagagtcg	Protospacer
 ***** *********** ******

139. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
agagtccgaatcgctgtcagagtcg	Protospacer
 *****.*********** ******

140. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
agagtccgaatcgctgtcagagtcg	Protospacer
 *****.*********** ******

141. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctatctgagtct	Protospacer
*********.*****.********

142. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctgtctgaatct	Protospacer
*********.***********.**

143. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgaatctgagtcgctgtctgagtct	Protospacer
***.*****.**************

144. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgaatcgctatctgaatct	Protospacer
***************.*****.**

145. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgaatctgaatcactgtctgagtcc	Protospacer
***.********.***********

146. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctgtctgaatct	Protospacer
*********.***********.**

147. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgaatctgagtcgctgtctgagtct	Protospacer
***.*****.**************

148. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctatctgagtct	Protospacer
*********.*****.********

149. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctatctgagtct	Protospacer
*********.*****.********

150. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctatctgagtct	Protospacer
*********.*****.********

151. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgaatcgctatctgaatct	Protospacer
***************.*****.**

152. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgaatctgaatcactgtctgagtcc	Protospacer
***.********.***********

153. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctgtctgaatct	Protospacer
*********.***********.**

154. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgaatctgagtcgctgtctgagtct	Protospacer
***.*****.**************

155. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctatctgagtct	Protospacer
*********.*****.********

156. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgagtcgctgtctgaatct	Protospacer
*********.***********.**

157. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgaatctgagtcgctgtctgagtct	Protospacer
***.*****.**************

158. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgaatcgctatctgaatct	Protospacer
***************.*****.**

159. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgaatctgaatcactgtctgagtcc	Protospacer
***.********.***********

160. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgaatctgaatcgctgtctgaatct	Protospacer
***.*****************.**

161. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgaatctgagtcgctgtctgagtct	Protospacer
***.*****.**************

162. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgagtctgaatcgctatctgaatct	Protospacer
***************.*****.**

163. spacer 2.37|852874|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
tgaatctgaatcactgtctgagtcc	Protospacer
***.********.***********

164. spacer 2.37|852874|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
ggagtctgagtcgctgtcggagtcg	Protospacer
 ********.******** ******

165. spacer 2.37|852874|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
ggagtccgaatcgctgtcagagtcg	Protospacer
 *****.*********** ******

166. spacer 2.37|852874|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
ggagtccgaatcgctgtcagagtcg	Protospacer
 *****.*********** ******

167. spacer 2.37|852874|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
agagtcagaatcgctgtccgagtcg	Protospacer
 ***** ***********.******

168. spacer 2.38|852928|49|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.939

cgaatccgagtcactgtcggagtccgaatcactgtccgaatccgagtct	CRISPR spacer
cgaatccgagtcgctgtcggagtccgaatcgctgtccgaatccgagtcg	Protospacer
************.*****************.*****************

169. spacer 2.39|853006|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgagtcggagtcactgtcgctgtcc	CRISPR spacer
ggagtcggagtcactgtcggagtcc	Protospacer
 ******************  ****

170. spacer 2.39|853006|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgagtcggagtcactgtcgctgtcc	CRISPR spacer
agagtcggagtcactgtcggagtcc	Protospacer
 ******************  ****

171. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
ggagtccgaatcactgtcagaatcc	Protospacer
 ***** *****************

172. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
ggagtccgaatcactgtcagaatcc	Protospacer
 ***** *****************

173. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
ggagtccgaatcgctgtcagaatcg	Protospacer
 ***** *****.************

174. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtccgaatcgctgtcagaatcg	Protospacer
 ***** *****.************

175. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcggaatcactgtcagagtcg	Protospacer
 *****.**************.***

176. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
ggagtccgaatcactgtcagagtcg	Protospacer
 ***** **************.***

177. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
cgagtccgaatcgctgtcagaatcc	Protospacer
****** *****.***********

178. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcggaatcactgtcagagtcg	Protospacer
 *****.**************.***

179. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
ggagtccgaatcactgtcagagtcg	Protospacer
 ***** **************.***

180. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
cgagtccgaatcactgtccgaatcc	Protospacer
****** *********** *****

181. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
ggagtcggaatcgctgtcagaatcg	Protospacer
 *****.*****.************

182. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
ggagtcggaatcgctgtcagaatcg	Protospacer
 *****.*****.************

183. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
cgaatcggaatcactgtcagaatcc	Protospacer
***.**.*****************

184. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtccgaatcactgtcggaatcg	Protospacer
 ***** ***********.******

185. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcggaatcgctgtcagaatcg	Protospacer
 *****.*****.************

186. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
ggagtcagagtcgctgtcagaatcg	Protospacer
 ********.**.************

187. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtccgaatcactgtcggaatcg	Protospacer
 ***** ***********.******

188. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
cgagtcagagtcgctgtcagaatcc	Protospacer
*********.**.***********

189. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtctgaatcactgtcagaatcc	Protospacer
 ***** *****************

190. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtccgaatcactgtcagaatcc	Protospacer
 ***** *****************

191. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcagaatcgctgtcagaatcc	Protospacer
 ***********.***********

192. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
ggagtcagagtcgctgtcagaatcg	Protospacer
 ********.**.************

193. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
cgagtccgaatcactgtcggaatcc	Protospacer
****** ***********.*****

194. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
cgagtcagagtcgctgtcagaatcc	Protospacer
*********.**.***********

195. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
cgagtccgaatcactgtcagcatcc	Protospacer
****** ************* ***

196. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcagaatcgctgtcggaatcg	Protospacer
 ***********.*****.******

197. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtccgaatcactgtcggaatcg	Protospacer
 ***** ***********.******

198. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
cgagtccgagtcactgtcagaatcc	Protospacer
****** **.**************

199. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
ggagtcagagtcgctgtcagaatcg	Protospacer
 ********.**.************

200. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
cgagtccgaatcactgtccgaatcc	Protospacer
****** *********** *****

201. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtccgaatcactgtcggaatcg	Protospacer
 ***** ***********.******

202. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
cgagtccgaatcgctgtcagaatcc	Protospacer
****** *****.***********

203. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcggaatcactgtccgaatcg	Protospacer
 *****.*********** ******

204. spacer 2.45|853492|25|NZ_CP015308|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
tgagtctgaatcactgtctgaatcg	Protospacer
.***** *********** ******

205. spacer 2.45|853492|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
tgagtctgaatcactgtctgaatcg	Protospacer
.***** *********** ******

206. spacer 2.45|853492|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
tgagtctgaatcactgtctgaatcg	Protospacer
.***** *********** ******

207. spacer 2.45|853492|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
tgagtctgaatcactgtctgaatcg	Protospacer
.***** *********** ******

208. spacer 2.45|853492|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

cgagtcagaatcactgtcagaatcg	CRISPR spacer
tgagtctgaatcactgtctgaatcg	Protospacer
.***** *********** ******

209. spacer 2.47|853618|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgaatctgagtcggaatcgctgtcg	CRISPR spacer
cgagtcagagtcggaatcgctgtca	Protospacer
***.** *****************.

210. spacer 2.47|853618|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgaatctgagtcggaatcgctgtcg	CRISPR spacer
cgagtcagagtcggaatcgctgtca	Protospacer
***.** *****************.

211. spacer 2.47|853618|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

cgaatctgagtcggaatcgctgtcg	CRISPR spacer
tgagtctgagtctgaatcgctgtcg	Protospacer
.**.******** ************

212. spacer 2.47|853618|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

cgaatctgagtcggaatcgctgtcg	CRISPR spacer
tgagtctgagtctgaatcgctgtcg	Protospacer
.**.******** ************

213. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtcggaatcgctgtcggaatcc	Protospacer
 ********************.**

214. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtcggaatcgctgtcggaatcc	Protospacer
 ********************.**

215. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtccgaatcgctgtcggagtcc	Protospacer
 ***** *****************

216. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtccgaatcgctgtcggagtcc	Protospacer
 ***** *****************

217. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtccgaatcgctgtcggagtcc	Protospacer
 ***** *****************

218. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggaatcgctgtcagagtcc	Protospacer
 *****************.*****

219. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggaatcgctgtcggaatcc	Protospacer
 ********************.**

220. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggaatcgctgtccgagtcc	Protospacer
 ***************** *****

221. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggaatcgctgtcggaatcc	Protospacer
 ********************.**

222. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtccgaatcgctgtcggagtcc	Protospacer
 ***** *****************

223. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtcggaatcgctgtcggaatcc	Protospacer
 ********************.**

224. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtccgaatcgctgtcggagtcc	Protospacer
 ***** *****************

225. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agaatcggaatcgctgtcggagtcc	Protospacer
 **.********************

226. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
cgaatcggaatcactgtcggagtcc	Protospacer
***.********.***********

227. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
cgaatccgaatcgctgtcggagtcc	Protospacer
***.** *****************

228. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agaatccgaatcgctgtcggagtcg	Protospacer
 **.** ******************

229. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtccgaatcgctgtcagagtcg	Protospacer
 ***** ***********.******

230. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggagtcactgtcggagtcg	Protospacer
 ********.**.************

231. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agaatcggaatcgctgtcagagtcg	Protospacer
 **.**************.******

232. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtccgaatcactgtcggagtcg	Protospacer
 ***** *****.************

233. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
cgaatcggaatcactgtcggagtcc	Protospacer
***.********.***********

234. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
cgaatcggaatcactgtcggagtcc	Protospacer
***.********.***********

235. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
cgaatcggaatcactgtcggagtcc	Protospacer
***.********.***********

236. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
cgaatcggaatcactgtcggagtcc	Protospacer
***.********.***********

237. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggaatcactgtcagagtcg	Protospacer
 ***********.*****.******

238. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
tgagtcggaatcgctgtccgaatcg	Protospacer
.***************** **.***

239. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agaatccgaatcgctgtcggagtcg	Protospacer
 **.** ******************

240. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggaatcactgtcagagtcg	Protospacer
 ***********.*****.******

241. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggaatcggaatcactgtcggagtcg	Protospacer
 **.********.************

242. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agaatccgaatcgctgtcggagtcg	Protospacer
 **.** ******************

243. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtcggaatcgctgtcagaatcg	Protospacer
 *****************.**.***

244. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtcggaatcgctgtcagaatcg	Protospacer
 *****************.**.***

245. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtccgaatcgctgtcagagtcg	Protospacer
 ***** ***********.******

246. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggaatcgctgtccgaatcg	Protospacer
 ***************** **.***

247. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtccgaatcgctgtcggaatcg	Protospacer
 ***** **************.***

248. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
cgagtccgaatcactgtcggagtcc	Protospacer
****** *****.***********

249. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggaatcgctgtcagaatcg	Protospacer
 *****************.**.***

250. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtcggaatcgctgtcagagtct	Protospacer
 *****************.*****

251. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtccgagtcgctgtcggagtcg	Protospacer
 ***** **.***************

252. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcagaatcgctgtcggaatcg	Protospacer
 *****.**************.***

253. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agaatccgaatcgctgtcggagtcg	Protospacer
 **.** ******************

254. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
cgagtcggagtcgctgtcagagtcc	Protospacer
*********.********.*****

255. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtctgagtcgctgtcggagtcg	Protospacer
 ***** **.***************

256. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
cgagtcagagtcgctgtcggagtct	Protospacer
******.**.**************

257. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agaatccgaatcgctgtcggagtcg	Protospacer
 **.** ******************

258. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtccgagtcgctgtcggagtcg	Protospacer
 ***** **.***************

259. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtccgaatcgctgtcagagtcg	Protospacer
 ***** ***********.******

260. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtccgaatcgctgtcagagtcg	Protospacer
 ***** ***********.******

261. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcagaatcgctgtccgagtcg	Protospacer
 *****.*********** ******

262. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
cgagtcggagtcgctgtccgagtca	Protospacer
*********.******** *****.

263. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
cgagtcagagtcgctgtcggagtct	Protospacer
******.**.**************

264. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.88

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtccgagtcgctgtcggagtcg	Protospacer
 ***** **.***************

265. spacer 2.50|853816|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctatctgaatcactgtcagagtcg	CRISPR spacer
gctatccgaatcgctgtcagagtcc	Protospacer
******.*****.***********

266. spacer 2.50|853816|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctatctgaatcactgtcagagtcg	CRISPR spacer
actatccgaatcgctgtcagagtcg	Protospacer
.*****.*****.************

267. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcggagtccgagtcgctgtca	Protospacer
****** **************.**.

268. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtcagagtccgagtcgctgtcg	Protospacer
.***** **************.***

269. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgaatccgagtcgctgtcc	Protospacer
*********.***********.**

270. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgaatccgagtcgctgtcc	Protospacer
*********.***********.**

271. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgagtccgaatcgctgtcc	Protospacer
***************.*****.**

272. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcagagtccgagtcgctgtca	Protospacer
****** **************.**.

273. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgaatccgagtcgctgtca	Protospacer
*********.***********.**.

274. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtccgaatccgagtcgctgtcg	Protospacer
.********.***********.***

275. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcagagtccgagtcgctgtcc	Protospacer
****** **************.**

276. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcagagtccgagtcgctgtcc	Protospacer
****** **************.**

277. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgaatccgagtcgctgtca	Protospacer
*********.***********.**.

278. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcagagtccgagtcgctgtca	Protospacer
****** **************.**.

279. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgaatccgagtcgctgtcc	Protospacer
*********.***********.**

280. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgaatccgagtcgctgtcc	Protospacer
*********.***********.**

281. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgaatccgagtcgctgtca	Protospacer
*********.***********.**.

282. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgaatccgagtcgctgtcc	Protospacer
*********.***********.**

283. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgaatccgagtcgctgtca	Protospacer
*********.***********.**.

284. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtcggagtccgagtcgctgtcg	Protospacer
.***** **************.***

285. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgaatccgagtcgctgtca	Protospacer
*********.***********.**.

286. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtcggagtccgagtcgctgtcg	Protospacer
.***** **************.***

287. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtcagagtccgagtcgctgtcg	Protospacer
.***** **************.***

288. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtcggagtccgagtcgctgtcg	Protospacer
.***** **************.***

289. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgaatccgagtcgctgtcc	Protospacer
*********.***********.**

290. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgaatccgagtcgctgtcc	Protospacer
*********.***********.**

291. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgagtccgaatcgctgtca	Protospacer
***************.*****.**.

292. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcagagtccgagtcgctgtca	Protospacer
****** **************.**.

293. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcagagtccgagtcgctgtct	Protospacer
****** **************.**

294. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtccgagtcgctgtct	Protospacer
******.**************.**

295. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtcggagtccgagtcgctgtcg	Protospacer
.***** **************.***

296. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtcagagtccgagtcgctgtcg	Protospacer
.***** **************.***

297. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcggagtccgagtcgctgtca	Protospacer
****** **************.**.

298. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtcggagtccgagtcgctgtcg	Protospacer
.***** **************.***

299. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcggagtccgagtcgctgtca	Protospacer
****** **************.**.

300. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcggagtccgagtcgctgtca	Protospacer
****** **************.**.

301. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcagagtccgagtcgctgtca	Protospacer
****** **************.**.

302. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcagagtccgagtcgctgtca	Protospacer
****** **************.**.

303. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcagagtccgagtcgctgtca	Protospacer
****** **************.**.

304. spacer 2.53|853996|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcagagtccgagtcgctgtca	Protospacer
****** **************.**.

305. spacer 2.53|853996|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgagtcagagtcgctgtcc	Protospacer
************ ********.**

306. spacer 2.53|853996|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgagtcagagtcgctgtcc	Protospacer
************ ********.**

307. spacer 2.53|853996|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgagtcagagtcgctgtca	Protospacer
************ ********.**.

308. spacer 2.53|853996|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtcagagtccgagtcgctgtcc	Protospacer
****** **************.**

309. spacer 2.53|853996|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgagtcggagtcgctgtca	Protospacer
************ ********.**.

310. spacer 2.53|853996|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgagtcagagtcgctgtcc	Protospacer
************ ********.**

311. spacer 2.53|853996|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtcagagtccgagtcgctgtcg	Protospacer
.***** **************.***

312. spacer 2.53|853996|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtcagagtccgagtcgctgtcg	Protospacer
.***** **************.***

313. spacer 2.53|853996|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgagtccgaatcgctgtca	Protospacer
***************.*****.**.

314. spacer 2.53|853996|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgagtcggagtcgctgtca	Protospacer
************ ********.**.

315. spacer 2.53|853996|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgagtcggagtcgctgtcc	Protospacer
************ ********.**

316. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtctgagtcgctatct	Protospacer
******.*****.***********

317. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtctgagtcgctatct	Protospacer
******.*****.***********

318. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtctgagtcgctatct	Protospacer
******.*****.***********

319. spacer 2.53|853996|25|NZ_CP015308|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgagtcagagtcgctgtca	Protospacer
************ ********.**.

320. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtctgagtcgctatct	Protospacer
******.*****.***********

321. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtctgagtcgctatct	Protospacer
******.*****.***********

322. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtctgagtcgctatct	Protospacer
******.*****.***********

323. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtctgagtctgagtcgctatct	Protospacer
******.*****.***********

324. spacer 2.53|853996|25|NZ_CP015308|CRT matches to MT521994 (Gordonia phage Magel, complete genome) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgactccgagtcgctttca	Protospacer
********* *********** **.

325. spacer 2.53|853996|25|NZ_CP015308|CRT matches to MG962368 (Gordonia phage Gravy, complete genome) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgactccgagtcgctttca	Protospacer
********* *********** **.

326. spacer 2.53|853996|25|NZ_CP015308|CRT matches to MN585988 (Gordonia Phage Odesza, complete genome) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgactccgagtcgctttca	Protospacer
********* *********** **.

327. spacer 2.53|853996|25|NZ_CP015308|CRT matches to MG962369 (Gordonia phage Kerry, complete genome) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgactccgagtcgctttca	Protospacer
********* *********** **.

328. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NC_048817 (Gordonia phage Tanis, complete genome) position: , mismatch: 3, identity: 0.88

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gctgtccgactccgagtcgctttca	Protospacer
********* *********** **.

329. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtctgaatcactgtca	Protospacer
.*********** ***********.

330. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcactgtca	Protospacer
.*********** ***********.

331. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcggagtcggaatcactgtca	Protospacer
.*****.*****************.

332. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgagtcactgtcg	Protospacer
.*********** **.*********

333. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagagtccgaatcgctgtcc	Protospacer
************ *****.*****

334. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtccgagtccgaatcactgtcg	Protospacer
.***** ***** ************

335. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagaatccgaatcactgtcg	Protospacer
.********.** ************

336. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcagaatcgctgtcg	Protospacer
.***********.*****.******

337. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagagtccgaatcgctgtca	Protospacer
************ *****.*****.

338. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagagtcagaatcgctgtca	Protospacer
************.*****.*****.

339. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagagtcggagtcgctgtcc	Protospacer
***************.**.*****

340. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagaatccgaatcactgtcg	Protospacer
.********.** ************

341. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcggagtcggagtcactgtcg	Protospacer
.*****.********.*********

342. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcagagtcactgtcg	Protospacer
.***********.**.*********

343. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagaatccgaatcactgtcg	Protospacer
.********.** ************

344. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcggaatcgctgtca	Protospacer
.*****************.*****.

345. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcggagtcactgtca	Protospacer
.**************.********.

346. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcggaatcgctgtcc	Protospacer
.*****************.*****

347. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcggaatcgctgtca	Protospacer
.*****************.*****.

348. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcggagtcggaatcgctgtcg	Protospacer
.*****.***********.******

349. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcggagtcggaatcgctgtcg	Protospacer
.*****.***********.******

350. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcgctgtcg	Protospacer
.*********** *****.******

351. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtccgaatcggaatcactgtcg	Protospacer
.***** **.***************

352. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcggagtccgaatcactgtcc	Protospacer
******.***** ***********

353. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagaatcggagtcactgtcc	Protospacer
*********.*****.********

354. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagagtccgaatcgctgtcc	Protospacer
************ *****.*****

355. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagaatcggagtcactgtcg	Protospacer
.********.*****.*********

356. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcggagtcggaatcgctgtcc	Protospacer
******.***********.*****

357. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagaatcggaatcgctgtca	Protospacer
*********.********.*****.

358. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcggagtcggaatcgctgtca	Protospacer
******.***********.*****.

359. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagagtccgaatcgctgtca	Protospacer
************ *****.*****.

360. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtccgaatcggaatcactgtcg	Protospacer
.***** **.***************

361. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtccgaatcggaatcactgtcg	Protospacer
.***** **.***************

362. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagagtccgaatcgctgtca	Protospacer
************ *****.*****.

363. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtccgaatcggaatcactgtcg	Protospacer
.***** **.***************

364. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagagtccgaatcgctgtca	Protospacer
************ *****.*****.

365. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtccgaatcggaatcactgtcg	Protospacer
.***** **.***************

366. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcggagtccgaatcactgtca	Protospacer
******.***** ***********.

367. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcggagtcggagtcactgtcg	Protospacer
.*****.********.*********

368. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcggagtccgaatcactgtca	Protospacer
******.***** ***********.

369. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcggaatcggaatcactgtcg	Protospacer
.*****.**.***************

370. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagaatcggaatcgctgtca	Protospacer
*********.********.*****.

371. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagaatcggaatcgctgtcg	Protospacer
.********.********.******

372. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagaatccgaatcactgtca	Protospacer
*********.** ***********.

373. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtctgaatcggaatcactgtcg	Protospacer
.***** **.***************

374. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcggagtccgaatcactgtca	Protospacer
******.***** ***********.

375. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcggagtcggaatcgctgtca	Protospacer
******.***********.*****.

376. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcggagtcggaatcgctgtca	Protospacer
******.***********.*****.

377. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcggagtcggaatcgctgtcg	Protospacer
.*****.***********.******

378. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagagtcagagtcactgtca	Protospacer
************.**.********.

379. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagagtccgaatcgctgtca	Protospacer
************ *****.*****.

380. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcagagtcactgtcg	Protospacer
.***********.**.*********

381. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcgctgtcg	Protospacer
.*********** *****.******

382. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtccgagtccgaatcactgtcg	Protospacer
.***** ***** ************

383. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagagtccgagtcactgtca	Protospacer
************ **.********.

384. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagagtccgagtcactgtca	Protospacer
************ **.********.

385. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtccgagtccgaatcactgtcg	Protospacer
.***** ***** ************

386. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagaatcggaatcgctgtcg	Protospacer
.********.********.******

387. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtcagaatcggagtcactgtca	Protospacer
*********.*****.********.

388. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtctgagtctgaatcactgtcg	Protospacer
.***** ***** ************

389. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtctgagtctgaatcactgtcg	Protospacer
.***** ***** ************

390. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtctgagtctgaatcactgtcg	Protospacer
.***** ***** ************

391. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtctgagtctgaatcactgtcg	Protospacer
.***** ***** ************

392. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtctgagtctgaatcactgtcg	Protospacer
.***** ***** ************

393. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtctgagtctgaatcactgtcg	Protospacer
.***** ***** ************

394. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtctgagtctgaatcactgtcg	Protospacer
.***** ***** ************

395. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtctgagtctgaatcactgtcg	Protospacer
.***** ***** ************

396. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtctgagtctgaatcactgtcg	Protospacer
.***** ***** ************

397. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtctgagtctgaatcactgtcg	Protospacer
.***** ***** ************

398. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtctgagtctgaatcactgtcg	Protospacer
.***** ***** ************

399. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtctgagtctgaatcactgtcg	Protospacer
.***** ***** ************

400. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtctgagtctgaatcactgtcg	Protospacer
.***** ***** ************

401. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtctgagtctgaatcactgtcg	Protospacer
.***** ***** ************

402. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtctgagtctgaatcactgtcg	Protospacer
.***** ***** ************

403. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtctgagtctgaatcactgtct	Protospacer
****** ***** ***********

404. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtctgagtctgaatcactgtct	Protospacer
****** ***** ***********

405. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtctgagtctgaatcactgtct	Protospacer
****** ***** ***********

406. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtctgagtctgaatcactgtct	Protospacer
****** ***** ***********

407. spacer 2.56|854194|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

actgtcagagtcggaatcactgtcg	CRISPR spacer
actgtctgagtctgaatcactgtct	Protospacer
****** ***** ***********

408. spacer 2.25|851938|31|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgagtcggagtcactgtcgctgtccgaatcc	CRISPR spacer
ggagtcggagtcactgtcggagtccgaatcg	Protospacer
 ******************  *********

409. spacer 2.25|851938|31|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

cgagtcggagtcactgtcgctgtccgaatcc	CRISPR spacer
agagtcggagtcactgtcggagtccgaatca	Protospacer
 ******************  *********

410. spacer 2.27|852058|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ggaatctgagtcactgtcgctatcc	CRISPR spacer
tgagtctgaatcactgtcgctatct	Protospacer
 **.*****.**************.

411. spacer 2.27|852058|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ggaatctgagtcactgtcgctatcc	CRISPR spacer
tgagtctgaatcactgtcgctatct	Protospacer
 **.*****.**************.

412. spacer 2.27|852058|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ggaatctgagtcactgtcgctatcc	CRISPR spacer
tgagtctgaatcactgtcgctatct	Protospacer
 **.*****.**************.

413. spacer 2.27|852058|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ggaatctgagtcactgtcgctatcc	CRISPR spacer
agagtctgaatcactgtcgctatct	Protospacer
.**.*****.**************.

414. spacer 2.27|852058|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ggaatctgagtcactgtcgctatcc	CRISPR spacer
tgagtctgaatcactgtcgctatct	Protospacer
 **.*****.**************.

415. spacer 2.27|852058|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ggaatctgagtcactgtcgctatcc	CRISPR spacer
tgagtctgaatcactgtcgctatct	Protospacer
 **.*****.**************.

416. spacer 2.27|852058|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ggaatctgagtcactgtcgctatcc	CRISPR spacer
tgagtctgaatcactgtcgctatct	Protospacer
 **.*****.**************.

417. spacer 2.27|852058|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ggaatctgagtcactgtcgctatcc	CRISPR spacer
agagtctgaatcactgtcgctatct	Protospacer
.**.*****.**************.

418. spacer 2.27|852058|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ggaatctgagtcactgtcgctatcc	CRISPR spacer
tgagtctgaatcactgtcgctatct	Protospacer
 **.*****.**************.

419. spacer 2.27|852058|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ggaatctgagtcactgtcgctatcc	CRISPR spacer
tgagtctgaatcactgtcgctatct	Protospacer
 **.*****.**************.

420. spacer 2.27|852058|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ggaatctgagtcactgtcgctatcc	CRISPR spacer
agagtctgaatcactgtcgctatct	Protospacer
.**.*****.**************.

421. spacer 2.27|852058|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ggaatctgagtcactgtcgctatcc	CRISPR spacer
tgagtctgaatcactgtcgctatct	Protospacer
 **.*****.**************.

422. spacer 2.27|852058|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ggaatctgagtcactgtcgctatcc	CRISPR spacer
tgagtctgaatcactgtcgctatct	Protospacer
 **.*****.**************.

423. spacer 2.27|852058|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ggaatctgagtcactgtcgctatcc	CRISPR spacer
agagtctgaatcactgtcgctatct	Protospacer
.**.*****.**************.

424. spacer 2.27|852058|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ggaatctgagtcactgtcgctatcc	CRISPR spacer
tgagtctgaatcactgtcgctatct	Protospacer
 **.*****.**************.

425. spacer 2.27|852058|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ggaatctgagtcactgtcgctatcc	CRISPR spacer
tgagtctgaatcactgtcgctatct	Protospacer
 **.*****.**************.

426. spacer 2.27|852058|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ggaatctgagtcactgtcgctatcc	CRISPR spacer
tgagtctgaatcactgtcgctatct	Protospacer
 **.*****.**************.

427. spacer 2.27|852058|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ggaatctgagtcactgtcgctatcc	CRISPR spacer
tgagtctgaatcactgtcgctatct	Protospacer
 **.*****.**************.

428. spacer 2.27|852058|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ggaatctgagtcactgtcgctatcc	CRISPR spacer
tgaatcagagtcgctgtcgctatct	Protospacer
 ***** *****.***********.

429. spacer 2.27|852058|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ggaatctgagtcactgtcgctatcc	CRISPR spacer
tgagtctgaatcactgtcgctatct	Protospacer
 **.*****.**************.

430. spacer 2.27|852058|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

ggaatctgagtcactgtcgctatcc	CRISPR spacer
cgaatccgagtcactgtcgctgtcg	Protospacer
 *****.**************.**

431. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
ggagtccgaatcgctgtcggagtcc	Protospacer
 *****.*********** *****

432. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
ggagtccgaatcgctgtcggagtcc	Protospacer
 *****.*********** *****

433. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
ggagtccgaatcgctgtcggagtcc	Protospacer
 *****.*********** *****

434. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
agagtccgaatcgctgtcagagtca	Protospacer
 *****.*********** *****.

435. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
ggagtccgaatcgctgtcagagtcc	Protospacer
 *****.*********** *****

436. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
agagtccgaatcgctgtcagagtcc	Protospacer
 *****.*********** *****

437. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
agagtcggaatcgctgtcagagtcc	Protospacer
 ***** *********** *****

438. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
ggagtccgaatcgctgtcagagtca	Protospacer
 *****.*********** *****.

439. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
agagtccgagtcgctgtctgagtcc	Protospacer
 *****.**.**************

440. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
agagtcggaatcgctgtccgagtcc	Protospacer
 ***** ***********.*****

441. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
ggagtccgaatcgctgtcggagtcc	Protospacer
 *****.*********** *****

442. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
ggagtccgaatcgctgtcagagtcc	Protospacer
 *****.*********** *****

443. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
ggagtccgaatcgctgtcggagtcc	Protospacer
 *****.*********** *****

444. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
ggagtccgaatcgctgtcagagtcc	Protospacer
 *****.*********** *****

445. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
agagtccgaatcgctgtcagagtca	Protospacer
 *****.*********** *****.

446. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
agagtccgaatcgctgtcagagtca	Protospacer
 *****.*********** *****.

447. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
ggagtccgaatcgctgtcagagtcc	Protospacer
 *****.*********** *****

448. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
agagtccgaatcgctgtccgagtcc	Protospacer
 *****.***********.*****

449. spacer 2.37|852874|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
agagtccgaatcgctgtcagagtcc	Protospacer
 *****.*********** *****

450. spacer 2.37|852874|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
ggagtcggaatcgctgtcagagtct	Protospacer
 ***** *********** *****

451. spacer 2.37|852874|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
ggagtccgaatcgctgtcagagtcc	Protospacer
 *****.*********** *****

452. spacer 2.37|852874|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
agagtccgaatcgctgtccgagtca	Protospacer
 *****.***********.*****.

453. spacer 2.37|852874|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
ggagtccgaatcgctgtccgagtca	Protospacer
 *****.***********.*****.

454. spacer 2.37|852874|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
ggagtccgaatcgctgtcagagtcc	Protospacer
 *****.*********** *****

455. spacer 2.37|852874|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
agagtccgaatcgctgtccgagtca	Protospacer
 *****.***********.*****.

456. spacer 2.37|852874|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
agagtcggaatcgctgtcggagtcc	Protospacer
 ***** *********** *****

457. spacer 2.37|852874|25|NZ_CP015308|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
agagtccgaatcgctgtcagagtca	Protospacer
 *****.*********** *****.

458. spacer 2.37|852874|25|NZ_CP015308|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.84

tgagtctgaatcgctgtctgagtcg	CRISPR spacer
ggagtccgaatcgctgtccgagtca	Protospacer
 *****.***********.*****.

459. spacer 2.38|852928|49|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.918

cgaatccgagtcactgtcggagtccgaatcactgtccgaatccgagtct	CRISPR spacer
agaatccgagtcactgtcggagtccgaatcgctgtcggaatccgagtcg	Protospacer
 *****************************.***** ***********

460. spacer 2.39|853006|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtcggagtcactgtcgctgtcc	CRISPR spacer
agagtcggagtcactgtcggagtcg	Protospacer
 ******************  ***

461. spacer 2.39|853006|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtcggagtcactgtcgctgtcc	CRISPR spacer
agagtccgaatcactgtcgctgtcg	Protospacer
 ***** **.**************

462. spacer 2.39|853006|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtcggagtcactgtcgctgtcc	CRISPR spacer
cgaatccgagtcactgtcgctgtcg	Protospacer
.**.** *****************

463. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcagagtcgctgtcagaatcc	Protospacer
 ********.**.***********

464. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtccgaatcgctgtcagaatcc	Protospacer
 ***** *****.***********

465. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
ggagtccgagtcactgtcagaatcc	Protospacer
 ***** **.**************

466. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtccgaatcgctgtcagaatcc	Protospacer
 ***** *****.***********

467. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcagagtcactgtcagagtcc	Protospacer
 ********.***********.**

468. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcggaatcactgtcagagtcc	Protospacer
 *****.**************.**

469. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtccgaatcgctgtcagaatcc	Protospacer
 ***** *****.***********

470. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcggaatcactgtcagagtcc	Protospacer
 *****.**************.**

471. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcggaatcactgtcagagtcc	Protospacer
 *****.**************.**

472. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtccgaatcgctgtcagaatcc	Protospacer
 ***** *****.***********

473. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcggaatcactgtcagagtcc	Protospacer
 *****.**************.**

474. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcggaatcactgtcagagtcc	Protospacer
 *****.**************.**

475. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtccgaatcgctgtcagaatcc	Protospacer
 ***** *****.***********

476. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcggaatcactgtcagagtcc	Protospacer
 *****.**************.**

477. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtccgaatcgctgtcagaatcc	Protospacer
 ***** *****.***********

478. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtccgaatcgctgtcagaatcc	Protospacer
 ***** *****.***********

479. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
ggagtccgagtcactgtcagaatcc	Protospacer
 ***** **.**************

480. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcggagtcactgtcagaatcc	Protospacer
 *****.**.**************

481. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agaatccgaatcactgtcagaatcc	Protospacer
 **.** *****************

482. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcagagtcactgtcagagtca	Protospacer
 ********.***********.**.

483. spacer 2.45|853492|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcagagtcactgtcagagtcc	Protospacer
 ********.***********.**

484. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcagagtcgctgtcagaatcc	Protospacer
 ********.**.***********

485. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcggaatcactgtcagagtcc	Protospacer
 *****.**************.**

486. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtccgaatcgctgtcagaatcc	Protospacer
 ***** *****.***********

487. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
ggagtcggaatcgctgtcagaatcc	Protospacer
 *****.*****.***********

488. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
ggagtcggaatcgctgtcagaatcc	Protospacer
 *****.*****.***********

489. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
ggagtccgaatcgctgtcagaatcc	Protospacer
 ***** *****.***********

490. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
ggaatcggaatcactgtcagaatcc	Protospacer
 **.**.*****************

491. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcggaatcactgtcggaatcc	Protospacer
 *****.***********.*****

492. spacer 2.45|853492|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcagaatcactgtcagaatcg	CRISPR spacer
agagtcagagtcactgtcggaatcc	Protospacer
 ********.********.*****

493. spacer 2.47|853618|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

cgaatctgagtcggaatcgctgtcg	CRISPR spacer
gctatctgagtctgaatcgctgtcg	Protospacer
   ********* ************

494. spacer 2.47|853618|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

cgaatctgagtcggaatcgctgtcg	CRISPR spacer
tttatctgagtctgaatcgctgtcg	Protospacer
.  ********* ************

495. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtccgagtcgctgtcggagtcc	Protospacer
 ***** **.**************

496. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtcggaatcgctgtccgaatcc	Protospacer
 ***************** **.**

497. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtccgaatcgctgtcggaatcc	Protospacer
 ***** **************.**

498. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agaatcggagtcgctgtcggagtcc	Protospacer
 **.*****.**************

499. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtccgagtcgctgtcggagtcc	Protospacer
 ***** **.**************

500. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggaatccgaatcgctgtcggagtcc	Protospacer
 **.** *****************

501. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agaatcggagtcgctgtcggagtcc	Protospacer
 **.*****.**************

502. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtccgagtcgctgtcggagtcc	Protospacer
 ***** **.**************

503. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtcggaatcgctgtccgaatcc	Protospacer
 ***************** **.**

504. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtcggaatcgctgtccgaatcc	Protospacer
 ***************** **.**

505. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtccgaatcgctgtcagagtca	Protospacer
 ***** ***********.*****.

506. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtccgaatcgctgtcagagtcc	Protospacer
 ***** ***********.*****

507. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtccgaatcgctgtcagagtcc	Protospacer
 ***** ***********.*****

508. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggaatcactgtcagagtcc	Protospacer
 ***********.*****.*****

509. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggaatcactgtcagagtcc	Protospacer
 ***********.*****.*****

510. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggaatcactgtcagagtcc	Protospacer
 ***********.*****.*****

511. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggaatcactgtcagagtcc	Protospacer
 ***********.*****.*****

512. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggaatcactgtcagagtcc	Protospacer
 ***********.*****.*****

513. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggaatcactgtcagagtcc	Protospacer
 ***********.*****.*****

514. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agaatcggaatcactgtcggagtcc	Protospacer
 **.********.***********

515. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggaatcgctgtccgaatcc	Protospacer
 ***************** **.**

516. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtcggagtcactgtcggagtcc	Protospacer
 ********.**.***********

517. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtccgaatcgctgtcagagtca	Protospacer
 ***** ***********.*****.

518. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtccgagtcgctgtcggagtcc	Protospacer
 ***** **.**************

519. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agaatcggaatcactgtcggagtcc	Protospacer
 **.********.***********

520. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agaatcggaatcgctgtcggaatcc	Protospacer
 **.*****************.**

521. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
tgaatcggaatcactgtcggagtcc	Protospacer
.**.********.***********

522. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggagtcactgtcggagtcc	Protospacer
 ********.**.***********

523. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agaatcggagtcgctgtcggagtcc	Protospacer
 **.*****.**************

524. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtccgaatcgctgtcagagtcc	Protospacer
 ***** ***********.*****

525. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agaatcggagtcgctgtcggagtcc	Protospacer
 **.*****.**************

526. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtccgaatcgctgtcagagtcc	Protospacer
 ***** ***********.*****

527. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtccgaatcgctgtcagagtca	Protospacer
 ***** ***********.*****.

528. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtccgaatcgctgtcagagtca	Protospacer
 ***** ***********.*****.

529. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtccgaatcgctgtcagagtcc	Protospacer
 ***** ***********.*****

530. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtccgaatcgctgtccgagtcc	Protospacer
 ***** *********** *****

531. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtccgaatcgctgtcagagtcc	Protospacer
 ***** ***********.*****

532. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agaatccgaatcgctgtcggagtca	Protospacer
 **.** *****************.

533. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtccgagtcgctgtcggagtcc	Protospacer
 ***** **.**************

534. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtccgaatcgctgtcagagtcc	Protospacer
 ***** ***********.*****

535. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtccgaatcgctgtccgagtca	Protospacer
 ***** *********** *****.

536. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtccgaatcgctgtccgagtca	Protospacer
 ***** *********** *****.

537. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtcggagtcgctgtcagagtcc	Protospacer
 ********.********.*****

538. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtccgaatcgctgtcagagtcc	Protospacer
 ***** ***********.*****

539. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtcggaatcgctgtcagaatcc	Protospacer
 *****************.**.**

540. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggaatcggaatcgctgtccgagtca	Protospacer
 **.************** *****.

541. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggagtcgctgtccgagtca	Protospacer
 ********.******** *****.

542. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtccgagtcgctgtcggagtct	Protospacer
 ***** **.**************

543. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtcggaatcgctgtcagaatcc	Protospacer
 *****************.**.**

544. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agaatccgaatcgctgtcggagtca	Protospacer
 **.** *****************.

545. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtccgaatcgctgtccgagtca	Protospacer
 ***** *********** *****.

546. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agaatccgaatcgctgtcggagtca	Protospacer
 **.** *****************.

547. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtccgagtcgctgtcggagtcc	Protospacer
 ***** **.**************

548. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcagagtcgctgtcggagtcc	Protospacer
 *****.**.**************

549. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggaatcactgtcggaatcc	Protospacer
 ***********.********.**

550. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtcggagtcgctgtcagagtcc	Protospacer
 ********.********.*****

551. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggaatcactgtccgagtca	Protospacer
 ***********.***** *****.

552. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtcggagtcgctgtccgagtcc	Protospacer
 ********.******** *****

553. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtccgaatcactgtcggagtcc	Protospacer
 ***** *****.***********

554. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtcggagtcgctgtcagagtcc	Protospacer
 ********.********.*****

555. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggaatcggaatcgctgtcagagtcc	Protospacer
 **.**************.*****

556. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtccgaatcgctgtcagagtca	Protospacer
 ***** ***********.*****.

557. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ggagtccgaatcgctgtccgagtca	Protospacer
 ***** *********** *****.

558. spacer 2.49|853762|25|NZ_CP015308|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
agagtcggaatcactgtcagagtcc	Protospacer
 ***********.*****.*****

559. spacer 2.49|853762|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
tgagtctgaatcgctgtctgagtct	Protospacer
.***** *********** *****

560. spacer 2.49|853762|25|NZ_CP015308|CRT matches to NC_005241 (Cupriavidus necator H16 megaplasmid pHG1, complete sequence) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
gtagtcggcatcgctgtcggtgtcg	Protospacer
  ****** *********** ****

561. spacer 2.49|853762|25|NZ_CP015308|CRT matches to NZ_CP039289 (Cupriavidus necator H16 plasmid pHG1, complete sequence) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
gtagtcggcatcgctgtcggtgtcg	Protospacer
  ****** *********** ****

562. spacer 2.49|853762|25|NZ_CP015308|CRT matches to NC_025424 (Bacillus phage Waukesha92, complete genome) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ttagtcggcatcgctgtcggtgtcg	Protospacer
. ****** *********** ****

563. spacer 2.49|853762|25|NZ_CP015308|CRT matches to NZ_CP004871 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB46, complete sequence) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ttagtcggcatcgctgtcggtgtcg	Protospacer
. ****** *********** ****

564. spacer 2.49|853762|25|NZ_CP015308|CRT matches to NZ_CP011352 (Bacillus thuringiensis strain YC-10 plasmid pYC4, complete sequence) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ttagtcggcatcgctgtcggtgtcg	Protospacer
. ****** *********** ****

565. spacer 2.49|853762|25|NZ_CP015308|CRT matches to NZ_CP013060 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-5, complete sequence) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ttagtcggcatcgctgtcggtgtcg	Protospacer
. ****** *********** ****

566. spacer 2.49|853762|25|NZ_CP015308|CRT matches to NZ_CP038639 (Cupriavidus oxalaticus strain X32 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
gtagtcggcatcgctgtcggtgtcg	Protospacer
  ****** *********** ****

567. spacer 2.49|853762|25|NZ_CP015308|CRT matches to NZ_CP010095 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB47, complete sequence) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ttagtcggcatcgctgtcggtgtcg	Protospacer
. ****** *********** ****

568. spacer 2.49|853762|25|NZ_CP015308|CRT matches to MK843319 (Bacillus phage vB_BthS-TP21T, complete genome) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ttagtcggcatcgctgtcggtgtcg	Protospacer
. ****** *********** ****

569. spacer 2.49|853762|25|NZ_CP015308|CRT matches to KT970646 (Bacillus phage phiS58, complete genome) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ttagtcggcatcgctgtcggtgtcg	Protospacer
. ****** *********** ****

570. spacer 2.49|853762|25|NZ_CP015308|CRT matches to HE614281 (Staphylococcus phage SpaA1 complete genome) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ttagtcggcatcgctgtcggtgtcg	Protospacer
. ****** *********** ****

571. spacer 2.49|853762|25|NZ_CP015308|CRT matches to NC_018277 (Staphylococcus phage SpaA1, complete genome) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ttagtcggcatcgctgtcggtgtcg	Protospacer
. ****** *********** ****

572. spacer 2.49|853762|25|NZ_CP015308|CRT matches to KT970645 (Bacillus phage phi4J1, complete genome) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ttagtcggcatcgctgtcggtgtcg	Protospacer
. ****** *********** ****

573. spacer 2.49|853762|25|NZ_CP015308|CRT matches to NC_048628 (Bacillus phage BceA1 complete genome) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ttagtcggcatcgctgtcggtgtcg	Protospacer
. ****** *********** ****

574. spacer 2.49|853762|25|NZ_CP015308|CRT matches to AY894696 (Bacillus thuringiensis phage MZTP02 phage-related protein and hypothetical proteins genes, complete cds) position: , mismatch: 4, identity: 0.84

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
ttagtcggcatcgctgtcggtgtcg	Protospacer
. ****** *********** ****

575. spacer 2.50|853816|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

gctatctgaatcactgtcagagtcg	CRISPR spacer
ggaatcggaatcactgtcagagtcc	Protospacer
*  *** *****************

576. spacer 2.50|853816|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

gctatctgaatcactgtcagagtcg	CRISPR spacer
ggaatcggaatcactgtcagagtcc	Protospacer
*  *** *****************

577. spacer 2.50|853816|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

gctatctgaatcactgtcagagtcg	CRISPR spacer
ggagtccgaatcactgtcagagtcg	Protospacer
*  .**.******************

578. spacer 2.50|853816|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

gctatctgaatcactgtcagagtcg	CRISPR spacer
ggagtccgaatcactgtcagagtcg	Protospacer
*  .**.******************

579. spacer 2.50|853816|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

gctatctgaatcactgtcagagtcg	CRISPR spacer
ggaatcggaatcactgtcagagtcc	Protospacer
*  *** *****************

580. spacer 2.50|853816|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

gctatctgaatcactgtcagagtcg	CRISPR spacer
ggaatcggaatcactgtcagagtcc	Protospacer
*  *** *****************

581. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtcagagtccgagtcgctgtca	Protospacer
.***** **************.**.

582. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtcagagtccgagtcgctgtca	Protospacer
.***** **************.**.

583. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtccgaatccgagtcgctgtca	Protospacer
.********.***********.**.

584. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtcagagtccgagtcgctgtca	Protospacer
.***** **************.**.

585. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtcggagtccgagtcgctgtcc	Protospacer
.***** **************.**

586. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtcagagtccgagtcgctgtca	Protospacer
.***** **************.**.

587. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtcggagtccgagtcgctgtca	Protospacer
.***** **************.**.

588. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtcagagtccgagtcgctgtcc	Protospacer
.***** **************.**

589. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtcggagtccgagtcgctgtca	Protospacer
.***** **************.**.

590. spacer 2.53|853996|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtcagagtccgagtcgctgtca	Protospacer
.***** **************.**.

591. spacer 2.53|853996|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtcggagtccgagtcgctgtca	Protospacer
.***** **************.**.

592. spacer 2.53|853996|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtcggagtccgagtcgctgtca	Protospacer
.***** **************.**.

593. spacer 2.53|853996|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtccgagtcagagtcgctgtca	Protospacer
.*********** ********.**.

594. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 4, identity: 0.84

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtctgagtccgaatcgctatct	Protospacer
.*****.********.********

595. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtctgagtccgaatcgctatct	Protospacer
.*****.********.********

596. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_CP049837 (Gordonia terrae strain RL-JC02 plasmid pPAE01, complete sequence) position: , mismatch: 4, identity: 0.84

gctgtccgagtccgagtcgctatcg	CRISPR spacer
gccgtccgagtccgagtcgctacac	Protospacer
**.*******************.

597. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 4, identity: 0.84

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtctgagtccgaatcgctatct	Protospacer
.*****.********.********

598. spacer 2.53|853996|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 4, identity: 0.84

gctgtccgagtccgagtcgctatcg	CRISPR spacer
actgtctgagtccgaatcgctatct	Protospacer
.*****.********.********

599. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcggagtcggaatcgctgtca	Protospacer
.*****.***********.*****.

600. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcgctgtca	Protospacer
.*********** *****.*****.

601. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcggagtcggaatcgctgtca	Protospacer
.*****.***********.*****.

602. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcggagtcggaatcgctgtca	Protospacer
.*****.***********.*****.

603. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtccgagtccgaatcactgtca	Protospacer
.***** ***** ***********.

604. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcggaatcggaatcactgtca	Protospacer
.*****.**.**************.

605. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcggagtcggagtcactgtca	Protospacer
.*****.********.********.

606. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtccgagtccgaatcactgtcc	Protospacer
.***** ***** ***********

607. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcagaatcgctgtcc	Protospacer
.***********.*****.*****

608. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcggagtcggaatcgctgtcc	Protospacer
.*****.***********.*****

609. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcggaatcggaatcactgtca	Protospacer
.*****.**.**************.

610. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcggaatcggaatcactgtca	Protospacer
.*****.**.**************.

611. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcgctgtcc	Protospacer
.*********** *****.*****

612. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcgctgtca	Protospacer
.*********** *****.*****.

613. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcggaatcggaatcactgtcc	Protospacer
.*****.**.**************

614. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcgctgtcc	Protospacer
.*********** *****.*****

615. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtctgaatcggaatcactgtca	Protospacer
.***** **.**************.

616. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcggagtccgaatcactgtca	Protospacer
.*****.***** ***********.

617. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcgctgtca	Protospacer
.*********** *****.*****.

618. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcggagtcggaatcgctgtca	Protospacer
.*****.***********.*****.

619. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcggagtcggaatcgctgtca	Protospacer
.*****.***********.*****.

620. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcggagtcggaatcgctgtcc	Protospacer
.*****.***********.*****

621. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcgctgtca	Protospacer
.*********** *****.*****.

622. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcgctgtca	Protospacer
.*********** *****.*****.

623. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcgctgtca	Protospacer
.*********** *****.*****.

624. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcgctgtca	Protospacer
.*********** *****.*****.

625. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcagagtcactgtca	Protospacer
.***********.**.********.

626. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcgctgtcc	Protospacer
.*********** *****.*****

627. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcgctgtcc	Protospacer
.*********** *****.*****

628. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcgctgtca	Protospacer
.*********** *****.*****.

629. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcgctgtca	Protospacer
.*********** *****.*****.

630. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtctgagtcggaatcgctgtcc	Protospacer
.***** ***********.*****

631. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtctgaatcggaatcactgtca	Protospacer
.***** **.**************.

632. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtccgagtccgaatcactgtcc	Protospacer
.***** ***** ***********

633. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagaatcggaatcgctgtca	Protospacer
.********.********.*****.

634. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagaatcggaatcgctgtca	Protospacer
.********.********.*****.

635. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcgctgtca	Protospacer
.*********** *****.*****.

636. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtcagagtcactgtca	Protospacer
.***********.**.********.

637. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcgctgtca	Protospacer
.*********** *****.*****.

638. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtccgaatcggaatcactgtca	Protospacer
.***** **.**************.

639. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcggaatcggaatcactgtca	Protospacer
.*****.**.**************.

640. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcgctgtcc	Protospacer
.*********** *****.*****

641. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcggaatcggaatcactgtca	Protospacer
.*****.**.**************.

642. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcgctgtca	Protospacer
.*********** *****.*****.

643. spacer 2.56|854194|25|NZ_CP015308|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.84

actgtcagagtcggaatcactgtcg	CRISPR spacer
gctgtcagagtccgaatcgctgtca	Protospacer
.*********** *****.*****.

644. spacer 3.2|1823838|30|NZ_CP015308|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 4, identity: 0.867

taatcggcg----tggtgaagatttcgccgacgt	CRISPR spacer
----cggcggtgttggtgaagatttcgccgacgt	Protospacer
    *****    *********************

645. spacer 2.47|853618|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.8

cgaatctgagtcggaatcgctgtcg	CRISPR spacer
gctgtctgagtcggaatcgctgtcc	Protospacer
   .********************

646. spacer 2.47|853618|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.8

cgaatctgagtcggaatcgctgtcg	CRISPR spacer
gctgtcggagtcggaatcgctgtcg	Protospacer
   .** ******************

647. spacer 2.47|853618|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.8

cgaatctgagtcggaatcgctgtcg	CRISPR spacer
gctgtcggagtcggaatcgctgtcg	Protospacer
   .** ******************

648. spacer 2.47|853618|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.8

cgaatctgagtcggaatcgctgtcg	CRISPR spacer
gctgtcagagtcggaatcgctgtcg	Protospacer
   .** ******************

649. spacer 2.47|853618|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.8

cgaatctgagtcggaatcgctgtcg	CRISPR spacer
gctgtcagagtcggaatcgctgtcg	Protospacer
   .** ******************

650. spacer 2.47|853618|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.8

cgaatctgagtcggaatcgctgtcg	CRISPR spacer
gctgtcggagtcggaatcgctgtcg	Protospacer
   .** ******************

651. spacer 2.47|853618|25|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.8

cgaatctgagtcggaatcgctgtcg	CRISPR spacer
gctgtctgagtctgaatcgctgtcg	Protospacer
   .******** ************

652. spacer 2.47|853618|25|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.8

cgaatctgagtcggaatcgctgtcg	CRISPR spacer
actgtcagagtcggaatcgctgtcg	Protospacer
   .** ******************

653. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.8

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
actatccgaatcgctgtcggagtcg	Protospacer
   .** ******************

654. spacer 2.49|853762|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.8

cgagtcggaatcgctgtcggagtcg	CRISPR spacer
actatccgaatcgctgtcggagtcg	Protospacer
   .** ******************

655. spacer 2.50|853816|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.8

gctatctgaatcactgtcagagtcg	CRISPR spacer
tgaatcggaatcactgtcagagtcc	Protospacer
   *** *****************

656. spacer 2.50|853816|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.8

gctatctgaatcactgtcagagtcg	CRISPR spacer
agagtcggaatcactgtcagagtcg	Protospacer
.  .** ******************

657. spacer 2.50|853816|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.8

gctatctgaatcactgtcagagtcg	CRISPR spacer
tgaatcggaatcactgtcagagtcc	Protospacer
   *** *****************

658. spacer 2.50|853816|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.8

gctatctgaatcactgtcagagtcg	CRISPR spacer
agagtcggaatcactgtcagagtcg	Protospacer
.  .** ******************

659. spacer 2.50|853816|25|NZ_CP015308|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 5, identity: 0.8

gctatctgaatcactgtcagagtcg	CRISPR spacer
tgaatctgaatcactgtctgagtcc	Protospacer
   *************** *****

660. spacer 2.50|853816|25|NZ_CP015308|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.8

gctatctgaatcactgtcagagtcg	CRISPR spacer
tgaatctgaatcactgtctgagtcc	Protospacer
   *************** *****

661. spacer 2.50|853816|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 5, identity: 0.8

gctatctgaatcactgtcagagtcg	CRISPR spacer
tgaatctgaatcactgtctgagtcc	Protospacer
   *************** *****

662. spacer 2.50|853816|25|NZ_CP015308|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 5, identity: 0.8

gctatctgaatcactgtcagagtcg	CRISPR spacer
tgaatctgaatcactgtctgagtcc	Protospacer
   *************** *****

663. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.8

actgtcagagtcggaatcactgtcg	CRISPR spacer
cgagtcagagtcggaatcgctgtca	Protospacer
   ***************.*****.

664. spacer 2.56|854194|25|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.8

actgtcagagtcggaatcactgtcg	CRISPR spacer
cgagtcagagtcggaatcgctgtca	Protospacer
   ***************.*****.

665. spacer 2.25|851938|31|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

cgagtcggagtcactgtcgctgtccgaatcc	CRISPR spacer
gctgtcggagtcagagtcgctgtccgaatcg	Protospacer
   **********  ***************

666. spacer 2.34|852640|43|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.86

cgagtccgaatcactatccgaatccgagtcgctgtccgagtcc	CRISPR spacer
cgagtccgaatcactgtccgaatccgagtcactgtcgctgtcg	Protospacer
***************.**************.*****   ***

667. spacer 2.40|853060|43|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.86

cgagtcggaatcactgtcagaatcggagtcactgtcgctgtcc	CRISPR spacer
ggagtcggaatcactgtcagaatcggagtcgctgtccgaatcc	Protospacer
 *****************************.*****   .***

668. spacer 2.40|853060|43|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.86

cgagtcggaatcactgtcagaatcggagtcactgtcgctgtcc	CRISPR spacer
agagtccgaatcactgtcggaatcggagtcactgtcggaatcc	Protospacer
 ***** ***********.******************  .***

669. spacer 2.40|853060|43|NZ_CP015308|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 6, identity: 0.86

cgagtcggaatcactgtcagaatcggagtcactgtcgctgtcc	CRISPR spacer
agagtccgaatcactgtcagaatcggagtcactgtcagagtcg	Protospacer
 ***** *****************************.  ***

670. spacer 3.2|1823838|30|NZ_CP015308|CRT,PILER-CR,CRISPRCasFinder matches to AB981169 (Ralstonia phage RSY1 DNA, complete genome) position: , mismatch: 6, identity: 0.8

taatcggcgtggtgaagatttcgccgacgt	CRISPR spacer
cgatcggcgtggtgaggatgtcgccgatgg	Protospacer
..*************.*** *******.*

671. spacer 3.2|1823838|30|NZ_CP015308|CRT,PILER-CR,CRISPRCasFinder matches to NC_049432 (Ralstonia phage RsoM1USA, complete genome) position: , mismatch: 6, identity: 0.8

taatcggcgtggtgaagatttcgccgacgt	CRISPR spacer
caatcggcgtggtgaggatgtcgcccatgg	Protospacer
.**************.*** ***** *.*

672. spacer 3.2|1823838|30|NZ_CP015308|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP039965 (Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taatcggcgtggtgaagatttcg-ccgacgt	CRISPR spacer
ctatcggcgtggtgaatatttcgactgacc-	Protospacer
. ************** ****** *.***

673. spacer 2.40|853060|43|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.837

cgagtcggaatcactgtcagaatcggagtcactgtcgctgtcc	CRISPR spacer
agagtcggaatcactgtcagaatcggaatcgctgtcagagtcg	Protospacer
 **************************.**.*****.  ***

674. spacer 2.40|853060|43|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.837

cgagtcggaatcactgtcagaatcggagtcactgtcgctgtcc	CRISPR spacer
ggagtcggaatcgctgtcagaatccgagtcactgtcagaatcc	Protospacer
 ***********.*********** ***********.  .***

675. spacer 2.40|853060|43|NZ_CP015308|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.837

cgagtcggaatcactgtcagaatcggagtcactgtcgctgtcc	CRISPR spacer
agagtcggaatcactgtccgaatcggagtcgctgtcagagtca	Protospacer
 ***************** ***********.*****.  ***

676. spacer 2.25|851938|31|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.742

cgagtcggagtcactgtcgctgtccgaatcc	CRISPR spacer
agagtcggagtcactgtcggagtcgctgtca	Protospacer
 ******************  ***   .**

677. spacer 2.40|853060|43|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.814

cgagtcggaatcactgtcagaatcggagtcactgtcgctgtcc	CRISPR spacer
ggagtcggaatcactgtcagaatcggaatcgctgtcagaatcg	Protospacer
 **************************.**.*****.  .**

678. spacer 2.55|854122|43|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.814

actatcagaatccgaatcactatcagaatccgagtcgctgtct	CRISPR spacer
gctgtcgctatccgaatcgctgtcagaatccgagtcgctgtca	Protospacer
.**.**.  *********.**.********************

679. spacer 2.55|854122|43|NZ_CP015308|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.814

actatcagaatccgaatcactatcagaatccgagtcgctgtct	CRISPR spacer
gctgtcgctatccgaatcgctgtcagaatccgagtcgctgtcc	Protospacer
.**.**.  *********.**.********************.

680. spacer 2.23|851794|43|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.791

agaatcggaatcactgtcgctatctgaatcactatccgaatcg	CRISPR spacer
agagtctgaatcactgtcgctatctgaatcagagtcgctgtcg	Protospacer
***.** ************************  .**   .***

681. spacer 2.23|851794|43|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.791

agaatcggaatcactgtcgctatctgaatcactatccgaatcg	CRISPR spacer
agagtctgaatcactgtcgctatctgaatcagagtcgctgtcg	Protospacer
***.** ************************  .**   .***

682. spacer 2.23|851794|43|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.791

agaatcggaatcactgtcgctatctgaatcactatccgaatcg	CRISPR spacer
agagtctgaatcactgtcgctatctgaatcagagtcgctgtcg	Protospacer
***.** ************************  .**   .***

683. spacer 2.23|851794|43|NZ_CP015308|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.791

agaatcggaatcactgtcgctatctgaatcactatccgaatcg	CRISPR spacer
agagtctgaatcactgtcgctatctgaatcagagtcgctgtcg	Protospacer
***.** ************************  .**   .***

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

159523 : 245125

Lactobacillus_phage(73.47%)

portal,protease,terminase,holin,tail,tRNA,integrase,head,transposase

attL 152573:152590|attR 219526:219543

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
152573:152590	attL	NA	NA	NA	NA
WP_069137004.1\|159523_160687_-\|integrase	site-specific integrase	O64373	Lactobacillus_phage	3.9e-54	34.3
WP_069137005.1\|160986_161973_-	DUF3644 domain-containing protein	A0A0N9RUA4	Staphylococcus_phage	9.5e-86	52.0
WP_003641358.1\|162365_162566_-	hypothetical protein	E9LUS6	Lactobacillus_phage	4.9e-26	100.0
WP_069137006.1\|162757_162940_-	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	6.7e-14	66.7
WP_069137007.1\|163066_163309_-	hypothetical protein	NA	NA	NA	NA
WP_069137008.1\|163311_164061_-	potassium channel family protein	A0A1B0Y2S3	Lactobacillus_phage	9.2e-41	53.9
WP_069137009.1\|164118_164556_-	ImmA/IrrE family metallo-endopeptidase	A0A1C8E988	Bacillus_phage	4.9e-10	30.6
WP_069137010.1\|164567_164987_-	helix-turn-helix transcriptional regulator	A0A0M4QX29	Bacillus_phage	7.0e-30	47.9
WP_069137011.1\|165243_165447_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_069137012.1\|165462_166170_+	Rha family transcriptional regulator	D2IYT0	Enterococcus_phage	3.6e-63	58.6
WP_069137013.1\|166181_166391_+	hypothetical protein	NA	NA	NA	NA
WP_069137014.1\|166403_166631_+	hypothetical protein	NA	NA	NA	NA
WP_025015699.1\|166646_166868_-	hypothetical protein	NA	NA	NA	NA
WP_003641367.1\|166925_167186_+	hypothetical protein	NA	NA	NA	NA
WP_003641368.1\|167779_168070_-	hypothetical protein	NA	NA	NA	NA
WP_003641369.1\|168235_168439_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003641370.1\|168451_168700_+	hypothetical protein	E9LUT6	Lactobacillus_phage	2.7e-29	76.1
WP_003641371.1\|168702_168903_+	hypothetical protein	E9LUT7	Lactobacillus_phage	1.0e-26	89.4
WP_187337690.1\|168914_169079_+	hypothetical protein	E9LUT8	Lactobacillus_phage	4.2e-15	78.8
WP_187337691.1\|169081_169252_+	hypothetical protein	NA	NA	NA	NA
WP_069137015.1\|169251_169509_+	hypothetical protein	NA	NA	NA	NA
WP_069137016.1\|169610_170354_+	replisome organizer	E9LUM6	Lactobacillus_phage	2.7e-40	57.3
WP_069137017.1\|170353_171139_+	ATP-binding protein	E9LUN6	Lactobacillus_phage	7.0e-132	90.8
WP_063722553.1\|171274_171583_+	hypothetical protein	E9LUN7	Lactobacillus_phage	1.2e-47	93.1
WP_106904767.1\|171575_171734_+	hypothetical protein	A0A2P0ZLB5	Lactobacillus_phage	3.3e-17	92.3
WP_187337692.1\|171736_171895_+	hypothetical protein	O03920	Lactobacillus_phage	8.4e-21	96.2
WP_080475537.1\|171910_172324_+	hypothetical protein	O03921	Lactobacillus_phage	1.7e-36	61.9
WP_069137018.1\|172320_172686_+	hypothetical protein	A0A291I9N7	Lactobacillus_phage	4.0e-42	69.3
WP_069137371.1\|172685_173153_+	DUF1642 domain-containing protein	A0A2P0ZLB8	Lactobacillus_phage	2.9e-37	55.8
WP_080475538.1\|173149_173320_+	hypothetical protein	E9LUP4	Lactobacillus_phage	2.9e-19	91.1
WP_022638818.1\|173300_173726_+	phage transcriptional activator RinA	E9LUP5	Lactobacillus_phage	3.1e-62	81.6
WP_069137019.1\|173938_174607_+	HNH endonuclease	B8R694	Lactobacillus_phage	1.7e-22	39.0
WP_080475539.1\|174798_175233_+\|terminase	phage terminase small subunit P27 family	B8R648	Lactobacillus_phage	1.8e-17	37.7
WP_069137020.1\|175219_177136_+\|terminase	terminase large subunit	A0A0M7RDK9	Lactobacillus_phage	3.7e-134	41.3
WP_069137373.1\|177374_178493_+\|portal	phage portal protein	Q9AZM4	Lactococcus_phage	5.0e-67	40.6
WP_069137021.1\|178464_179070_+\|head,protease	HK97 family phage prohead protease	B8R651	Lactobacillus_phage	1.1e-39	49.1
WP_069137024.1\|180827_181175_+\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	4.0e-55	93.0
WP_069137025.1\|181177_181585_+	HK97 gp10 family phage protein	A0A2P0ZLE6	Lactobacillus_phage	3.3e-61	87.1
WP_069137026.1\|181584_181965_+	DUF806 family protein	A0A2P0ZLF4	Lactobacillus_phage	3.2e-58	88.9
WP_069137027.1\|181980_182634_+\|tail	phage tail protein	A0A2P0ZLH1	Lactobacillus_phage	1.3e-107	88.9
WP_063488422.1\|182709_183084_+\|tail	phage tail assembly chaperone	A0A2P0ZLH4	Lactobacillus_phage	4.6e-57	94.4
WP_069137028.1\|183128_183314_+	hypothetical protein	NA	NA	NA	NA
WP_069137029.1\|183345_187704_+	C40 family peptidase	A0A2P0ZLG0	Lactobacillus_phage	0.0e+00	72.6
WP_069137030.1\|187777_189547_+\|tail	phage tail family protein	E9LUR2	Lactobacillus_phage	0.0e+00	91.5
WP_069137031.1\|189613_191992_+\|tail	phage tail protein	E9LUR3	Lactobacillus_phage	0.0e+00	89.8
WP_069137032.1\|191984_194750_+	hypothetical protein	A0A2P0ZL34	Lactobacillus_phage	3.5e-194	50.1
WP_069137033.1\|194742_194994_+	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	9.3e-30	95.8
WP_187337693.1\|194997_195159_+	hypothetical protein	A0A2P0ZLG1	Lactobacillus_phage	8.0e-19	96.2
WP_069137034.1\|195142_196171_+	hypothetical protein	A0A2P0ZLF6	Lactobacillus_phage	9.0e-63	87.8
WP_069137375.1\|196476_197592_+	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	1.9e-45	65.7
WP_069137035.1\|197592_197889_+	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	7.6e-39	76.5
WP_069137036.1\|197875_198253_+\|holin	holin	A0A2K9VCG4	Lactobacillus_phage	2.1e-17	70.0
WP_003644508.1\|199496_200708_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_053338923.1\|202946_203738_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.5e-30	36.8
WP_003644505.1\|203718_204903_+	LCP family protein	NA	NA	NA	NA
WP_003645636.1\|205054_205627_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_053338920.1\|206378_207320_-	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	5.3e-78	49.0
WP_003644503.1\|207765_208158_-	hypothetical protein	NA	NA	NA	NA
WP_003640750.1\|208321_208714_+	hypothetical protein	NA	NA	NA	NA
WP_053338919.1\|208749_209919_+	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_069137037.1\|209968_210598_-	hypothetical protein	NA	NA	NA	NA
WP_089178220.1\|210901_211132_+	DNA alkylation repair protein	NA	NA	NA	NA
WP_003640747.1\|211221_211854_-	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
WP_003644501.1\|212005_212245_+	DUF896 domain-containing protein	NA	NA	NA	NA
WP_003640745.1\|212342_212579_+	YneF family protein	NA	NA	NA	NA
WP_003645630.1\|212635_213271_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003644499.1\|213382_214141_+\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_003640742.1\|214124_214430_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_003640741.1\|214514_215513_+	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9
WP_069137038.1\|215499_217179_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	4.7e-93	41.5
WP_003640740.1\|217573_218296_-	HAD family hydrolase	NA	NA	NA	NA
WP_003640739.1\|218520_219324_+	30S ribosomal protein S2	NA	NA	NA	NA
WP_003644498.1\|219426_220305_+	elongation factor Ts	NA	NA	NA	NA
219526:219543	attR	NA	NA	NA	NA
WP_003640737.1\|220505_221228_+	UMP kinase	NA	NA	NA	NA
WP_003640736.1\|221229_221793_+	ribosome recycling factor	NA	NA	NA	NA
WP_003640735.1\|221912_222692_+	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.1e-23	43.1
WP_003640734.1\|222707_223493_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_003640733.1\|223530_224808_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_069137039.1\|224847_226557_+\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_003640729.1\|227050_231364_+	DNA polymerase III subunit alpha	A0A1X9SH08	Bradyrhizobium_phage	1.0e-14	34.0
WP_003640728.1\|231659_232136_+	ribosome maturation factor RimP	NA	NA	NA	NA
WP_069137040.1\|232156_233374_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003640726.1\|233418_233718_+	YlxR family protein	NA	NA	NA	NA
WP_003640725.1\|233707_234013_+	ribosomal L7Ae/L30e/S12e/Gadd45 family protein	NA	NA	NA	NA
WP_003645962.1\|234027_236604_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.6e-21	23.3
WP_003640723.1\|236626_236980_+	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_069137041.1\|237628_239083_+	MFS transporter	NA	NA	NA	NA
WP_013355607.1\|239075_240245_+	chorismate synthase	NA	NA	NA	NA
WP_069137042.1\|240253_240781_+	amino acid biosynthesis protein	NA	NA	NA	NA
WP_015825651.1\|240794_242093_+	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_015825650.1\|242095_243193_+	prephenate dehydrogenase	NA	NA	NA	NA
WP_027821257.1\|243195_243717_+	shikimate kinase	NA	NA	NA	NA
WP_027821256.1\|244201_245125_+\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA

DBSCAN-SWA_2

747549 : 754910

Lactobacillus_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645220.1\|747549_748545_-	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	3.1e-52	38.8
WP_015380221.1\|749171_749309_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_011101401.1\|749404_749845_+	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	3.0e-76	98.6
WP_003643095.1\|749915_750476_-	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
WP_069137079.1\|750563_753002_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.1
WP_003643097.1\|753004_753619_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_003643099.1\|753962_754910_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0

DBSCAN-SWA_3

1361368 : 1369993

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053338713.1\|1361368_1362364_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	1.0e-50	37.9
WP_069137131.1\|1362502_1363288_-	acyl-ACP thioesterase	NA	NA	NA	NA
WP_053338711.1\|1363291_1364188_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	1.7e-81	55.7
WP_003640967.1\|1364286_1364634_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_003640966.1\|1364658_1365678_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640965.1\|1365694_1366024_-	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_003644908.1\|1366020_1366686_-	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640957.1\|1367084_1367336_-	YaaL family protein	NA	NA	NA	NA
WP_003637790.1\|1367350_1367950_-	recombination protein RecR	NA	NA	NA	NA
WP_003640956.1\|1367965_1368274_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_069137132.1\|1368295_1369993_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0

DBSCAN-SWA_4

1510188 : 1607211

uncultured_Mediterranean_phage(15.38%)

bacteriocin,tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054397570.1\|1510188_1511460_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	3.4e-96	43.7
WP_003642042.1\|1511926_1513540_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.2e-143	49.9
WP_003642041.1\|1513712_1514321_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_069137145.1\|1514365_1514806_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_069137146.1\|1515170_1516103_+	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_187337697.1\|1516111_1517470_+	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	2.3e-26	32.9
WP_063731239.1\|1517489_1518299_+	sugar-phosphatase	NA	NA	NA	NA
WP_054397561.1\|1518464_1519451_-	hypothetical protein	NA	NA	NA	NA
WP_054397559.1\|1519533_1520556_-	YdcF family protein	NA	NA	NA	NA
WP_003643830.1\|1520843_1521824_-	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	4.9e-42	36.3
WP_069137383.1\|1522177_1523002_-	serine hydrolase	NA	NA	NA	NA
WP_054397557.1\|1523228_1524611_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L140	Tupanvirus	1.3e-27	32.8
WP_069137148.1\|1524679_1525516_-	pur operon repressor	NA	NA	NA	NA
WP_063723574.1\|1525871_1526669_-	metal ABC transporter permease	NA	NA	NA	NA
WP_003642023.1\|1526661_1527360_-	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	1.2e-15	27.8
WP_021356652.1\|1527626_1528571_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_045352037.1\|1528880_1529747_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_003642020.1\|1529879_1530131_-	Veg family protein	NA	NA	NA	NA
WP_069137149.1\|1530235_1531126_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_063723569.1\|1531122_1531686_-	ribonuclease M5	NA	NA	NA	NA
WP_069137150.1\|1531672_1532449_-	TatD family hydrolase	NA	NA	NA	NA
WP_063723567.1\|1532571_1533756_-	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_069137151.1\|1533988_1536040_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	7.7e-90	35.6
WP_003646492.1\|1536361_1536751_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_003642012.1\|1537347_1538190_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_003642011.1\|1538189_1538894_-	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_003642010.1\|1538915_1539875_-	hypothetical protein	NA	NA	NA	NA
WP_003642009.1\|1539867_1541142_-	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_011101010.1\|1541187_1542105_-	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_027822753.1\|1542547_1543561_-\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_003642004.1\|1543673_1544420_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_080475553.1\|1544569_1545466_-	ROK family protein	NA	NA	NA	NA
WP_069137152.1\|1545586_1547023_-	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	2.8e-30	25.3
WP_003643816.1\|1547040_1548396_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003642000.1\|1548618_1549041_-	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003641999.1\|1549030_1549219_-	hypothetical protein	NA	NA	NA	NA
WP_069137153.1\|1549225_1550587_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641997.1\|1550659_1551370_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_069137154.1\|1551866_1552808_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.6e-21	32.2
WP_069137155.1\|1552788_1553922_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-15	30.4
WP_106904656.1\|1553893_1554832_-	ABC transporter permease	NA	NA	NA	NA
WP_069137156.1\|1554833_1556324_-	ABC transporter permease	NA	NA	NA	NA
WP_069137157.1\|1556396_1558358_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003643815.1\|1558705_1559722_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_069137158.1\|1560161_1560938_-	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_069137159.1\|1561192_1563502_+	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_069137160.1\|1563596_1563800_-	hypothetical protein	NA	NA	NA	NA
WP_069137161.1\|1563937_1564624_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_065080250.1\|1564717_1565398_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_069137162.1\|1565484_1566153_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_069137163.1\|1566219_1566909_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_069137164.1\|1566998_1568375_-	HlyD family secretion protein	NA	NA	NA	NA
WP_015825125.1\|1568390_1570541_-	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	6.1e-45	27.9
WP_003641985.1\|1570807_1570978_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_003643811.1\|1571002_1571161_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_021356666.1\|1571259_1572033_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_069137165.1\|1572337_1573081_-	response regulator transcription factor	NA	NA	NA	NA
WP_063724134.1\|1573199_1573943_-	LytTR family transcriptional regulator DNA-binding domain-containing protein	NA	NA	NA	NA
WP_069137166.1\|1573943_1575272_-	GHKL domain-containing protein	NA	NA	NA	NA
WP_046947768.1\|1575462_1575609_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_069137167.1\|1576869_1577538_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_027821506.1\|1578479_1578659_-\|bacteriocin	class IIb bacteriocin, lactobin A/cerein 7B family	NA	NA	NA	NA
WP_011100995.1\|1579222_1580407_-	cation:proton antiporter	NA	NA	NA	NA
WP_069137168.1\|1580451_1581828_-	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_069137169.1\|1582353_1583169_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_069137170.1\|1583328_1584201_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_069137171.1\|1584271_1585063_+	HAD family hydrolase	NA	NA	NA	NA
WP_069137172.1\|1585066_1586221_+	MFS transporter	NA	NA	NA	NA
WP_015379760.1\|1586224_1586842_+	sugar O-acetyltransferase	NA	NA	NA	NA
WP_097558290.1\|1587037_1587837_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_074029678.1\|1587917_1588640_-	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	5.4e-30	31.9
WP_003643774.1\|1588654_1590484_-	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_063731274.1\|1590498_1592016_-	glycerol kinase GlpK	NA	NA	NA	NA
WP_063731276.1\|1592479_1593811_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_054397376.1\|1593888_1594860_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_069137174.1\|1594860_1596387_-	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_063724647.1\|1596624_1597071_+	hypothetical protein	NA	NA	NA	NA
WP_069137175.1\|1597806_1598718_-	oxidoreductase	NA	NA	NA	NA
WP_063724646.1\|1598854_1599775_+	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_063724645.1\|1599928_1600486_-	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_063724644.1\|1600589_1601045_-	hypothetical protein	NA	NA	NA	NA
WP_069137176.1\|1601642_1602839_+	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|1602869_1603379_+	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_003643763.1\|1603490_1603859_-	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_069137177.1\|1604122_1605628_-	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_024002428.1\|1605785_1606454_-	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_063724637.1\|1606647_1607211_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_5

2754097 : 2762608

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645861.1\|2754097_2754580_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0
WP_053339078.1\|2754563_2755694_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_069137325.1\|2755696_2756428_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	3.5e-37	37.3
WP_003642588.1\|2756429_2756684_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_011101895.1\|2756683_2757364_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_069137326.1\|2757356_2759576_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	2.7e-144	39.1
WP_003642591.1\|2759560_2761015_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
WP_069137327.1\|2761011_2762037_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.1e-59	41.3
WP_003645867.1\|2762029_2762608_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9

DBSCAN-SWA_6

2958156 : 2970420

Staphylococcus_phage(25.0%)

capsid,portal,terminase,integrase,head

attL 2957959:2957980|attR 2972105:2972126

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2957959:2957980	attL	NA	NA	NA	NA
WP_069137346.1\|2958156_2959314_-\|integrase	site-specific integrase	Q938N9	Temperate_phage	1.0e-54	35.1
WP_069137347.1\|2959372_2959939_-	helix-turn-helix transcriptional regulator	A0A1P8BMN9	Lactococcus_phage	5.9e-08	50.0
WP_016511388.1\|2960097_2960277_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_069137348.1\|2960545_2960776_+	hypothetical protein	NA	NA	NA	NA
WP_069137349.1\|2960789_2961590_+	bifunctional DNA primase/polymerase	NA	NA	NA	NA
WP_069137350.1\|2961589_2962984_+	virulence protein	Q4ZD27	Staphylococcus_phage	1.6e-70	36.1
WP_069137351.1\|2963128_2963548_+	hypothetical protein	NA	NA	NA	NA
WP_064578496.1\|2963571_2963757_+	sporulation protein Cse60	NA	NA	NA	NA
WP_069137352.1\|2963766_2964105_+\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	1.3e-07	34.7
WP_069137353.1\|2964097_2964487_+	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	1.0e-19	45.2
WP_069137354.1\|2965453_2965927_+\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_069137355.1\|2965923_2967627_+\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	1.4e-121	40.3
WP_057705764.1\|2967781_2968882_+\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	8.8e-48	34.0
WP_069137357.1\|2968878_2970420_+\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	8.8e-46	26.2
2972105:2972126	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP015308

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection