CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP013361	Burkholderia thailandensis strain 2003015869 chromosome 2, complete sequence	2 crisprs	csa3,cas3,DinG	5	0	5	1
NZ_CP013360	Burkholderia thailandensis strain 2003015869 chromosome 1, complete sequence	0 crisprs	cas3,DEDDh,csa3,DinG,PD-DExK	0	0	9	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013361_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013361_1

150843-151202

Orphan

Consensus_repeat	Method
GGGNNNCNNNAGCACGGCGACNGG	CRT

8 spacers

The CRISPR arrays of NZ_CP013361_1

>merge|NZ_CP013361|1|150843-151202|CRT
GGGCAGCCAGAGCACGGCAACCGGACAAGGGTCCCAGGCGACGGGCGATCGGAGCACGGCGACGGGGCAGGGTTCGCACGCGACGGGTAGCAACAGCACGGCGACCGGCCAGAACGCCACGGCGTCGGGCGACTCGAGCACGGCGACGGGTCAAGGCTCGCAAGCGACGGGCGACAACAGCACGGCAACTGGCCAAGGTTCGCAAGCGACGGGTAGCAACAGCACGGCGACGGGTCAGGATGCCACGGCGTCGGGTGATTCGAGCACGGCGACGGGGCAGGGTTCGCAAGCGACGAGTGACAACAGCACGGCGACGGGCCAGAACGCCACGGCGTCGGGCAACTCGAGCACAGCGACGGG

>NZ_CP013361|1|1|150843-151202|CRT
GGGCAGCCAGAGCACGGCAACCGG	ACAAGGGTCCCAGGCGAC
GGGCGATCGGAGCACGGCGACGGG	GCAGGGTTCGCACGCGAC
GGGTAGCAACAGCACGGCGACCGG	CCAGAACGCCACGGCGTC
GGGCGACTCGAGCACGGCGACGGG	TCAAGGCTCGCAAGCGAC
GGGCGACAACAGCACGGCAACTGG	CCAAGGTTCGCAAGCGAC
GGGTAGCAACAGCACGGCGACGGG	TCAGGATGCCACGGCGTC
GGGTGATTCGAGCACGGCGACGGG	GCAGGGTTCGCAAGCGAC
GAGTGACAACAGCACGGCGACGGG	CCAGAACGCCACGGCGTC
GGGCAACTCGAGCACAGCGACGGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013361.1\|WP_009898294.1\|147585_149127_-\|membrane-protein	unknown	unknown	unknown
NZ_CP013361.1\|WP_009898267.1\|139474_139777_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013361.1\|WP_025987410.1\|160340_161030_+\|DotU-family-type-IV/VI-secretion-system-protein	unknown	unknown	gnl\|CDD\|378275
NZ_CP013361.1\|WP_080558013.1\|154169_154376_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013361.1\|WP_009894707.1\|144288_144513_-\|DUF1656-domain-containing-protein	unknown	unknown	gnl\|CDD\|377931
NZ_CP013361.1\|WP_029227146.1\|161032_162709_+\|OmpA-family-protein	unknown	unknown	gnl\|CDD\|143586
NZ_CP013361.1\|WP_025987411.1\|159737_160310_+\|type-1-fimbrial-protein	unknown	unknown	gnl\|CDD\|226069
NZ_CP013361.1\|WP_038708388.1\|156163_156889_+\|fimbria/pilus-periplasmic-chaperone	unknown	unknown	gnl\|CDD\|236634
NZ_CP013361.1\|WP_038708432.1\|144509_146576_-\|FUSC-family-protein	unknown	unknown	gnl\|CDD\|377393
NZ_CP013361.1\|WP_009898310.1\|157048_159745_+\|fimbrial-biogenesis-outer-membrane-usher-protein	unknown	unknown	gnl\|CDD\|225729
NZ_CP013361.1\|WP_009898264.1\|137933_138857_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP013361.1\|WP_019255400.1\|141969_143394_-\|TolC-family-protein	unknown	unknown	gnl\|CDD\|273830
NZ_CP013361.1\|WP_025987413.1\|154348_154942_-\|membrane-protein	unknown	unknown	gnl\|CDD\|284781
NZ_CP013361.1\|WP_019255401.1\|140770_141970_-\|transcriptional-regulator-CynR	unknown	unknown	gnl\|CDD\|183051
NZ_CP013361.1\|WP_009898320.1\|163052_163592_+\|type-VI-secretion-system-contractile-sheath-small-subunit	unknown	unknown	gnl\|CDD\|226047
NZ_CP013361.1\|WP_009898306.1\|155527_156082_+\|type-1-fimbrial-protein	unknown	unknown	gnl\|CDD\|226069
NZ_CP013361.1\|WP_009898285.1\|143387_144287_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|182548
NZ_CP013361.1\|WP_155275044.1\|140423_140657_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013361.1\|WP_155275045.1\|149474_149831_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013361.1\|WP_009898304.1\|152646_154098_-\|PhoPQ-regulated-protein	unknown	unknown	gnl\|CDD\|226737

Protein	Function_ID	Function_description	E-value
NZ_CP013361.1\|WP_025987411.1\|159737_160310_+\|type-1-fimbrial-protein	gnl\|CDD\|226069	COG3539, FimA, P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion].	5.98254e-21
NZ_CP013361.1\|WP_025987410.1\|160340_161030_+\|DotU-family-type-IV/VI-secretion-system-protein	gnl\|CDD\|378275	pfam09850, DotU, Type VI secretion system protein DotU. DotU is a family of Gram-negative bacterial proteins that form part of the membrane-joining complex of the type VI secretion system. DotU binds tightly to IcmF and together they are tethered to the inner membrane at one end and the peptidoglycan layer at the other; they interact with Lip1 which then tethers the peptidoglycan layer to the outer membrane.	7.68393e-22
NZ_CP013361.1\|WP_009894707.1\|144288_144513_-\|DUF1656-domain-containing-protein	gnl\|CDD\|377931	pfam07869, DUF1656, Protein of unknown function (DUF1656). This family contains bacterial proteins, many of which are hypothetical. Some proteins in this family are putative membrane proteins.	2.36543e-05
NZ_CP013361.1\|WP_025987413.1\|154348_154942_-\|membrane-protein	gnl\|CDD\|284781	pfam07437, YfaZ, YfaZ precursor. This family contains the precursor of the bacterial protein YfaZ (approximately 180 residues long). Many members of this family are hypothetical proteins.	1.36206e-16
NZ_CP013361.1\|WP_038708388.1\|156163_156889_+\|fimbria/pilus-periplasmic-chaperone	gnl\|CDD\|236634	PRK09926, PRK09926, fimbrial chaperone.	2.86011e-94
NZ_CP013361.1\|WP_038708432.1\|144509_146576_-\|FUSC-family-protein	gnl\|CDD\|377393	pfam04632, FUSC, Fusaric acid resistance protein family. This family includes a conserved region found in two proteins associated with fusaric acid resistance, FusC from Burkholderia cepacia and fdt-2 from Klebsiella oxytoca. These proteins are likely to be membrane transporter proteins.	4.3239e-114
NZ_CP013361.1\|WP_009898310.1\|157048_159745_+\|fimbrial-biogenesis-outer-membrane-usher-protein	gnl\|CDD\|225729	COG3188, FimD, P pilus assembly protein, porin PapC [Cell motility and secretion / Intracellular trafficking and secretion].	0
NZ_CP013361.1\|WP_009898264.1\|137933_138857_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.72251e-52
NZ_CP013361.1\|WP_019255400.1\|141969_143394_-\|TolC-family-protein	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	9.46095e-61
NZ_CP013361.1\|WP_019255401.1\|140770_141970_-\|transcriptional-regulator-CynR	gnl\|CDD\|183051	PRK11242, PRK11242, DNA-binding transcriptional regulator CynR; Provisional.	4.29412e-166
NZ_CP013361.1\|WP_009898320.1\|163052_163592_+\|type-VI-secretion-system-contractile-sheath-small-subunit	gnl\|CDD\|226047	COG3516, COG3516, Predicted component of the type VI protein secretion system [Intracellular trafficking, secretion, and vesicular transport].	1.53951e-83
NZ_CP013361.1\|WP_009898306.1\|155527_156082_+\|type-1-fimbrial-protein	gnl\|CDD\|226069	COG3539, FimA, P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion].	1.26113e-17
NZ_CP013361.1\|WP_009898285.1\|143387_144287_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|182548	PRK10559, PRK10559, p-hydroxybenzoic acid efflux pump subunit AaeA.	9.19596e-71
NZ_CP013361.1\|WP_029227146.1\|161032_162709_+\|OmpA-family-protein	gnl\|CDD\|143586	cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA. OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. Well-studied members of this family include the Escherichia coli outer membrane protein OmpA, the Escherichia coli lipoprotein PAL, Neisseria meningitdis RmpM, which interact with the outer membrane, as well as the Escherichia coli motor protein MotB, and the Vibrio flagellar motor proteins PomB and MotY, which interact with the inner membrane.	3.10508e-33
NZ_CP013361.1\|WP_009898304.1\|152646_154098_-\|PhoPQ-regulated-protein	gnl\|CDD\|226737	COG4287, PqaA, PhoPQ-activated pathogenicity-related protein [General function prediction only].	0

>NZ_CP013361.1|WP_155275045.1|149474_149831_-|hypothetical-protein
MNTPLSTHSPNFKSLVRRLAARLHALVTTRNCRDLLAWKTRKELERLLPTGTPMTQVGWRLGPPHQAVEHPGGYVTWIFLSDGQWLREPGRLLMWSGQTRSLKLTFDREQILTQMQLD
>NZ_CP013361.1|WP_009898294.1|147585_149127_-|membrane-protein
MSISQTRIWMFGFVIAFMLAMSGPLTHTLQKTVDIDKQRNHAPEETATSDTKSAEQPIASEAHQAQTLPRIDPARFPADHFDELPMHLASIGGNERLPSGPLPPGPLPDTSFSPFPFQRGVDAAIHAGPPIPAPSSLTQASIDARTRADTSLDPGTPQPSEAAGMPLSFYADMVEQAMNRTAHDAITLAKLDPDATPLPDMQAEPHDRSAGTHAPIFYADMLAASIHVSIANDRMPSAPPLLTQRAIDIAWTKLFARELPAATMPPAPTPRVASVDATLQAEPFDLAQWNAPDDAHSDLPPFELDGQHDVAPPYSPADTLSSSTPPTNTDSPPDTRVARVEAMRATDFESADGHAAALCSRPLGADERPMEGHAIGLSGSGMAMLVMEQFASSARAASDYARECIHDRPTAFVNSLALPRPSDHFDSSEDASRITFLPRFANDPFQSAFSMPDDTLTHWESPYSGDFALTHKSEPSVHRERDADVRHRVRSCGREDRTGNRSCIATANSDRSD
>NZ_CP013361.1|WP_038708432.1|144509_146576_-|FUSC-family-protein
MPHASVAPLRSRDPLSIDHRKLFFSISTFIAAALVLLISFTVSFPRPWWALLTVYVTAQPMAGAFRPKVLYRLAGIAAGAMVAIVVAPNLQNSPLLLVLCLALWIGFCIYLAVLDRTPRAFLFQMAAFSSAVICLPYLDDPADIFITAISRVEEMTVAILCVTVAHMVLRPAGVRPVIHERALSFLDDACRWTAEAFGTHHARLEHEHRRKLAADVVELGMIAMNLPFDQRFALATRETVTALQHRLAALLSIASAAANRLDRLRSLNAVDAETAALIDSLIVDLRASQEVGDALDIDLASRCRALAAKRLRDPAWTSLLAASLFDRTADFIDTLHAARSLVRTFGDSDVELERHARLVDGAHRFRLARDHGLALLAGAATTTAIMIYCAVWILLAWPSGSATAAFAALVTCSFAAQDDPAPAIGRYLIATLTTFPLAALYLFVILPRVDGAGMLILTLAPAFLWMGYIQADPARSARALPMFSCFIVAMGFLDRFQADFATFVNTGLAQVGGIVTTLVVTKLFRSASTRWTAYRIVRQNWAELAQMADPREALDAQAWTARAVDRLGQVASRVALADPGDALHAVDGLSDLRIGRNIIQVRQRIGRGSARTRHAIERALGEVSNLYRARADASLPVPASAPLLRALDLAIHSAAHDPAGRDDATLLALVGMRCNLLPNVQPIEGGAR
>NZ_CP013361.1|WP_009894707.1|144288_144513_-|DUF1656-domain-containing-protein
MIEEIHIFGIYMPSALAWAIAALILTFLLRGMLLRLPLRLFLWQPALLELAAFFLLWLGIARLADAFLPRGILS
>NZ_CP013361.1|WP_009898285.1|143387_144287_-|efflux-RND-transporter-periplasmic-adaptor-subunit
MKRTIPLLRTCLTAAILVTILGAIYALWTRYQIEPLTRDGKVRADVVPIAPDVGGLVTDVRVHDNQKVTKGQVLLVIDPSRYRIALEHAQADLASQQAELDEAVREDRRNRALPDVVATESTEQGATRVEKLRAAVAQARAARDLAALNLERTRVRAPVDGTVTNVGLLPGVYLSAGKGAMALVNDRSLRVEGYFEETKLPAIHVGDPASVYLMGIASEIRGHVQSIAGGVEDRERAGGAAQLANVNPAFTWVRLAQRIPVRVAIDSVPPGLRLVPGQTASVEIHARAGDVTVRRSLPW
>NZ_CP013361.1|WP_019255400.1|141969_143394_-|TolC-family-protein
MVSAAAKAAAAVLCVALAACAEVGPDYRIPPGALVNTPAANRPFVAGASGAKVASGEPLPDRWWRLFDDPALDGLVEKALSGNVDLRVAEANLARSDALLAAARTAREPSIAADASTTYTQQSAQSVLSHVEPPRHEIYNIGFTASYDLDLFGGIRRGIEAASADREAAAAARDLARVNVAAEVTRAYSDLCNAGNQLDIARRSISVQERRLALTRLLVAHGRAPSFEQRRDEGAADSSRAQLAPLEARRLNAAFRLAALTGQPPENYDRALLACRTPLSLAAPIPTGDGRALLKRRPDVRAAERRLAAATARIGVETAALYPDIKLGASIGSTGGAASFFTPLTNRFAIGPMVTWDLHRNAIRARIEAARADSRASLAHFDATVLAALRETETALETYAGALERLRRLEASRDAARAVMERTDELRRGGKVGGLVALDAERGWLAAQAAVAAAQREVNDDQIATFLALGGGWQ
>NZ_CP013361.1|WP_019255401.1|140770_141970_-|transcriptional-regulator-CynR
MESDMMAARSATFYDHLCDDAATGVSDRSAAGAPADARRASDMPGDAAADGRRPPRTIPRSATAREAQDVDPPERHAQRLIRRNMKSMQRNPLLRNICYLLAVDEHRNFTRAAEALSISQSALSQKIRQLEDELGAQLFDRSGRVVQLTDFGGVYLEYARRAHSDLLTAQRALNDVHDLSRGQLRIGFTPTFTEYLIAPVIEHFHERYPGIVIEMTEMSLDAVETALGDDQVDLAFGFVDVRSDEIEAEALFPERLMLVAGDTHPLTAQRDPITPDQLAETPLALLTTSFVSRFYIDSYFQSYDMKPNVALQANSISAVLKIVRRGKIATILPGTIEFEHRDLQYVPLDPPFPVRTVALLRRKGAYRTVASTAFAESVRALLDNGSLSSLRTMTKRDDS
>NZ_CP013361.1|WP_155275044.1|140423_140657_+|hypothetical-protein
MTNSAHASDIVPARLKPLSRASVSTAESKCGSIEMSTRTLFLRAGAAGWAERIGAGADASPLAGSAVCAARIVAFRS
>NZ_CP013361.1|WP_009898267.1|139474_139777_-|hypothetical-protein
MFKHTLVSLAVALTAFSGIPTNASAQQSQSAAHAESSVRAADAAYTTQLAARSAATGGGVDHVTGAKAAVPAGNAPASRSIAPELQCVGPVSFCNPYFGS
>NZ_CP013361.1|WP_009898264.1|137933_138857_-|LysR-family-transcriptional-regulator
MRVFLKVAETHHFSHAANQLNLSPSLVTRYVGDLESHLGVKLLQRSTRKTVLTEVGVRYAEGCRALLANLHEIESRATHESSAIAGDLHVVALDSITSPELAGLFAEYQSRHPDVSLRITQTDSEVDLLGGGFDVGIVADTMITSVSLVSRTLIHAPLVAVASPGYLLQAPPPTRPADLARHRIIGLAAGARTYRWTGKNNAVDTTQIDTPITVNNAPMQRQLVLAGGGIGLLPEYLVANDLRIGTLTRLLGDYRIANDGVTISLVYPGREFLPGKVRAFVDLAAARFKLPMISVPRAVGRVDMSVA
>NZ_CP013361.1|WP_009898304.1|152646_154098_-|PhoPQ-regulated-protein
MLSITYPHAEAAPMDSPCQADAHRDLTDTLACYRQTVESQPLNYTMTSVVQLPGIEQRTYRLVSQSWSPDQLVRPDTWVHEVTLYIPQDALPHRALVIANDGTRHPSDGETPRSPNDFLPDTLTDIARNTRTAVISVSDVPNQLLTYAGDGKPKAEDDSVARSWTLFMQSPHTRATMPLHVPMAASVWRAMSLAERELTTLGIHRFVVSGISKRAWTTWLALIGDKRIDAIAPFAIDLLSTRAALDNMYRSYGGNWPLAFYPYYAEGIDRTLDSRAFGLLMRIEDPLSYLGTRHGSRLAVPKYIVNASGDDFFVPDNSQLYFDKLPGAKALRMVPNASHSDIRRATRDSLIPFVNRIQHGKALPQVEAMPADTNGQTILRLRTSEQPRQLLLWQATNPHARDFRYACGIRYTSTPVTMNGAPPRRLVLDRPASGWRAYFVEATFDDGFVATSQTYILGDGYPSTAPPPIGDSCRTLPGRNTRS
>NZ_CP013361.1|WP_080558013.1|154169_154376_+|hypothetical-protein
MATADEILDELIDYPRQNRRLFEPTVTMPRAMRQDERRFLQDGAWRGMHRALASFDRRALQKEKPAAI
>NZ_CP013361.1|WP_025987413.1|154348_154942_-|membrane-protein
MSRTESLIFAKRPGWPRVLSKILRAASWIAVFSFMSSARASDYSIVIGNGYQSVSRTPTGTGFGFLFDATRSGEDAYSIGPGLSFGVPIGAVSLTAAGKALYVRSADGRSGLTTPIGVIASLRAASRLSLVGRALYTPRSFFNAGLGAYTQAAAGVRSTYKPINLEAGWRYEELKGRNGTQNARLANGPYIAAGFSF
>NZ_CP013361.1|WP_009898306.1|155527_156082_+|type-1-fimbrial-protein
MKKNVVSFAAAALLGLGATQAAFAQTVGAAQGKVTFNGELITSTCTVDAGSKDQIVQLPKVSTNTLTTAGQTAGSRPFDIKVIDCPKEVKVAAHFEMDNMHPESRTLKNLDETDKGAKNVSVQLVEADGTPLDVGSTSKNFVEVSDNGAGKYGATLTYGGQYYALGKTDPGLVNTFTRFTLAYE
>NZ_CP013361.1|WP_038708388.1|156163_156889_+|fimbria/pilus-periplasmic-chaperone
MSAAVAAAACCLASALSQAAIVITGTRVVYPESSREVNVRLTNVEQSPVLVQAWIDDGNAGASPDEIKVPFVLMPPVFRVEPKKGQTLRVMYTGDDLPKDRESVYWLNVLEIPPKPTVEAEQNLLQLAFRTRIKLFFRPSALEDGNAAQARDQLTWKVVRNDKGVTVLRAENRSPYYISLSQVTAKSGEESTQFDPGMVSPFGSRDFVSKRDTSTLSAHAEISYKLLNDYGAEVAGTATAE
>NZ_CP013361.1|WP_009898310.1|157048_159745_+|fimbrial-biogenesis-outer-membrane-usher-protein
MPVDAAEFDGTRIDEHSRSDAMGAALLDAAPTQHDRKALLVASHASPSAPTTVSFNSRLLMSGGIDLSRFERGNPVVAGIYPVDVTVNGERRGRMDVEFRDVRGRDSAAPCFTRATLERLGVEGDFVVKRLDAARGVTGEQSGRPPAIAESACIGLHDALPDATYTLDTADLTLDLTIPQVDMRKTARGYVDPSRWDNGVNAGLLQYNLSGYASENKFFGSGTSSLFLGLQAGVNIGAWRVRQRSNLMWGNRSAGMSWRSLETYVQRDITALRSQITLGDSYTTGEIFESFGVRGVQLASDDRMLPVSLQSYAPTIRGIADTNARVAVRQRGNVIYEASVPPGPFEFDDLPPTGYGGDLDVTITESDGRTKQFTVPFASVRQLLRPGMQRFNFTVGQYRDALSNGKPWVAQLTYQRGLTNLLTGYAGLLSSTGYASGLIGVALNTPIGAFAFDVTSARTSLPGQGARNGFSSHVSYSKMVPSTGTNFSMAAYRYSTANYYSLADAVIARYGYNAEERAWPNDYRARTRLQLNVNQRIGDRSSAYVSSSLLNYWNGRGRDIQFQAGFSSVFKRVSYTVYAQRSRSSDDRTVTQVGVNLSIPLGGGAYTTRNAFSSLTTSLSRASNGDSSVQANLSGSTAHVVPIDYGINVSRSVSGDSNSASLGVYGTYRSPFGTYSGNASVDNRARQASFGANGAVVLHRGGVTLSPPLGPAAALVEAKGAKGGRLINGQGATIDRFGYAVIPSLMPYRANTVAIDPSELPDDVELANTSEEVVPRNNSIVFVKMETKRGRPVFAATETEDGKPLPMGSELFDVDGKSLGGVGQGGMAFLRGLEGSGNLVAKWGTGSSEQCTMPYAVPVDQAEAKKSRAIVRIRLRCEPQLRAEASQTSDGDGETRND
>NZ_CP013361.1|WP_025987411.1|159737_160310_+|type-1-fimbrial-protein
MIEMNRLTLMRGATRRWSAIAAAAMFASSAACGAPPSPTVTIKFKGSYNPVTCTVVEGNENKVVNLPKISTSSLTNAGQTAGATAFDISVLCDGYAGNVVTFFEHGPTANENGNLDVEDPNDGQSATGVQIQLVNGDGSPIKVGDLSTMKTVPVEASTPTPIPFFARYYATGKSGAGKVRTHVTFVIQML
>NZ_CP013361.1|WP_025987410.1|160340_161030_+|DotU-family-type-IV/VI-secretion-system-protein
MSIGMPAQSLRMLLQDTMLHVALLTEGARISRVHDWRARCIALVRQFEQAMQDGGYRGGIANELGLAQCVLLDEMTMRNLSPEQKEEWLRELLQFRFHSTRDGLGQVRARVDRLSSAHSANTELLEMYSLFYEFGLLEDRKGAALAGALASEAKPALGKKTAKAPEIWNESGPSDEAAHGRPWRIAGSLLAFAALMTMWLVIDARLSHEVEQMGVTSTDEATIRPESGD
>NZ_CP013361.1|WP_029227146.1|161032_162709_+|OmpA-family-protein
MSRRIRFWLVWGAIPFVVLASLCLPLGMQPEWSHVLTIVLIIAAVVLAIEISERFRETRQDRTVEAEIDDHELAVIIVAGPHASSLFNSKGDDAMLRREAGALWLRADNVEQFRETMARIKASRGRFPDAAVVPLVSESDDESEMRQAFSKWRTELRESLCYPDAAYVLPCYLAVYTCLGFKGGDSARPKWTGDAIEIGAGQMNAASKVGELLAAIRQQLLRPSRTGSSAQCALGLGAFDWLDATALLSSMSALANTPPFMLKGLTLADVGRQPVRPGAWTRWLTVRTGLHIRRPQSSTSPLPVPRVTKVAESGIREGWSSARNIVSARASFVPALVFSTVSTLGIAVAVSAWTNGRMIQRVATDMADYRSAPDEWIGKKRFAQARLEHDRTTIVDTLLNGVPAGLGWGLYRGQELLVKLDMALVSPRGESTAMQLDTVTLFATGQATFSPGAVQRELQHALRMILANPEQRVLIVGHSDSAGSDAVNLQLSKARARAIRDWFVDQGVLKTRFIVQGAGDTHPVADNASPLGRALNRRVEILLIPDVASDRTAIETEL
>NZ_CP013361.1|WP_009898320.1|163052_163592_+|type-VI-secretion-system-contractile-sheath-small-subunit
MAISNSSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPIEPLPAVGDRKFFSIDIDNFDERMKAMKPRVAFSVPNTLSGDGQLMVDITFESMDDFSPAAIAKKVGALSQLLDARTQLANLQTYMDGKSGAENLVSKVLKDPALLSALAKAPKPAAEQAENRESKEKH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013361_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013361_2

1659842-1659933

Orphan

Consensus_repeat	Method
GCGACGCGCGCAAGGCCGAAGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013361_2

>merge|NZ_CP013361|2|1659842-1659933|CRISPRCasFinder
GCGACGCGCGCAAGGCCGAAGCGGGCGCGAAGCGCACGGCCGACGACGACAGGCACCGCAAGCACGACGGCGACGCGCGCAAGGCGGAAGCG

>NZ_CP013361|2|1|1659842-1659933|CRISPRCasFinder
GCGACGCGCGCAAGGCCGAAGCG	GGCGCGAAGCGCACGGCCGACGACGACAGGCACCGCAAGCACGACG
GCGACGCGCGCAAGGCGGAAGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013361.1\|WP_009899920.1\|1665790_1666681_+\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|226145
NZ_CP013361.1\|WP_011401139.1\|1671943_1672156_+\|DUF3079-domain-containing-protein	unknown	unknown	gnl\|CDD\|337966
NZ_CP013361.1\|WP_009899933.1\|1657288_1658305_-\|1-aminocyclopropane-1-carboxylate-deaminase	unknown	unknown	gnl\|CDD\|183494
NZ_CP013361.1\|WP_009896595.1\|1658497_1659007_+\|Lrp/AsnC-ligand-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|183009
NZ_CP013361.1\|WP_009899941.1\|1649538_1651569_+\|BCCT-family-transporter	unknown	unknown	gnl\|CDD\|376718
NZ_CP013361.1\|WP_029227226.1\|1651825_1653034_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NZ_CP013361.1\|WP_009899924.1\|1663656_1664382_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
NZ_CP013361.1\|WP_009896602.1\|1653208_1653550_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013361.1\|WP_009899935.1\|1656281_1656635_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013361.1\|WP_025987468.1\|1653986_1655378_+\|alkaline-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|293737
NZ_CP013361.1\|WP_009899914.1\|1671355_1671628_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013361.1\|WP_019255458.1\|1662193_1663456_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340877
NZ_CP013361.1\|WP_009899917.1\|1668375_1670001_+\|cytochrome-c-methylamine-utilization-protein	unknown	unknown	gnl\|CDD\|224771
NZ_CP013361.1\|WP_009899928.1\|1661235_1661856_-\|HAD-hydrolase-like-protein	unknown	unknown	gnl\|CDD\|319799
NZ_CP013361.1\|WP_009896597.1\|1656954_1657113_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013361.1\|WP_025405556.1\|1666900_1668379_+\|metallophosphoesterase	unknown	unknown	gnl\|CDD\|277318
NZ_CP013361.1\|WP_009899922.1\|1664431_1665739_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929
NZ_CP013361.1\|WP_009899916.1\|1670163_1671024_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|377216
NZ_CP013361.1\|WP_009899936.1\|1655555_1656197_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013361.1\|WP_127446982.1\|1653574_1653871_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP013361.1\|WP_011401139.1\|1671943_1672156_+\|DUF3079-domain-containing-protein	gnl\|CDD\|337966	pfam11278, DUF3079, Protein of unknown function (DUF3079). This family of proteins with unknown function appears to be restricted to Proteobacteria.	1.88329e-34
NZ_CP013361.1\|WP_009899933.1\|1657288_1658305_-\|1-aminocyclopropane-1-carboxylate-deaminase	gnl\|CDD\|183494	PRK12390, PRK12390, 1-aminocyclopropane-1-carboxylate deaminase; Provisional.	0
NZ_CP013361.1\|WP_009899920.1\|1665790_1666681_+\|amidohydrolase-family-protein	gnl\|CDD\|226145	COG3618, COG3618, Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only].	3.73384e-69
NZ_CP013361.1\|WP_009899941.1\|1649538_1651569_+\|BCCT-family-transporter	gnl\|CDD\|376718	pfam02028, BCCT, BCCT, betaine/carnitine/choline family transporter.	0
NZ_CP013361.1\|WP_029227226.1\|1651825_1653034_-\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	4.21559e-55
NZ_CP013361.1\|WP_009899924.1\|1663656_1664382_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	3.20406e-58
NZ_CP013361.1\|WP_009896595.1\|1658497_1659007_+\|Lrp/AsnC-ligand-binding-domain-containing-protein	gnl\|CDD\|183009	PRK11169, PRK11169, leucine-responsive transcriptional regulator Lrp.	6.18054e-47
NZ_CP013361.1\|WP_009899917.1\|1668375_1670001_+\|cytochrome-c-methylamine-utilization-protein	gnl\|CDD\|224771	COG1858, MauG, Cytochrome c peroxidase [Inorganic ion transport and metabolism].	3.57407e-82
NZ_CP013361.1\|WP_025987468.1\|1653986_1655378_+\|alkaline-phosphatase-family-protein	gnl\|CDD\|293737	cd16013, AcpA, acid phosphatase A. Acid phosphatase A catalyzes the hydrolysis reaction via a phosphoseryl intermediate to produce inorganic phosphate and the corresponding alcohol, optimally at low pH. AcpA hydrolyzes a variety of substrates, including p-nitrophenylphosphate (pNPP), p-nitrophenylphosphorylcholine (pNPPC), peptides containing phosphotyrosine, inositol phosphates, AMP, ATP, fructose 1,6-bisphosphate, glucose and fructose 6-phosphates, NADP, and ribose 5-phosphate. AcpA is distinct from histidine ACPs and purple ACPs, as well as class A, B, and C bacterial nonspecific ACPs.	5.01657e-100
NZ_CP013361.1\|WP_019255458.1\|1662193_1663456_-\|MFS-transporter	gnl\|CDD\|340877	cd17319, MFS_ExuT_GudP_like, Hexuronate transporter, Glucarate transporter, and similar transporters of the Major Facilitator Superfamily. This family is composed of predominantly bacterial transporters for hexuronate (ExuT), glucarate (GudP), galactarate (GarP), and galactonate (DgoT). They mediate the uptake of these compounds into the cell. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.64768e-73
NZ_CP013361.1\|WP_009899928.1\|1661235_1661856_-\|HAD-hydrolase-like-protein	gnl\|CDD\|319799	cd04303, HAD_PGPase, phosphoglycolate phosphatase, similar to Synechococcus elongates phosphoglycolate phosphatase PGP/CbbZ. Phosphoglycolate phosphatase catalyzes the dephosphorylation of phosphoglycolate; its activity requires divalent cations, especially Mg++. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	4.54494e-68
NZ_CP013361.1\|WP_025405556.1\|1666900_1668379_+\|metallophosphoesterase	gnl\|CDD\|277318	cd00839, MPP_PAPs, purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain. Purple acid phosphatases (PAPs) belong to a diverse family of binuclear metallohydrolases that have been identified and characterized in plants, animals, and fungi. PAPs contain a binuclear metal center and their characteristic pink or purple color derives from a charge-transfer transition between a tyrosine residue and a chromophoric ferric ion within the binuclear center. PAPs catalyze the hydrolysis of a wide range of activated phosphoric acid mono- and di-esters and anhydrides. PAPs are distinguished from the other phosphatases by their insensitivity to L-(+) tartrate inhibition and are therefore also known as tartrate resistant acid phosphatases (TRAPs). While only a few copies of PAP-like genes are present in mammalian and fungal genomes, multiple copies are present in plant genomes. PAPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	6.97841e-09
NZ_CP013361.1\|WP_009899916.1\|1670163_1671024_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|377216	pfam04072, LCM, Leucine carboxyl methyltransferase. Family of leucine carboxyl methyltransferases EC:2.1.1.-. This family may need divides a the full alignment contains a significantly shorter mouse sequence.	4.17989e-52
NZ_CP013361.1\|WP_009899922.1\|1664431_1665739_+\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.46405e-132

>NZ_CP013361.1|WP_009896595.1|1658497_1659007_+|Lrp/AsnC-ligand-binding-domain-containing-protein
MCATKKSAPKAAAQPAGADIDRVDRAILRMLQRDASISNVALAAKVNLSAPACLRRVERLKEMGLIRGIVALLEPKALNAGMLVMIGVVLDRSTPDSFGAFEQAAQKVSGCMECHVVTGEFDYIMLIRTRDSDTFNRLHAEQLLYLPGVRQIRTFVVLKEILSTTSFPI
>NZ_CP013361.1|WP_009899933.1|1657288_1658305_-|1-aminocyclopropane-1-carboxylate-deaminase
MNLQKFPRYPLTFGPTPIQPLKRLSAHLGGKVELYAKRDDCNSGLAFGGNKTRKLEYLIPDALAQGCDTLVSIGGIQSNQTRQVAAVAAHLGMKCVLVQENWVNYHDAVYDRVGNIQMSRMMGADVRLVPDGFDIGFRKSWEDALADVRARGGKPYAIPAGCSDHPLGGLGFVGFAEEVRVQEAELGFKFDYVVVCSVTGSTQAGMVVGFAADGRADRVIGIDASAKPAQTREQILRIARNTADRVELGRDIASGDVVLDERFGGPEYGLPNEGTLEAIRLCAKLEGVLTDPVYEGKSMHGMIEKVRLGEFPAGSKVLYAHLGGVPALNAYSFLFRDG
>NZ_CP013361.1|WP_009896597.1|1656954_1657113_-|hypothetical-protein
MVSNNIVALHNFEIACDAISISGEVTVRSRQARGALAGRPMPIAGWMRARSN
>NZ_CP013361.1|WP_009899935.1|1656281_1656635_-|hypothetical-protein
MGFVGGERRRARIAESNEIDGAMLITEVASEPLAALGGARSEATPPLTLYGAYRQGFADYLAGRPNPYRIGSRLAGVWHEGHAEAASNDALDFTARARTCGGARTAANPVAFFRRRR
>NZ_CP013361.1|WP_009899936.1|1655555_1656197_+|hypothetical-protein
MKIRSGLVAELTVNLLLPWAAYRAAVPHWGETGGLIASAVPPLAWSVIELARFRRIDALSAVVLFGIVLSIAAALAGGSPRMLLMRESLASGAIGVAFLGSLALRKPLVFHLARATIAREAHDGAARIDALWAERPAFVSAMRLMTLVWGSGLVAENLLRAWMVWNWPVERVLVVAPFVGYGIYGALMLWTLWYRKVMRAHALAGLPRGGALG
>NZ_CP013361.1|WP_025987468.1|1653986_1655378_+|alkaline-phosphatase-family-protein
MAKILENVEHIVVVMFENRSFDTMLGWLYPPGTQPAHVLPARGSPQFDGLKPDMSNPSRAGKTIAVTREATNNVIPDPQETFVNVTSQILGPGGAGNPWPPMQGFVVNYETTQTTDPGHVMQCHSVAQLPTLTALARAYAVSDAWFASVPSQTWPNRAFAHAGTSNGHVNNGAIPDPLEWDVPTIFDVLSSIGASWAVYSDTAVTPSLTHTMFPSLWNDKYADNFKRFPDFVAACKNDALPRYAFVEPSFLFEPNDQHPPHDVLAGDKFLHDIWTAISTSPGWPRTLLVVTYDEHGGCFDHVLPPANATPPDAASNPGDETFEFDRFGVRVPAVVVSPYIEAGTVFRSPTNVPYDHTSILATLRDWLAIAPDKMLKSARIANAPTLAQLFTRSVPRGDLPAIAAPSADFVQPPPSAPLNDLQKSLVTGTSRRDGNDPAASVAPIATRQHALDFFTRRATAKPT
>NZ_CP013361.1|WP_127446982.1|1653574_1653871_+|hypothetical-protein
MTTEPAHASGGARSFTHRADRAAIRRHDGRRHRQRHLRHQRGYRRNESVFMGRGANSAPGDKFAAMIETAPARAPPPARRVAGTPAAPPCFSRNIGYT
>NZ_CP013361.1|WP_009896602.1|1653208_1653550_+|hypothetical-protein
MIAPATPAALAAGATTFAEWAALGTLALLYLFGLGWSLRGALARSRGRAYWLACAALIAGGTACALLAKPSAPNSGEMPPGFGLGVLVVMLGIAGTTAGCAWQAIARLRHGQR
>NZ_CP013361.1|WP_029227226.1|1651825_1653034_-|serine-hydrolase
MNPESVTPATAAAAATAAAAATDHAALAGRLDRVFATALAERRVVGAVALVARGGELVYRRAHGFAERETQRPMREDTLFRLSSITKPIVTVAVLRLVAAGRMALDAPITRWLPEFAPALPDGRAPALTVHQLLTHTAGLSYWLLEAPGSAYHTLGISDGIDLVDFDLAENLRRIAAAPLAFEPGSAWRYSLALDVLGAAIERETGLALPDAVAQLVTTPLGLRDTGFVAADPARFAAAYANAAPQPVRITDNLDVPLPEGHGVAVRFAPSRVFDATAFASGGAGMYGSADDVLRVLETIRTGGDGFLPAALAAAMRTDHTGPAAETRGPGWGFGYGGAVLSDPARAQSPQSAGTLQWGGVYGHSWFVDAARGLTVLLMTNTAYEGMSGPLTVEVRDAVYAV
>NZ_CP013361.1|WP_009899941.1|1649538_1651569_+|BCCT-family-transporter
MPSSRSAPRTTLKPQVVVPSLAVIGALLAVCALLPNEAGALFGTGQQWIVERFDWFYVLAITTFLIFIVLIAASRFGNIKLGPDDAEPEFSFVSWTAMLFAAGMGIGLMYFGVGEPIQHYLKPPTALGGTPAAAREAMLMSFFHWGLHAWATYGVMGLVLAYFGFRYNLPLTLRSGLYPVLREGVNGWIGHTVDAFALVGTVAGIAVTLGYGVLQLSAGLHTIAGWQTDSDAFRIGLVAVVVALAGLSAASGLDKGVRRLSELNLMLAFALLAFVVVAGPTSFLLRAFGDNVGEYLSKLVSLSFRTYAYEAPNDKGWFGGWTLLYWAWWVSWSPFVGMFIARISRGRTIREFVIGVLLVPTAFNLVWMTAFGNSAIWLDTHAAAGALAQTATNVDALLFRFFDYLPLTQLLSVAAIVLIAVFFVTSADSGAFVIDAIATRGAPHSPVWQRLFWAAVLGVTASVLLVAGGLKALQALTLVAALPVALVMLALCYGLWRGLKADHAHYSQEMAPATSFWTGQHWRQRLSQILRHTTGADARRFIAQTVEPALRKVADELKAGGVDAHVARDDDDAVRLTVPAPAQRDFVYGARVSRKSAPAFRIREAAEPEPQREHVCEVLTFFADGRLGYDIEYLRGDEIIADVLRQYERYVSLAADTRTHLLNRAPEHAGPDGLTQ
>NZ_CP013361.1|WP_009899928.1|1661235_1661856_-|HAD-hydrolase-like-protein
MAYKLIAFDFDGTLADSLACFLLALSESARQHGFRAIDGALLPQVRGMSAHEIVKLLGVPPWKVPLIAADVRRRMHARASDVRLFAGIDATLRALAQRGTRVAIATSNSEAVVRAIAGPATCAHIRHFSCGISLFGKARRLRALAHASGFACADVLYVGDEVRDAQAADRAGIAFRGVAWGYTAPDALRAHCRMPLIERPEELLAL
>NZ_CP013361.1|WP_019255458.1|1662193_1663456_-|MFS-transporter
MTKIARRLMPLLVIMFLIAFIDRQNVGFAKLQMVHALGMTETSYGLGASLFFIGYLLFEVPSTLALHRFGARLWLARIMMTWGVITVLLGFTHSTSVFYVFRFLLGVAEAGFYPGVIYYLTLWFPQSHRTRVLGLFTLGSALANMLGSLAGGLLLSLDGRLGLAGWQWVFVATGLPAVAVAFVALRYLPESVERATFLADDEKRVVLAALKREASPEAVSESPWRALVDPRVLMFALAYMLMSTSLYGVTYWLPTLLKSSGVPASLNGLLNMIPWAIAALLLLWLPARLKRERLVLKAMAIVAGVGVAGFALSLALPGLPLRFAALVLGGACIPLLYPCFWSLPPRFFSGARAAASIAAINSIGNLGGFFAQNLMPYVGKAAGSTSAPMLVPVVCLAALGVGMLAAASVAGRRRAAGMAA
>NZ_CP013361.1|WP_009899924.1|1663656_1664382_+|GntR-family-transcriptional-regulator
MHATDDRLPRYQRLRDELAALIAARHWRPGEAIPTEQALAKRYDVAIGTVRKAVDLLVADGMLERFQGRGTFVRRASFDSSLFRFFRFQSKHGERRIPESRILRREVVEATSAVAAALQIPARAPVIEMTRVRLIDGAPMLAEEIWLPYDRFAAFSRLELDSIGDLLYPVYEAHCNQIVASATETLTVEAIGPVHARLLRIEPGTPAVVIERLAYGYDRRPLEWRRSRGPASEFIYQAEIR
>NZ_CP013361.1|WP_009899922.1|1664431_1665739_+|MFS-transporter
MFEWFATVSLRERRTFWACFGGWALDALDMQMFSLVIPAIVAEWSLSRTQAGFVGGATLVASAIGGWVAGMLSDRFGRVRTLQWTIACFAVGTFACAFATSYPQFVVLKALQGAGFGGEWAAGAVLMAETIRAEHRGKAMGAVQSAWALGWAAAVLLYALAFSLMPAALAWRAMFAIGLLPALLIVYVRRGIVEPSVSPSSPSNTPAAARASVPLVGIFSRDTRRMTLIGALLGVGAHGGYYALMTWLPTYLKVERHLSVLGTGGYLAVIIVAFFCGCIASAQLLDRIGRHGTILAFAACCIATVIAYLFLPLGNAAMLVLGFPLGFFAAGIPASMGALFNELYPRGTRGTGVGFCYNFGRVASAGFPVLVGHMSADMPLGTAIGIDAAIAYSIVVVAVLLLPETRARALDDLAGAHATADARADRIGAPDARHR
>NZ_CP013361.1|WP_009899920.1|1665790_1666681_+|amidohydrolase-family-protein
MSEQEWSTCAHAAEMRCAAGGITAIDAHAHVFETGLPLAGRRRYAPDYDAPLDAYLAQLDAHRVSHGVLVQPSFLGSDCRYLLRALAQQPRRLRGVAVIDAGCEPQVLDTLDRAGVVGIRLNLIGMPDPALDGPAWRATLERIAALRWHVELHAQAQRLGRLIAPLLAHRVNVVVDHFGRPNPACGIADAGFRDLLRTAATRRVWVKVSGVYRNWPLAPGEANARAQEAFDALAAEFGAERLVWGSDWPHTQFERTETFGRAFTLARQWMRDDAMRRAIFVETPARLFRFGEIHGA
>NZ_CP013361.1|WP_025405556.1|1666900_1668379_+|metallophosphoesterase
MPRPILRRAAALLPTLASAALLQACTSSIDNQPDAASASANIQAAWVEIGDANQAIARVITSYAPPAAAPGEAAPAVCPQLNADGKIARMTLRAAAGTAAQRPTASDPADSKPSGFPVSVCEATVPANAKDVTVAGRALPLPKAEPQRVAIIADTGCRMKKADNAFQACSDATVWPFATIAASVAKLNPDLVLHVGDYHYRENACPPDIAGCKNSPWGYGWDAWRADLFEPAAPLLAKAPWVVVRGNHEECARAGQGWFRFLDPRPYSDARSCNDPANDGNANYSEPYAVPLGTGSQVIVFDTAKVGRAALKTTDVQFQIYQKQFQTVAALANKPGMSTTIFTNHHPILAFAPIPGSTPAPGNLALQSVMSSLYAQAYYPPGVQVALHGHVHDFQAINFASGHPATIVSGNGGDNLDVALPDPFPANLTPAPGVVIDKLSHNNSFGFLIMERRAAPARGWTFKAYTAAGKLLASCDQAGTTLTCDKTGFVAP
>NZ_CP013361.1|WP_009899917.1|1668375_1670001_+|cytochrome-c-methylamine-utilization-protein
MTGRRRSSAARRAVPAAALAVRASVTAFALGTARTRRAVLTLSTIARAACGALAACASAIALASGPAAPAATHSTHSTHAARPASAASSTSPMNPTSTPGASGPAHAKAALDAARAKAAPPSSPTTVLLPGAPPERVVDTIGRGTPQVASKVDPTAAVFRPDPTLAALGKRVFFDPALSEPRGTSCASCHDPGRAFAPTLSPAALAGPRVPQGSRPGHFSRRNAPSLLYVRYVPRRHFYQDDDALAPAPFGGLFSDGRADTLAEQLRGPLFDPDEMNNASAAALMRKIGRTGLGAALAGRFGPSVRRDPERMVRALGEAMQAYLQSDEMAPFSSRYDAYVTKRAPLTPQEMRGLALFRNPDKGNCMSCHTLSDTASRPERSLFTDFGYDAIAVPRNRALPANRDPRHFDNGLCDTAAKLRWPEPTQWCAYLRTPGLRNVAIKESFMHNGVFDTLRDAVAFYNTRSTDPARWYHGRDTFDDVPRAYRGNVNVNSTPMNRRPGTPPAMTDADVDDLVAFLRTLTDARYVGLMPAAPDGKAARP
>NZ_CP013361.1|WP_009899916.1|1670163_1671024_+|class-I-SAM-dependent-methyltransferase
MSNQSIAAPDSTAVRVALWRALHVEIDAPPHVLDDGIGLELAAPDDDWRSRPDMAPQATRGYRASIVGRARFVEDLIGEQAERGVAQYVVLGAGLDTFAQRRAKLAAHLRVFEIDQPGTQAWKRQRLIALGYGVPEWLRLVPVDFEASDAWRAQLSAAGFDDSRPAVVSSTGVSMYLTRDAIAGTLRQIATLAPGSTLAMTFLLPLELIDDPAERAQHAAVYERARAAGTPFVSFFSPAEMLALAREAGFREVRHVSTDDLVRRYFEGRPDGLRPSSGEAFLVAST
>NZ_CP013361.1|WP_009899914.1|1671355_1671628_+|hypothetical-protein
MEHLVRIVNDTDRQILAWLRNQVGDERVERAAQHMGRVRKPYLSAICRYLGVWPPISLRYQTRRAEVDHAVGDRYLTLIRQHLATHAASR
>NZ_CP013361.1|WP_011401139.1|1671943_1672156_+|DUF3079-domain-containing-protein
MAKKFPLHPKHPERNCWGCDRYCSVDALSCGNGSDRTQHPVELLGDDWYEWEQENEAAQKQMQQTQAAAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP013361_1	1.3\|150951\|18\|NZ_CP013361\|CRT	150951-150968	18	NZ_CP013361.1	151245-151262	0	1.0
NZ_CP013361_1	1.3\|150951\|18\|NZ_CP013361\|CRT	150951-150968	18	NZ_CP013361.1	151329-151346	0	1.0
NZ_CP013361_1	1.3\|150951\|18\|NZ_CP013361\|CRT	150951-150968	18	NZ_CP013361.1	151497-151514	0	1.0
NZ_CP013361_1	1.5\|151035\|18\|NZ_CP013361\|CRT	151035-151052	18	NZ_CP013361.1	151203-151220	0	1.0
NZ_CP013361_1	1.5\|151035\|18\|NZ_CP013361\|CRT	151035-151052	18	NZ_CP013361.1	151287-151304	0	1.0
NZ_CP013361_1	1.5\|151035\|18\|NZ_CP013361\|CRT	151035-151052	18	NZ_CP013361.1	151455-151472	0	1.0
NZ_CP013361_1	1.7\|151119\|18\|NZ_CP013361\|CRT	151119-151136	18	NZ_CP013361.1	151749-151766	0	1.0
NZ_CP013361_1	1.8\|151161\|18\|NZ_CP013361\|CRT	151161-151178	18	NZ_CP013361.1	151245-151262	0	1.0
NZ_CP013361_1	1.8\|151161\|18\|NZ_CP013361\|CRT	151161-151178	18	NZ_CP013361.1	151329-151346	0	1.0
NZ_CP013361_1	1.8\|151161\|18\|NZ_CP013361\|CRT	151161-151178	18	NZ_CP013361.1	151497-151514	0	1.0
NZ_CP013361_1	1.2\|150909\|18\|NZ_CP013361\|CRT	150909-150926	18	NZ_CP013361.1	151749-151766	1	0.944
NZ_CP013361_1	1.3\|150951\|18\|NZ_CP013361\|CRT	150951-150968	18	NZ_CP013361.1	151413-151430	1	0.944
NZ_CP013361_1	1.3\|150951\|18\|NZ_CP013361\|CRT	150951-150968	18	NZ_CP013361.1	151707-151724	1	0.944
NZ_CP013361_1	1.8\|151161\|18\|NZ_CP013361\|CRT	151161-151178	18	NZ_CP013361.1	151413-151430	1	0.944
NZ_CP013361_1	1.8\|151161\|18\|NZ_CP013361\|CRT	151161-151178	18	NZ_CP013361.1	151707-151724	1	0.944

1. spacer 1.3|150951|18|NZ_CP013361|CRT matches to position: 151245-151262, mismatch: 0, identity: 1.0

ccagaacgccacggcgtc	CRISPR spacer
ccagaacgccacggcgtc	Protospacer
******************

2. spacer 1.3|150951|18|NZ_CP013361|CRT matches to position: 151329-151346, mismatch: 0, identity: 1.0

ccagaacgccacggcgtc	CRISPR spacer
ccagaacgccacggcgtc	Protospacer
******************

3. spacer 1.3|150951|18|NZ_CP013361|CRT matches to position: 151497-151514, mismatch: 0, identity: 1.0

ccagaacgccacggcgtc	CRISPR spacer
ccagaacgccacggcgtc	Protospacer
******************

4. spacer 1.5|151035|18|NZ_CP013361|CRT matches to position: 151203-151220, mismatch: 0, identity: 1.0

ccaaggttcgcaagcgac	CRISPR spacer
ccaaggttcgcaagcgac	Protospacer
******************

5. spacer 1.5|151035|18|NZ_CP013361|CRT matches to position: 151287-151304, mismatch: 0, identity: 1.0

ccaaggttcgcaagcgac	CRISPR spacer
ccaaggttcgcaagcgac	Protospacer
******************

6. spacer 1.5|151035|18|NZ_CP013361|CRT matches to position: 151455-151472, mismatch: 0, identity: 1.0

ccaaggttcgcaagcgac	CRISPR spacer
ccaaggttcgcaagcgac	Protospacer
******************

7. spacer 1.7|151119|18|NZ_CP013361|CRT matches to position: 151749-151766, mismatch: 0, identity: 1.0

gcagggttcgcaagcgac	CRISPR spacer
gcagggttcgcaagcgac	Protospacer
******************

8. spacer 1.8|151161|18|NZ_CP013361|CRT matches to position: 151245-151262, mismatch: 0, identity: 1.0

ccagaacgccacggcgtc	CRISPR spacer
ccagaacgccacggcgtc	Protospacer
******************

9. spacer 1.8|151161|18|NZ_CP013361|CRT matches to position: 151329-151346, mismatch: 0, identity: 1.0

ccagaacgccacggcgtc	CRISPR spacer
ccagaacgccacggcgtc	Protospacer
******************

10. spacer 1.8|151161|18|NZ_CP013361|CRT matches to position: 151497-151514, mismatch: 0, identity: 1.0

ccagaacgccacggcgtc	CRISPR spacer
ccagaacgccacggcgtc	Protospacer
******************

11. spacer 1.2|150909|18|NZ_CP013361|CRT matches to position: 151749-151766, mismatch: 1, identity: 0.944

gcagggttcgcacgcgac	CRISPR spacer
gcagggttcgcaagcgac	Protospacer
************ *****

12. spacer 1.3|150951|18|NZ_CP013361|CRT matches to position: 151413-151430, mismatch: 1, identity: 0.944

ccagaacgccacggcgtc	CRISPR spacer
ccagaacgccacggcatc	Protospacer
***************.**

13. spacer 1.3|150951|18|NZ_CP013361|CRT matches to position: 151707-151724, mismatch: 1, identity: 0.944

ccagaacgccacggcgtc	CRISPR spacer
ccagaacgccacggcatc	Protospacer
***************.**

14. spacer 1.8|151161|18|NZ_CP013361|CRT matches to position: 151413-151430, mismatch: 1, identity: 0.944

ccagaacgccacggcgtc	CRISPR spacer
ccagaacgccacggcatc	Protospacer
***************.**

15. spacer 1.8|151161|18|NZ_CP013361|CRT matches to position: 151707-151724, mismatch: 1, identity: 0.944

ccagaacgccacggcgtc	CRISPR spacer
ccagaacgccacggcatc	Protospacer
***************.**

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

54197 : 78596

uncultured_virus(28.57%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080558217.1\|54197_55466_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	2.3e-39	42.8
WP_157779363.1\|55540_56074_-	DUF2326 domain-containing protein	NA	NA	NA	NA
WP_144410512.1\|56145_57266_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.8e-49	39.9
WP_172820589.1\|57426_58624_+\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	2.3e-102	65.9
WP_009906959.1\|59251_59482_+	hypothetical protein	NA	NA	NA	NA
WP_009906958.1\|59579_59897_+	hypothetical protein	NA	NA	NA	NA
WP_099975758.1\|59984_60134_+	hypothetical protein	NA	NA	NA	NA
WP_009906957.1\|60468_60753_+	hypothetical protein	NA	NA	NA	NA
WP_009906956.1\|61042_61255_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_080558217.1\|61344_62613_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	2.3e-39	42.8
WP_034175064.1\|63910_64096_+	hypothetical protein	NA	NA	NA	NA
WP_009907020.1\|64096_64363_+	DUF1488 domain-containing protein	NA	NA	NA	NA
WP_029227483.1\|64454_66053_+	SagB/ThcOx family dehydrogenase	NA	NA	NA	NA
WP_006480091.1\|66420_67152_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_080001171.1\|67388_67592_+	hypothetical protein	NA	NA	NA	NA
WP_029227484.1\|67787_68210_-	type II toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
WP_009907027.1\|68334_69156_+	fatty acid desaturase	NA	NA	NA	NA
WP_029227485.1\|69252_69432_-	hypothetical protein	NA	NA	NA	NA
WP_009907030.1\|70418_70706_-	hypothetical protein	NA	NA	NA	NA
WP_009907031.1\|70754_71027_-	hypothetical protein	NA	NA	NA	NA
WP_012339007.1\|71090_71288_-	hypothetical protein	NA	NA	NA	NA
WP_009907033.1\|71824_72142_+	hypothetical protein	NA	NA	NA	NA
WP_009907034.1\|72304_72565_+	hypothetical protein	NA	NA	NA	NA
WP_012339006.1\|72836_73076_-	hypothetical protein	NA	NA	NA	NA
WP_012339005.1\|73144_73384_-	hypothetical protein	NA	NA	NA	NA
WP_009907039.1\|74107_74311_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	5.9e-19	70.1
WP_155772935.1\|74539_74695_-	hypothetical protein	NA	NA	NA	NA
WP_009907041.1\|74852_75098_+	translation initiation factor IF-1	NA	NA	NA	NA
WP_038711778.1\|75192_75477_+	hypothetical protein	NA	NA	NA	NA
WP_009907043.1\|75725_75923_-	hypothetical protein	NA	NA	NA	NA
WP_039336681.1\|76294_76657_+\|transposase	transposase	NA	NA	NA	NA
WP_029227479.1\|76656_77004_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	4.7e-40	70.1
WP_009906954.1\|77033_78596_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	2.1e-143	52.1

DBSCAN-SWA_2

128889 : 187320

Leptospira_phage(25.0%)

holin,plate,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009898227.1\|128889_131085_+\|holin	phospholipase C, phosphocholine-specific	NA	NA	NA	NA
WP_144410576.1\|131165_132253_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.4e-44	37.2
WP_004523721.1\|132572_132992_-	YjbQ family protein	NA	NA	NA	NA
WP_004523720.1\|133011_133338_-	thioredoxin family protein	NA	NA	NA	NA
WP_004523719.1\|133810_134503_+	hypothetical protein	NA	NA	NA	NA
WP_080558009.1\|135325_135682_-	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_009898259.1\|136158_137301_-	porin	NA	NA	NA	NA
WP_009898264.1\|137933_138857_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_009898267.1\|139474_139777_-	hypothetical protein	NA	NA	NA	NA
WP_155275044.1\|140423_140657_+	hypothetical protein	NA	NA	NA	NA
WP_019255401.1\|140770_141970_-	transcriptional regulator CynR	NA	NA	NA	NA
WP_019255400.1\|141969_143394_-	TolC family protein	NA	NA	NA	NA
WP_009898285.1\|143387_144287_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_009894707.1\|144288_144513_-	DUF1656 domain-containing protein	NA	NA	NA	NA
WP_038708432.1\|144509_146576_-	FUSC family protein	NA	NA	NA	NA
WP_009898294.1\|147585_149127_-	membrane protein	NA	NA	NA	NA
WP_155275045.1\|149474_149831_-	hypothetical protein	NA	NA	NA	NA
WP_039339343.1\|150675_152571_+	YadA-like family protein	K4F7R4	Cronobacter_phage	6.9e-08	46.1
WP_009898304.1\|152646_154098_-	PhoPQ-regulated protein	NA	NA	NA	NA
WP_080558013.1\|154169_154376_+	hypothetical protein	NA	NA	NA	NA
WP_025987413.1\|154348_154942_-	membrane protein	NA	NA	NA	NA
WP_009898306.1\|155527_156082_+	type 1 fimbrial protein	NA	NA	NA	NA
WP_038708388.1\|156163_156889_+	fimbria/pilus periplasmic chaperone	NA	NA	NA	NA
WP_009898310.1\|157048_159745_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_025987411.1\|159737_160310_+	type 1 fimbrial protein	NA	NA	NA	NA
WP_025987410.1\|160340_161030_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_029227146.1\|161032_162709_+	OmpA family protein	NA	NA	NA	NA
WP_009898320.1\|163052_163592_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_009898321.1\|163625_165125_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_009894730.1\|165325_165808_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_019255186.1\|165935_166478_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_025405980.1\|166483_167833_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_009898325.1\|167829_169131_+	type VI secretion system protein TssL	NA	NA	NA	NA
WP_009898327.1\|169145_173054_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_009898329.1\|173244_173814_+	hypothetical protein	NA	NA	NA	NA
WP_039339348.1\|173914_176608_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.9e-35	26.0
WP_004523693.1\|176682_176952_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_029227147.1\|176964_180417_+	RHS repeat protein	NA	NA	NA	NA
WP_038709601.1\|180309_181668_-	hypothetical protein	A0A292GJ55	Xanthomonas_phage	7.6e-110	49.6
WP_009894750.1\|181700_182729_-	fimbrial protein	NA	NA	NA	NA
WP_009898344.1\|182784_183855_-	type VI secretion system ImpA family N-terminal domain-containing protein	NA	NA	NA	NA
WP_009898345.1\|183873_184923_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_009894755.1\|184919_186800_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_009894757.1\|186801_187320_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA

DBSCAN-SWA_3

751662 : 793115

Burkholderia_virus(43.24%)

integrase,tRNA,plate,tail,transposase

attL 763733:763752|attR 797342:797361

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009895739.1\|751662_752703_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.7e-93	54.0
WP_009899222.1\|752833_754057_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_009895742.1\|754136_754349_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_019254422.1\|754515_754962_+	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	3.3e-22	48.6
WP_009899227.1\|755058_756936_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	4.9e-67	36.2
WP_009895748.1\|756982_757321_-	hypothetical protein	NA	NA	NA	NA
WP_009899229.1\|757379_759422_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	4.2e-35	32.0
WP_144410555.1\|759761_759977_-	hypothetical protein	NA	NA	NA	NA
WP_009899231.1\|760070_760361_-	hypothetical protein	NA	NA	NA	NA
WP_127446954.1\|760341_760740_+	hypothetical protein	NA	NA	NA	NA
WP_009899232.1\|760831_761332_-	VUT family protein	A0A2H4N7D9	Pectobacterium_phage	2.0e-31	54.3
WP_009899233.1\|761665_762022_-	DNA-binding protein	Q6QIE8	Burkholderia_phage	1.1e-44	76.8
WP_009899234.1\|762112_762727_-	DUF3164 family protein	A4JWM8	Burkholderia_virus	2.2e-93	83.4
WP_009899237.1\|762823_763156_-	hypothetical protein	Q6QIE2	Burkholderia_phage	2.5e-22	58.2
WP_009899239.1\|763187_764441_-	AAA family ATPase	Q6QIE1	Burkholderia_phage	7.2e-155	69.1
763733:763752	attL	NA	NA	NA	NA
WP_009899242.1\|764437_766234_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	Q6QIE0	Burkholderia_phage	4.3e-278	80.2
WP_009899243.1\|766248_767214_-	hypothetical protein	A4JWN3	Burkholderia_virus	1.4e-102	70.3
WP_009899245.1\|767227_767539_-	helix-turn-helix domain-containing protein	A4JWN4	Burkholderia_virus	1.7e-33	80.0
WP_155772941.1\|767535_767979_-	hypothetical protein	NA	NA	NA	NA
WP_009906820.1\|768053_768296_-	DNA-binding protein	Q6QID3	Burkholderia_phage	7.3e-32	90.0
WP_050789956.1\|768426_768846_+	helix-turn-helix transcriptional regulator	A4JWR8	Burkholderia_virus	6.7e-25	51.4
WP_052689340.1\|768911_769775_+	hypothetical protein	A4JWN9	Burkholderia_virus	2.4e-24	29.3
WP_009906937.1\|770277_770625_+	membrane protein	Q6QIC8	Burkholderia_phage	1.2e-43	79.1
WP_025405408.1\|770627_771236_+	transglycosylase SLT domain-containing protein	Q6QIC7	Burkholderia_phage	3.9e-90	79.8
WP_009906939.1\|771232_771835_+	hypothetical protein	A4JWP5	Burkholderia_virus	1.8e-50	61.1
WP_009906940.1\|771831_772170_+	hypothetical protein	A4JWP6	Burkholderia_virus	4.0e-44	82.7
WP_009906941.1\|772166_772499_+	hypothetical protein	Q6QIC3	Burkholderia_phage	1.9e-46	77.8
WP_025405411.1\|772831_773146_-	hypothetical protein	NA	NA	NA	NA
WP_009906942.1\|773316_773781_+	hypothetical protein	Q6QIB2	Burkholderia_phage	3.9e-42	60.1
WP_009906943.1\|773777_774023_+	hypothetical protein	Q6QIB1	Burkholderia_phage	1.7e-20	62.5
WP_009906944.1\|774026_775460_+\|tail	phage tail sheath subtilisin-like domain-containing protein	A4JWK5	Burkholderia_virus	4.7e-243	87.2
WP_009906945.1\|775461_775986_+\|tail	phage major tail tube protein	A4JWK6	Burkholderia_virus	2.9e-86	90.2
WP_009906946.1\|776290_776620_+\|tail	phage tail assembly protein	Q6QIA8	Burkholderia_phage	1.8e-25	65.7
WP_009906947.1\|776591_776750_+	hypothetical protein	Q6QIA7	Burkholderia_phage	2.5e-17	80.8
WP_039339607.1\|776900_779459_+\|tail	phage tail tape measure protein	A4JWL0	Burkholderia_virus	9.4e-186	49.8
WP_009906887.1\|779460_780363_+\|tail	phage tail protein	Q6QIA4	Burkholderia_phage	3.5e-71	72.1
WP_009906886.1\|780362_780569_+\|tail	tail protein X	A4JWL2	Burkholderia_virus	1.5e-25	78.3
WP_099975756.1\|780565_781762_+	phage protein D	A4JWL3	Burkholderia_virus	1.2e-135	70.3
WP_009906884.1\|781758_782361_+\|plate	phage baseplate assembly protein V	A4JWL4	Burkholderia_virus	4.3e-65	69.0
WP_135351490.1\|782374_782584_-	hypothetical protein	NA	NA	NA	NA
WP_009906962.1\|783876_784971_+\|transposase	IS5-like element ISButh6 family transposase	NA	NA	NA	NA
WP_009907016.1\|785253_785697_+\|tail	phage tail protein	NA	NA	NA	NA
WP_009907015.1\|785991_786345_+	GPW/gp25 family protein	Q6QIA0	Burkholderia_phage	4.2e-52	82.9
WP_009907014.1\|786341_787493_+\|plate	baseplate J/gp47 family protein	A4JWL6	Burkholderia_virus	2.3e-168	79.9
WP_009907013.1\|787485_788067_+\|tail	phage tail protein I	A4JWL7	Burkholderia_virus	1.5e-91	86.5
WP_009907012.1\|788066_790031_+\|tail	tail fiber protein	Q45YG3	Burkholderia_virus	3.9e-131	58.1
WP_009907011.1\|790046_790748_+\|tail	tail assembly chaperone	E5E3Q6	Burkholderia_phage	1.1e-59	59.7
WP_080558217.1\|791846_793115_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	2.3e-39	42.8
797342:797361	attR	NA	NA	NA	NA

DBSCAN-SWA_4

2247951 : 2314692

Aeromonas_phage(25.0%)

holin,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009900960.1\|2247951_2248902_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_009900964.1\|2249169_2250114_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_009900966.1\|2250587_2252291_+	peptidase	NA	NA	NA	NA
WP_009900968.1\|2252409_2253636_+	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_009907969.1\|2253694_2254837_-	porin	NA	NA	NA	NA
WP_019254804.1\|2255064_2256102_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_009900970.1\|2256098_2257652_-\|holin	choline-sulfatase	NA	NA	NA	NA
WP_009900971.1\|2257814_2258687_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_009900972.1\|2258830_2259706_+	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_009898039.1\|2259792_2261448_-	APC family permease	NA	NA	NA	NA
WP_009900973.1\|2261627_2262491_-	glycine betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_019254807.1\|2262600_2263740_-	hybrid-cluster NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_171462515.1\|2263760_2265029_-	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_009900977.1\|2265053_2265839_-	drug:proton antiporter	NA	NA	NA	NA
WP_009900978.1\|2265835_2267017_-	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_009900979.1\|2267021_2268947_-	(Fe-S)-binding protein	NA	NA	NA	NA
WP_009900980.1\|2268949_2271013_-	NADH:flavin oxidoreductase	NA	NA	NA	NA
WP_009898053.1\|2271073_2271607_-	4-vinyl reductase	NA	NA	NA	NA
WP_009900981.1\|2271754_2272726_-	membrane dipeptidase	NA	NA	NA	NA
WP_009898057.1\|2272797_2274072_-	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	6.9e-105	53.4
WP_009898058.1\|2274480_2275506_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_009900982.1\|2275698_2276898_-	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	1.4e-11	26.8
WP_009900983.1\|2277243_2278260_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_025405822.1\|2278533_2280018_+	glycoside hydrolase family 68 protein	NA	NA	NA	NA
WP_025987348.1\|2280136_2281810_+	glycoside hydrolase family 32 protein	F8WPR5	Bacillus_phage	1.0e-55	31.0
WP_039339746.1\|2282261_2283530_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_025405551.1\|2283788_2285351_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_009906874.1\|2285403_2286369_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_009896564.1\|2286501_2288073_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_039339117.1\|2288069_2289347_-	glycosyltransferase	NA	NA	NA	NA
WP_009896560.1\|2289626_2290526_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_019255885.1\|2291098_2291374_-	hypothetical protein	NA	NA	NA	NA
WP_009900992.1\|2291683_2291989_-	hypothetical protein	NA	NA	NA	NA
WP_009893756.1\|2292144_2292504_-	hypothetical protein	NA	NA	NA	NA
WP_009893757.1\|2292562_2296057_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_009893758.1\|2296053_2297781_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_009893759.1\|2297863_2299225_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_009900994.1\|2299221_2299815_-	type VI secretion lipoprotein TssJ	NA	NA	NA	NA
WP_009893761.1\|2299820_2300210_-	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_009893763.1\|2300249_2300966_-	DUF3540 domain-containing protein	NA	NA	NA	NA
WP_009900995.1\|2300968_2302039_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_009900996.1\|2302038_2304255_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_039339121.1\|2304258_2306547_-	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_025405827.1\|2306715_2309007_-	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_009901009.1\|2308997_2311841_-	type VI secretion system ATPase TssH	A0A2I7REQ1	Vibrio_phage	1.2e-61	27.0
WP_009901010.1\|2311843_2312833_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_009901011.1\|2312829_2314692_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

DBSCAN-SWA_5

2408700 : 2520861

101

Burkholderia_virus(79.1%)

integrase,head,portal,capsid,lysis,protease,holin,tail,terminase,transposase

attL 2459779:2459808|attR 2516232:2516261

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009901105.1\|2408700_2409084_+\|transposase	transposase	NA	NA	NA	NA
WP_009901107.1\|2409556_2410510_+	hypothetical protein	NA	NA	NA	NA
WP_009901108.1\|2410801_2411851_-	hypothetical protein	NA	NA	NA	NA
WP_011401450.1\|2411854_2412901_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_025405852.1\|2412913_2413483_-	acetyltransferase	NA	NA	NA	NA
WP_029227266.1\|2413475_2414507_-	glycosyltransferase family 9 protein	NA	NA	NA	NA
WP_019254319.1\|2414436_2415645_-	glycosyltransferase family 9 protein	NA	NA	NA	NA
WP_009901115.1\|2415866_2416910_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_009901116.1\|2416925_2418281_-	membrane protein	NA	NA	NA	NA
WP_009901117.1\|2418559_2420320_-	GNAT family N-acetyltransferase	A0A2K9L470	Tupanvirus	1.5e-36	37.0
WP_009901118.1\|2420345_2421698_-	lipopolysaccharide biosynthesis protein RfbH	A0A0P0YLZ6	Yellowstone_lake_phycodnavirus	1.0e-50	36.1
WP_009901119.1\|2421701_2422787_-	CDP-glucose 4,6-dehydratase	J7Q7J8	Aeropyrum_coil-shaped_virus	1.1e-13	29.6
WP_009901121.1\|2422777_2423554_-	glucose-1-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_009901124.1\|2423550_2424768_-	chain-length determining protein	NA	NA	NA	NA
WP_009901125.1\|2424772_2427325_-	SLBB domain-containing protein	NA	NA	NA	NA
WP_162096848.1\|2428090_2428489_+	hypothetical protein	NA	NA	NA	NA
WP_009901126.1\|2428574_2429219_+	YjbF family lipoprotein	NA	NA	NA	NA
WP_009901127.1\|2429220_2432208_+	YjbH domain-containing protein	NA	NA	NA	NA
WP_080558076.1\|2432566_2434279_-	thiamine pyrophosphate-binding protein	M4QSI1	Ostreococcus_lucimarinus_virus	3.2e-65	31.7
WP_009893910.1\|2434511_2434919_-	hypothetical protein	NA	NA	NA	NA
WP_009901130.1\|2435621_2436314_+	hypothetical protein	NA	NA	NA	NA
WP_009901131.1\|2436446_2440010_+	hypothetical protein	NA	NA	NA	NA
WP_009901132.1\|2440023_2452392_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_009901133.1\|2452382_2453117_+	hypothetical protein	NA	NA	NA	NA
WP_144410512.1\|2453367_2454488_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.8e-49	39.9
WP_144410526.1\|2454763_2456001_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	9.9e-157	95.1
WP_038709965.1\|2457180_2457600_+	hypothetical protein	NA	NA	NA	NA
WP_144410567.1\|2457657_2457840_+	hypothetical protein	NA	NA	NA	NA
WP_009899900.1\|2457858_2459715_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
2459779:2459808	attL	NA	NA	NA	NA
WP_144410568.1\|2460145_2460694_-	hypothetical protein	NA	NA	NA	NA
WP_009899898.1\|2460690_2460972_-	hypothetical protein	NA	NA	NA	NA
WP_009899897.1\|2461827_2462514_-	SOS response-associated peptidase family protein	Q8W6R8	Burkholderia_virus	1.3e-121	92.2
WP_029227221.1\|2462598_2463240_+	hypothetical protein	Q8W6R9	Burkholderia_virus	2.0e-108	90.1
WP_025990442.1\|2463369_2464464_-	DUF3396 domain-containing protein	Q8W6S0	Burkholderia_virus	5.2e-202	95.5
WP_010109969.1\|2464491_2465226_-	VRR-NUC domain-containing protein	Q8W6S1	Burkholderia_virus	7.0e-134	96.3
WP_009899893.1\|2465222_2465783_-	PAAR domain-containing protein	A4JX23	Burkholderia_virus	6.1e-98	94.1
WP_009899892.1\|2465978_2466860_-	hypothetical protein	Q8W6S3	Burkholderia_virus	2.4e-117	81.6
WP_009899891.1\|2467023_2467566_-\|lysis	lysis protein	A4JX21	Burkholderia_virus	1.3e-73	86.7
WP_038709960.1\|2467565_2468057_-	lysozyme	Q6JIK8	Burkholderia_virus	4.7e-78	87.7
WP_004552929.1\|2468049_2468262_-\|holin	class II holin gp23	Q8W6S7	Burkholderia_virus	6.6e-29	100.0
WP_009899887.1\|2468304_2469048_-	hypothetical protein	Q8W6S8	Burkholderia_virus	1.4e-102	72.0
WP_009899886.1\|2469047_2469356_-	hypothetical protein	Q8W6S9	Burkholderia_virus	1.2e-39	72.5
WP_009899885.1\|2469352_2472667_-	DUF1983 domain-containing protein	Q8W6T0	Burkholderia_virus	0.0e+00	94.6
WP_029227219.1\|2472663_2473248_-\|tail	tail assembly protein	Q6JIL3	Burkholderia_virus	1.5e-94	93.8
WP_009899883.1\|2473244_2473997_-	C40 family peptidase	Q6JIL4	Burkholderia_virus	8.4e-135	89.6
WP_009899882.1\|2474046_2474730_-\|tail	phage minor tail protein L	Q6JIL5	Burkholderia_virus	3.4e-127	94.7
WP_029227218.1\|2474726_2476115_-\|tail	tail fiber domain-containing protein	Q8W6T4	Burkholderia_virus	3.7e-245	89.6
WP_009899880.1\|2476123_2476462_-\|tail	phage tail protein	Q8W6T5	Burkholderia_virus	4.4e-59	96.4
WP_039339132.1\|2476458_2480523_-\|tail	phage tail tape measure protein	Q6JIL8	Burkholderia_virus	0.0e+00	90.0
WP_009901135.1\|2480536_2480815_-	DUF4035 domain-containing protein	Q8W6T7	Burkholderia_virus	2.4e-39	94.7
WP_029227267.1\|2480814_2481279_-\|tail	tail assembly protein	A4JX08	Burkholderia_virus	1.8e-79	96.1
WP_009901137.1\|2481305_2481761_-	hypothetical protein	Q8W6T9	Burkholderia_virus	1.1e-73	95.3
WP_009901138.1\|2481823_2482171_-	DUF3168 domain-containing protein	Q6JIM2	Burkholderia_virus	6.8e-55	92.2
WP_009901139.1\|2482167_2482590_-	HK97 gp10 family phage protein	Q6JIM3	Burkholderia_virus	5.5e-67	96.4
WP_038710370.1\|2482582_2482912_-\|head	phage head closure protein	Q6JIM4	Burkholderia_virus	2.1e-45	79.8
WP_029227269.1\|2482914_2483277_-\|head,tail	phage gp6-like head-tail connector protein	Q6JIM5	Burkholderia_virus	1.2e-46	80.0
WP_038710381.1\|2483280_2483505_-	hypothetical protein	Q6JIM6	Burkholderia_virus	6.1e-25	75.3
WP_029227270.1\|2483567_2484824_-\|capsid	phage major capsid protein	Q6JIM7	Burkholderia_virus	8.1e-215	94.5
WP_009901144.1\|2484826_2485513_-\|head,protease	HK97 family phage prohead protease	Q6JIM8	Burkholderia_virus	3.7e-121	95.2
WP_009901146.1\|2485493_2486807_-\|portal	phage portal protein	Q6JIM9	Burkholderia_virus	1.0e-204	81.2
WP_029227271.1\|2486803_2488477_-\|terminase	terminase large subunit	Q3HQS7	Burkholderia_phage	2.7e-266	80.8
WP_029227272.1\|2488476_2488956_-\|terminase	terminase small subunit	Q3HQS6	Burkholderia_phage	9.0e-58	82.1
WP_009901149.1\|2489075_2489285_-	HNH endonuclease	NA	NA	NA	NA
WP_059601806.1\|2489527_2489785_+	type II toxin-antitoxin system RelE/ParE family toxin	Q8W6N1	Burkholderia_virus	7.0e-41	98.8
WP_009901152.1\|2489781_2490177_+	helix-turn-helix transcriptional regulator	Q8W6N2	Burkholderia_virus	5.0e-62	96.1
WP_009901154.1\|2490210_2490690_-	hypothetical protein	Q3HQX5	Burkholderia_phage	6.3e-19	78.6
WP_144410569.1\|2491173_2491509_+	hypothetical protein	NA	NA	NA	NA
WP_144410570.1\|2491498_2491909_+	hypothetical protein	NA	NA	NA	NA
WP_009901158.1\|2492071_2492596_+	hypothetical protein	NA	NA	NA	NA
WP_144410571.1\|2493307_2495326_+	hypothetical protein	NA	NA	NA	NA
WP_102869147.1\|2495722_2496922_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	5.4e-43	43.2
WP_009901163.1\|2497066_2497714_-	hypothetical protein	Q8W6N4	Burkholderia_virus	9.2e-106	93.0
WP_009901164.1\|2497722_2497983_-	hypothetical protein	Q8W6N5	Burkholderia_virus	9.9e-43	95.3
WP_009901165.1\|2497958_2498240_-	hypothetical protein	Q3HR03	Burkholderia_phage	1.1e-31	77.9
WP_038710377.1\|2498293_2498716_-	DUF1364 family protein	Q6JIF7	Burkholderia_virus	2.2e-52	71.1
WP_009901169.1\|2498712_2499087_-	hypothetical protein	A4JX57	Burkholderia_virus	1.8e-53	85.5
WP_029227276.1\|2499083_2499635_-	DUF1064 domain-containing protein	A4JX56	Burkholderia_virus	1.8e-86	89.1
WP_029227277.1\|2499631_2500624_-	hypothetical protein	Q6JIG0	Burkholderia_virus	5.5e-174	97.6
WP_009901173.1\|2500777_2501038_-	helix-turn-helix domain-containing protein	Q6JIG2	Burkholderia_virus	3.8e-34	86.0
WP_029227278.1\|2501034_2501856_-	hypothetical protein	Q8W6P2	Burkholderia_virus	9.2e-143	97.8
WP_009901176.1\|2501890_2502865_-	phosphoadenosine phosphosulfate reductase family protein	A4JX51	Burkholderia_virus	2.0e-149	77.4
WP_009901177.1\|2503302_2503593_+	DUF4145 domain-containing protein	A4JX50	Burkholderia_virus	4.3e-47	97.9
WP_009901178.1\|2503763_2504204_-	phage regulatory CII family protein	Q8W6P5	Burkholderia_virus	8.8e-76	97.9
WP_009901179.1\|2504387_2504624_+	hypothetical protein	NA	NA	NA	NA
WP_009901180.1\|2504836_2505079_-	helix-turn-helix domain-containing protein	C7BGF8	Burkholderia_phage	5.4e-27	71.4
WP_009901181.1\|2505164_2505557_+	hypothetical protein	Q8W6P8	Burkholderia_virus	6.9e-64	94.6
WP_025987318.1\|2506453_2506729_+	hypothetical protein	Q8W6Q1	Burkholderia_virus	2.0e-41	91.2
WP_019254603.1\|2506739_2506910_+	hypothetical protein	Q8W6Q2	Burkholderia_virus	1.8e-08	80.0
WP_009901185.1\|2507321_2507471_+	hypothetical protein	Q8W6Q6	Burkholderia_virus	2.6e-16	91.8
WP_009901186.1\|2507467_2508280_+	prohibitin family protein	Q8W6Q7	Burkholderia_virus	2.0e-142	97.0
WP_009901187.1\|2508552_2509260_+	hypothetical protein	Q6JII4	Burkholderia_virus	1.2e-109	84.7
WP_009901188.1\|2509385_2510060_+	hypothetical protein	Q8W6Q9	Burkholderia_virus	1.8e-112	89.5
WP_009901192.1\|2511828_2512779_+	phage Gp37/Gp68 family protein	Q6JIJ3	Burkholderia_virus	3.2e-123	67.5
WP_009901193.1\|2512775_2513438_+	hypothetical protein	A0A059VF56	Pseudomonas_phage	4.3e-34	42.0
WP_009901194.1\|2513440_2513770_-	hypothetical protein	NA	NA	NA	NA
WP_025987319.1\|2513818_2514061_-	hypothetical protein	Q6JIJ4	Burkholderia_virus	3.1e-30	84.6
WP_009901196.1\|2514069_2514279_-	hypothetical protein	Q6JIJ5	Burkholderia_virus	1.8e-31	91.3
WP_009901198.1\|2514919_2516119_+\|integrase	site-specific integrase	A0A1W6JTA0	Pseudomonas_phage	1.1e-107	52.6
WP_009901199.1\|2516391_2518407_-	VC_2705 family sodium/solute symporter	NA	NA	NA	NA
2516232:2516261	attR	NA	NA	NA	NA
WP_045143316.1\|2518400_2518781_-	DUF4212 domain-containing protein	NA	NA	NA	NA
WP_009901201.1\|2518878_2520861_-	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	8.9e-83	44.3

Anti-CRISPR protein detection

Acr_ID: NZ_CP013361.1|WP_004523719.1|133810_134503_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP013361.1|WP_004523719.1|133810_134503_+|hypothetical-protein

133810_134503_+

230 aa aa

128889-187320

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP013361_1	Orphan	1.2\|150909\|18\|NZ_CP013361\|CRT	150909-150926	18	151749-151766	1
NZ_CP013361_1	Orphan	1.7\|151119\|18\|NZ_CP013361\|CRT	151119-151136	18	151749-151766	0
NZ_CP013361_1	Orphan	1.3\|150951\|18\|NZ_CP013361\|CRT	150951-150968	18	151245-151262	0
NZ_CP013361_1	Orphan	1.8\|151161\|18\|NZ_CP013361\|CRT	151161-151178	18	151245-151262	0
NZ_CP013361_1	Orphan	1.3\|150951\|18\|NZ_CP013361\|CRT	150951-150968	18	151329-151346	0
NZ_CP013361_1	Orphan	1.8\|151161\|18\|NZ_CP013361\|CRT	151161-151178	18	151329-151346	0
NZ_CP013361_1	Orphan	1.3\|150951\|18\|NZ_CP013361\|CRT	150951-150968	18	151497-151514	0
NZ_CP013361_1	Orphan	1.8\|151161\|18\|NZ_CP013361\|CRT	151161-151178	18	151497-151514	0
NZ_CP013361_1	Orphan	1.3\|150951\|18\|NZ_CP013361\|CRT	150951-150968	18	151413-151430	1
NZ_CP013361_1	Orphan	1.8\|151161\|18\|NZ_CP013361\|CRT	151161-151178	18	151413-151430	1
NZ_CP013361_1	Orphan	1.3\|150951\|18\|NZ_CP013361\|CRT	150951-150968	18	151707-151724	1
NZ_CP013361_1	Orphan	1.8\|151161\|18\|NZ_CP013361\|CRT	151161-151178	18	151707-151724	1
NZ_CP013361_1	Orphan	1.5\|151035\|18\|NZ_CP013361\|CRT	151035-151052	18	151203-151220	0
NZ_CP013361_1	Orphan	1.5\|151035\|18\|NZ_CP013361\|CRT	151035-151052	18	151287-151304	0
NZ_CP013361_1	Orphan	1.5\|151035\|18\|NZ_CP013361\|CRT	151035-151052	18	151455-151472	0

1. spacer 1.2|150909|18|NZ_CP013361|CRT matches to NZ_CP013361 position: 151749-151766, mismatch: 1

gcagggttcgcacgcgac	CRISPR spacer
gcagggttcgcaagcgac	Protospacer
************ *****

2. spacer 1.7|151119|18|NZ_CP013361|CRT matches to NZ_CP013361 position: 151749-151766, mismatch: 0

gcagggttcgcaagcgac	CRISPR spacer
gcagggttcgcaagcgac	Protospacer
******************

3. spacer 1.3|150951|18|NZ_CP013361|CRT matches to NZ_CP013361 position: 151245-151262, mismatch: 0

ccagaacgccacggcgtc	CRISPR spacer
ccagaacgccacggcgtc	Protospacer
******************

4. spacer 1.8|151161|18|NZ_CP013361|CRT matches to NZ_CP013361 position: 151245-151262, mismatch: 0

ccagaacgccacggcgtc	CRISPR spacer
ccagaacgccacggcgtc	Protospacer
******************

5. spacer 1.3|150951|18|NZ_CP013361|CRT matches to NZ_CP013361 position: 151329-151346, mismatch: 0

ccagaacgccacggcgtc	CRISPR spacer
ccagaacgccacggcgtc	Protospacer
******************

6. spacer 1.8|151161|18|NZ_CP013361|CRT matches to NZ_CP013361 position: 151329-151346, mismatch: 0

ccagaacgccacggcgtc	CRISPR spacer
ccagaacgccacggcgtc	Protospacer
******************

7. spacer 1.3|150951|18|NZ_CP013361|CRT matches to NZ_CP013361 position: 151497-151514, mismatch: 0

ccagaacgccacggcgtc	CRISPR spacer
ccagaacgccacggcgtc	Protospacer
******************

8. spacer 1.8|151161|18|NZ_CP013361|CRT matches to NZ_CP013361 position: 151497-151514, mismatch: 0

ccagaacgccacggcgtc	CRISPR spacer
ccagaacgccacggcgtc	Protospacer
******************

9. spacer 1.3|150951|18|NZ_CP013361|CRT matches to NZ_CP013361 position: 151413-151430, mismatch: 1

ccagaacgccacggcgtc	CRISPR spacer
ccagaacgccacggcatc	Protospacer
***************.**

10. spacer 1.8|151161|18|NZ_CP013361|CRT matches to NZ_CP013361 position: 151413-151430, mismatch: 1

ccagaacgccacggcgtc	CRISPR spacer
ccagaacgccacggcatc	Protospacer
***************.**

11. spacer 1.3|150951|18|NZ_CP013361|CRT matches to NZ_CP013361 position: 151707-151724, mismatch: 1

ccagaacgccacggcgtc	CRISPR spacer
ccagaacgccacggcatc	Protospacer
***************.**

12. spacer 1.8|151161|18|NZ_CP013361|CRT matches to NZ_CP013361 position: 151707-151724, mismatch: 1

ccagaacgccacggcgtc	CRISPR spacer
ccagaacgccacggcatc	Protospacer
***************.**

13. spacer 1.5|151035|18|NZ_CP013361|CRT matches to NZ_CP013361 position: 151203-151220, mismatch: 0

ccaaggttcgcaagcgac	CRISPR spacer
ccaaggttcgcaagcgac	Protospacer
******************

14. spacer 1.5|151035|18|NZ_CP013361|CRT matches to NZ_CP013361 position: 151287-151304, mismatch: 0

ccaaggttcgcaagcgac	CRISPR spacer
ccaaggttcgcaagcgac	Protospacer
******************

15. spacer 1.5|151035|18|NZ_CP013361|CRT matches to NZ_CP013361 position: 151455-151472, mismatch: 0

ccaaggttcgcaagcgac	CRISPR spacer
ccaaggttcgcaagcgac	Protospacer
******************

2. NZ_CP013360

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

410120 : 463679

Pseudomonas_phage(22.22%)

plate,protease,transposase,integrase

attL 410682:410723|attR 454280:454321

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009906344.1\|410120_410633_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	1.1e-21	52.5
410682:410723	attL	NA	NA	NA	NA
WP_045143259.1\|410885_411728_+	hypothetical protein	NA	NA	NA	NA
WP_009906339.1\|411882_412131_+	hypothetical protein	NA	NA	NA	NA
WP_009906338.1\|412127_413597_+	DUF3987 domain-containing protein	NA	NA	NA	NA
WP_144410523.1\|413647_415000_+	hypothetical protein	NA	NA	NA	NA
WP_039337111.1\|415497_416172_+	inovirus-type Gp2 protein	NA	NA	NA	NA
WP_144410522.1\|416450_417680_+	hypothetical protein	NA	NA	NA	NA
WP_144410521.1\|417773_418121_+	hypothetical protein	NA	NA	NA	NA
WP_172820589.1\|418193_419391_+\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	2.3e-102	65.9
WP_144410520.1\|419429_420080_+	hypothetical protein	NA	NA	NA	NA
WP_009906830.1\|420159_422496_-	type I restriction enzyme HsdR N-terminal domain-containing protein	NA	NA	NA	NA
WP_069246068.1\|423011_424121_-	hypothetical protein	NA	NA	NA	NA
WP_069246059.1\|424188_425508_-	hypothetical protein	A0A0A8J8N7	Ralstonia_phage	1.2e-88	49.4
WP_029227459.1\|425684_426026_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_009906835.1\|426003_426657_-	hypothetical protein	NA	NA	NA	NA
WP_029227460.1\|426658_426958_-	hypothetical protein	NA	NA	NA	NA
WP_029227461.1\|427092_427899_-	DUF4942 domain-containing protein	NA	NA	NA	NA
WP_029227462.1\|427960_428983_-	hypothetical protein	NA	NA	NA	NA
WP_009906840.1\|428979_429906_-	hypothetical protein	NA	NA	NA	NA
WP_009906841.1\|429972_430200_-	hypothetical protein	NA	NA	NA	NA
WP_045143258.1\|430211_431207_-	YqaJ viral recombinase family protein	A6XMH8	Bacillus_virus	9.4e-49	37.8
WP_009906843.1\|431279_432248_-	DUF932 domain-containing protein	A0A0H4INH5	Stenotrophomonas_phage	4.1e-57	42.0
WP_080558212.1\|432356_432698_-	hypothetical protein	NA	NA	NA	NA
WP_029227464.1\|433366_434533_+	DUF4297 domain-containing protein	NA	NA	NA	NA
WP_009906845.1\|434529_435009_+	hypothetical protein	NA	NA	NA	NA
WP_009906846.1\|435005_436808_+	hypothetical protein	NA	NA	NA	NA
WP_144410519.1\|437246_438206_+	hypothetical protein	NA	NA	NA	NA
WP_029227466.1\|438093_443457_+	DEAD/DEAH box helicase	A0A1B1IUF6	uncultured_Mediterranean_phage	5.4e-42	22.1
WP_009906848.1\|443453_444656_+	DUF4338 domain-containing protein	NA	NA	NA	NA
WP_144410518.1\|444985_446227_+	hypothetical protein	NA	NA	NA	NA
WP_144410517.1\|446236_448801_+	hypothetical protein	NA	NA	NA	NA
WP_009906852.1\|449129_450344_-	DUF3396 domain-containing protein	E5E3X7	Burkholderia_phage	5.5e-144	68.2
WP_009906853.1\|450354_451104_-	VRR-NUC domain-containing protein	A4JWV4	Burkholderia_virus	1.0e-60	57.5
WP_009906854.1\|451100_451628_-	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	7.9e-55	60.5
WP_009906855.1\|452009_452333_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_009906856.1\|452316_452700_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_029227469.1\|452730_454095_-\|integrase	integrase arm-type DNA-binding domain-containing protein	NA	NA	NA	NA
WP_009888580.1\|454667_455453_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
454280:454321	attR	NA	NA	NA	NA
WP_009906858.1\|455449_456796_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_025404121.1\|456904_457519_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_043036367.1\|457892_458582_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_009888592.1\|458618_459137_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_009888594.1\|459153_460644_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_009906860.1\|460716_461220_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_009888597.1\|461277_461760_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_009906861.1\|461840_463679_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

DBSCAN-SWA_2

766791 : 777335

Hokovirus(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009904051.1\|766791_768744_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	6.6e-147	50.3
WP_009889258.1\|769007_770138_+	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	1.8e-24	38.0
WP_039336891.1\|770169_772179_+	bifunctional anthranilate synthase component I family protein/class IV aminotransferase	S4VT78	Pandoravirus	4.8e-52	34.9
WP_045143256.1\|772245_773466_-\|transposase	ISL3 family transposase	A9YX10	Burkholderia_phage	1.7e-225	92.4
WP_009904054.1\|773667_774483_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	3.3e-36	32.9
WP_009889263.1\|774547_775231_-	deoxynucleoside kinase	A0A249XZR7	Enterococcus_phage	3.3e-05	26.0
WP_009889265.1\|775227_775755_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_009904055.1\|775790_777335_-	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	2.5e-24	31.2

DBSCAN-SWA_3

985116 : 1009338

Stx2-converting_phage(28.57%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009904256.1\|985116_985914_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_144410515.1\|986338_987364_+	AAA family ATPase	Q7M293	Enterobacteria_phage	1.0e-29	29.7
WP_009904260.1\|987536_987767_+	hypothetical protein	NA	NA	NA	NA
WP_099975734.1\|987772_988285_-	HNH endonuclease	NA	NA	NA	NA
WP_009904262.1\|989021_989420_-	helix-turn-helix transcriptional regulator	R9W020	Paenibacillus_phage	9.6e-05	39.4
WP_029227357.1\|989595_990075_+	hypothetical protein	NA	NA	NA	NA
WP_009904264.1\|990096_990447_+	hypothetical protein	NA	NA	NA	NA
WP_009904265.1\|990446_990806_+	hypothetical protein	NA	NA	NA	NA
WP_172820589.1\|991410_992608_+\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	2.3e-102	65.9
WP_144410513.1\|992768_993269_+	hypothetical protein	NA	NA	NA	NA
WP_052689349.1\|993351_993723_+\|transposase	transposase	NA	NA	NA	NA
WP_144410512.1\|993753_994873_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.8e-49	39.9
WP_009906954.1\|995269_996832_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	2.1e-143	52.1
WP_029227479.1\|996861_997209_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	4.7e-40	70.1
WP_039336681.1\|997208_997571_-\|transposase	transposase	NA	NA	NA	NA
WP_039336678.1\|997687_998944_+	hypothetical protein	NA	NA	NA	NA
WP_029227358.1\|999278_999596_+	hypothetical protein	NA	NA	NA	NA
WP_011544796.1\|999656_999959_-	hypothetical protein	NA	NA	NA	NA
WP_009904271.1\|1000029_1000752_-	DUF5343 domain-containing protein	NA	NA	NA	NA
WP_155772925.1\|1001486_1002509_-	hypothetical protein	NA	NA	NA	NA
WP_009904277.1\|1002652_1004590_+	hypothetical protein	NA	NA	NA	NA
WP_009904278.1\|1004778_1005753_-	quinone oxidoreductase	NA	NA	NA	NA
WP_009904279.1\|1005885_1006770_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_009904281.1\|1007006_1007849_+	NAD-dependent protein deacetylase	S5M4R0	Bacillus_phage	7.5e-07	24.3
WP_009904282.1\|1008117_1009338_-\|protease	serine protease	NA	NA	NA	NA

DBSCAN-SWA_4

1149048 : 1157730

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009904402.1\|1149048_1150449_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.4e-79	38.7
WP_080511617.1\|1150480_1151404_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.3e-15	27.9
WP_009904403.1\|1151461_1152454_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	9.1e-28	30.9
WP_009889858.1\|1152525_1152843_+	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_009904404.1\|1153177_1154080_+	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	4.3e-53	39.9
WP_009889862.1\|1154174_1155416_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_009889864.1\|1155594_1156518_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	3.2e-43	36.2
WP_025987375.1\|1156887_1157730_-	alpha/beta hydrolase	A7XCB7	Tanapox_virus	8.5e-19	26.8

DBSCAN-SWA_5

2266132 : 2395182

Burkholderia_virus(19.23%)

transposase,integrase,tRNA,plate,coat

attL 2381658:2381705|attR 2395190:2395237

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009905815.1\|2266132_2269000_+\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	6.7e-148	39.3
WP_009891646.1\|2269086_2269971_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.1e-69	48.3
WP_009905817.1\|2270047_2270653_-	DUF4136 domain-containing protein	NA	NA	NA	NA
WP_009891650.1\|2270744_2273138_-	CHASE2 domain-containing protein	NA	NA	NA	NA
WP_009891653.1\|2273148_2274513_-	FecR domain-containing protein	NA	NA	NA	NA
WP_004193573.1\|2274509_2275214_-	response regulator transcription factor	NA	NA	NA	NA
WP_009905819.1\|2275504_2275891_-	hypothetical protein	NA	NA	NA	NA
WP_004193727.1\|2276148_2276379_-	sulfurtransferase TusA family protein	NA	NA	NA	NA
WP_025405098.1\|2276540_2277578_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_009905830.1\|2277590_2278610_-	inositol 2-dehydrogenase	NA	NA	NA	NA
WP_009905831.1\|2278602_2279484_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_009891666.1\|2279733_2280783_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_009891668.1\|2280883_2282029_+	ABC transporter permease	NA	NA	NA	NA
WP_009891669.1\|2282041_2282842_+	sugar ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-14	29.4
WP_025405099.1\|2282855_2284856_+	5-dehydro-2-deoxygluconokinase	NA	NA	NA	NA
WP_045143295.1\|2284866_2286870_+	3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing)	NA	NA	NA	NA
WP_009905840.1\|2286866_2287787_+	myo-inosose-2 dehydratase	NA	NA	NA	NA
WP_009905842.1\|2287786_2288590_+	5-deoxy-glucuronate isomerase	NA	NA	NA	NA
WP_009891678.1\|2288654_2289359_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.7e-09	31.8
WP_025405101.1\|2289355_2291593_-	branched-chain amino acid ABC transporter ATP-binding protein/permease	A0A2R8FFL6	Cedratvirus	1.2e-08	27.5
WP_009905849.1\|2291585_2292521_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_019255838.1\|2292525_2292975_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_009891683.1\|2293234_2294383_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_009891685.1\|2294572_2294908_+	YbjQ family protein	NA	NA	NA	NA
WP_009905853.1\|2295000_2295555_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_025405102.1\|2296019_2297558_-	trypsin-like peptidase domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	5.0e-09	24.8
WP_080940522.1\|2298109_2299708_-	YbfB/YjiJ family MFS transporter	NA	NA	NA	NA
WP_009905862.1\|2299792_2300758_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_009905863.1\|2301186_2303811_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	7.1e-80	39.2
WP_009905864.1\|2304253_2305474_+	CoA transferase	NA	NA	NA	NA
WP_009905865.1\|2305567_2306374_+	hypothetical protein	NA	NA	NA	NA
WP_009891704.1\|2306903_2307146_-	ornithine acetyltransferase	NA	NA	NA	NA
WP_009891706.1\|2307393_2309103_+\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	2.8e-186	56.9
WP_009905869.1\|2309388_2309865_-	NUDIX hydrolase	A0A2I6PFL2	Proteus_phage	2.0e-20	41.3
WP_009905870.1\|2309883_2310270_-	hypothetical protein	NA	NA	NA	NA
WP_009905871.1\|2310556_2312656_-	glycoside hydrolase family 3 protein	NA	NA	NA	NA
WP_009905874.1\|2312757_2313618_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_009905875.1\|2313663_2315091_-	cytochrome-c peroxidase	NA	NA	NA	NA
WP_009905877.1\|2315324_2316908_+	acid phosphatase	NA	NA	NA	NA
WP_009905879.1\|2317132_2318326_+	trans-2-enoyl-CoA reductase family protein	NA	NA	NA	NA
WP_009905880.1\|2318343_2319186_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_009891722.1\|2319895_2320528_-	response regulator transcription factor	NA	NA	NA	NA
WP_025987396.1\|2320528_2322601_-	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	1.2e-29	28.0
WP_009905886.1\|2323011_2323977_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_039337972.1\|2323992_2326404_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_009905896.1\|2326448_2327288_-	molecular chaperone	NA	NA	NA	NA
WP_038708375.1\|2327305_2327830_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_009905900.1\|2327912_2328473_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_019255106.1\|2328525_2329071_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_009891734.1\|2329879_2330773_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_038708373.1\|2331188_2332478_+	MFS transporter	NA	NA	NA	NA
WP_009905907.1\|2332522_2333449_+	amidohydrolase family protein	NA	NA	NA	NA
WP_009891740.1\|2333934_2334216_+	H-NS histone family protein	NA	NA	NA	NA
WP_009891742.1\|2334415_2334679_-	hypothetical protein	NA	NA	NA	NA
WP_155772930.1\|2335665_2336720_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.5e-44	37.2
WP_085952127.1\|2336792_2338029_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	5.8e-157	95.1
WP_172820589.1\|2338145_2339343_+\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	2.3e-102	65.9
WP_155772931.1\|2339409_2340129_-	hypothetical protein	NA	NA	NA	NA
WP_144410544.1\|2340435_2341556_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	5.2e-48	39.5
WP_050807625.1\|2342507_2342954_-	hypothetical protein	NA	NA	NA	NA
WP_019255073.1\|2343235_2346259_-	hypothetical protein	NA	NA	NA	NA
WP_009905923.1\|2346261_2347278_-	hypothetical protein	NA	NA	NA	NA
WP_009905924.1\|2347281_2350104_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	2.5e-30	24.7
WP_009905925.1\|2350116_2350422_-	hypothetical protein	NA	NA	NA	NA
WP_009905926.1\|2350439_2350772_-	hypothetical protein	NA	NA	NA	NA
WP_085955234.1\|2351812_2353023_-\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	9.2e-99	63.4
WP_038708366.1\|2353137_2353629_-	hypothetical protein	NA	NA	NA	NA
WP_009906870.1\|2354387_2354882_-	hypothetical protein	NA	NA	NA	NA
WP_025405119.1\|2354859_2358195_-	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_039338284.1\|2359555_2360134_-	DUF3304 domain-containing protein	NA	NA	NA	NA
WP_009906969.1\|2360240_2362646_-	DUF2235 domain-containing protein	NA	NA	NA	NA
WP_009906968.1\|2362642_2363242_-	DUF3304 domain-containing protein	NA	NA	NA	NA
WP_009906995.1\|2363729_2364329_-	DUF3304 domain-containing protein	NA	NA	NA	NA
WP_025987447.1\|2364325_2364883_-	DUF3304 domain-containing protein	NA	NA	NA	NA
WP_009905935.1\|2365019_2365853_-	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_009905937.1\|2365855_2368654_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	2.0e-27	24.1
WP_009891791.1\|2369179_2369446_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_025405123.1\|2369469_2370897_+	hypothetical protein	NA	NA	NA	NA
WP_009905942.1\|2370925_2372776_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_009910381.1\|2374267_2374486_+	hypothetical protein	NA	NA	NA	NA
WP_009905945.1\|2375246_2376725_+	PHB depolymerase family esterase	NA	NA	NA	NA
WP_009905946.1\|2377028_2377364_-	H-NS histone family protein	NA	NA	NA	NA
WP_009905947.1\|2377680_2378967_-	MFS transporter	Q6JIH2	Burkholderia_virus	1.7e-172	72.0
WP_025405127.1\|2379099_2380005_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.9e-129	75.1
2381658:2381705	attL	NA	NA	NA	NA
WP_009905950.1\|2381849_2382494_-	SOS response-associated peptidase family protein	C7BGE4	Burkholderia_phage	1.6e-113	89.5
WP_144410543.1\|2382575_2382839_+	hypothetical protein	NA	NA	NA	NA
WP_009905951.1\|2382808_2383288_-	DUF2514 family protein	Q6J1Q4	Burkholderia_virus	2.0e-57	81.3
WP_009905952.1\|2383284_2383830_-	hypothetical protein	NA	NA	NA	NA
WP_029227429.1\|2383826_2384324_-	lysozyme	Q3HQU9	Burkholderia_phage	1.3e-83	93.3
WP_009905959.1\|2384316_2384499_-	hypothetical protein	NA	NA	NA	NA
WP_009905961.1\|2384677_2384962_+	hypothetical protein	NA	NA	NA	NA
WP_099975745.1\|2384964_2385702_+	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_080940521.1\|2385767_2386802_+	acyltransferase	A0A166XZF2	Gordonia_phage	5.8e-17	31.2
WP_144410526.1\|2386814_2388051_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	9.9e-157	95.1
WP_144410542.1\|2388251_2388452_-	hypothetical protein	NA	NA	NA	NA
WP_080558189.1\|2389798_2390395_-	DUF2313 domain-containing protein	NA	NA	NA	NA
WP_038711425.1\|2391771_2392077_-	hypothetical protein	NA	NA	NA	NA
WP_009905983.1\|2393032_2393572_+	Lar family restriction alleviation protein	A0A127KN88	Pseudomonas_phage	7.1e-11	66.7
WP_172820592.1\|2394609_2395182_+\|integrase	site-specific integrase	A0A1S5NNJ1	Burkholderia_phage	3.2e-33	47.0
2395190:2395237	attR	NA	NA	NA	NA

DBSCAN-SWA_6

2632902 : 2672588

Pseudomonas_phage(36.36%)

capsid,transposase,integrase,portal,tail,head,tRNA,terminase

attL 2658847:2658873|attR 2677032:2677058

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009903844.1\|2632902_2633634_-\|tRNA	alanyl-tRNA editing protein	NA	NA	NA	NA
WP_009892241.1\|2633744_2634155_-	group II truncated hemoglobin	NA	NA	NA	NA
WP_009903843.1\|2634231_2636841_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_009892245.1\|2636837_2637455_-	DUF4126 domain-containing protein	NA	NA	NA	NA
WP_009892247.1\|2637635_2637956_-	quaternary ammonium compound efflux SMR transporter SugE	NA	NA	NA	NA
WP_009903842.1\|2638202_2638496_-	DUF333 domain-containing protein	NA	NA	NA	NA
WP_009903838.1\|2638836_2639535_-	two-component system response regulator KdpE	NA	NA	NA	NA
WP_039337861.1\|2639527_2642647_-	sensor histidine kinase KdpD	A0A1V0SGX0	Hokovirus	2.8e-06	23.6
WP_009903828.1\|2642900_2643482_-	potassium-transporting ATPase subunit KdpC	NA	NA	NA	NA
WP_009903825.1\|2643494_2645606_-	potassium-transporting ATPase subunit KdpB	M1HBF8	Paramecium_bursaria_Chlorella_virus	4.6e-21	25.7
WP_009903823.1\|2645673_2647482_-	potassium-transporting ATPase subunit KdpA	NA	NA	NA	NA
WP_004550719.1\|2647478_2647571_-	K(+)-transporting ATPase subunit F	NA	NA	NA	NA
WP_009892266.1\|2647997_2648972_-	quinone oxidoreductase	NA	NA	NA	NA
WP_009892268.1\|2649230_2649623_-	methylglyoxal synthase	NA	NA	NA	NA
WP_009903816.1\|2649831_2650611_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_009892273.1\|2650845_2651496_+	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_009892278.1\|2651790_2652519_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_009892280.1\|2652629_2653907_+	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_009903814.1\|2654034_2654958_+	oxygen-dependent coproporphyrinogen oxidase	NA	NA	NA	NA
WP_009903813.1\|2654954_2655707_+	nicotinate-nucleotide adenylyltransferase	NA	NA	NA	NA
WP_009903812.1\|2655711_2656176_+	ribosome silencing factor	NA	NA	NA	NA
WP_009903811.1\|2656234_2656705_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_009903809.1\|2656756_2657389_+	septum formation inhibitor Maf	NA	NA	NA	NA
WP_009903808.1\|2657405_2658872_+	ribonuclease G	NA	NA	NA	NA
2658847:2658873	attL	NA	NA	NA	NA
WP_029227343.1\|2659045_2660287_+\|integrase	site-specific integrase	Q6J1Q2	Burkholderia_virus	1.0e-81	45.1
WP_144410540.1\|2660378_2661137_+	hypothetical protein	NA	NA	NA	NA
WP_009903802.1\|2661385_2661616_+	transcriptional regulator	NA	NA	NA	NA
WP_009903800.1\|2661695_2661983_+	hypothetical protein	A0A1B0VRK7	Pseudomonas_phage	3.7e-06	47.9
WP_080558124.1\|2662276_2662462_+	hypothetical protein	NA	NA	NA	NA
WP_009903797.1\|2662454_2662649_+	hypothetical protein	A0A1W6JTA7	Pseudomonas_phage	6.1e-05	49.0
WP_009903795.1\|2662641_2662893_+	hypothetical protein	NA	NA	NA	NA
WP_009903794.1\|2662885_2663164_+	hypothetical protein	Q3HQY6	Burkholderia_phage	6.7e-21	67.1
WP_009903792.1\|2663156_2663393_+	hypothetical protein	NA	NA	NA	NA
WP_009903790.1\|2663389_2663617_+	hypothetical protein	NA	NA	NA	NA
WP_009903789.1\|2663616_2664165_+	hypothetical protein	NA	NA	NA	NA
WP_085955234.1\|2664817_2666028_-\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	9.2e-99	63.4
WP_029227453.1\|2666555_2666807_+	HNH endonuclease	NA	NA	NA	NA
WP_009906765.1\|2666908_2667349_+	hypothetical protein	A0A286S1P9	Klebsiella_phage	1.2e-40	60.4
WP_009906764.1\|2667330_2668851_+\|terminase	terminase	B5WZR8	Pseudomonas_phage	1.1e-229	79.2
WP_045143274.1\|2668907_2670800_+\|capsid	phage major capsid protein	S4TNE3	Salmonella_phage	5.2e-133	44.9
WP_039337852.1\|2670812_2670992_+	hypothetical protein	NA	NA	NA	NA
WP_172820593.1\|2671066_2672281_+\|portal	phage portal protein	F8TVA0	EBPR_siphovirus	5.1e-89	46.1
WP_009903786.1\|2672270_2672588_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
2677032:2677058	attR	NA	NA	NA	NA

DBSCAN-SWA_7

2765008 : 2781265

Stenotrophomonas_phage(14.29%)

capsid,transposase,integrase,portal,tail,head,terminase

attL 2759060:2759077|attR 2771042:2771059

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2759060:2759077	attL	NA	NA	NA	NA
WP_009903624.1\|2765008_2766226_+\|integrase	tyrosine-type recombinase/integrase	B7SYF8	Stenotrophomonas_phage	1.1e-88	44.8
WP_038710841.1\|2766299_2766956_-	hypothetical protein	NA	NA	NA	NA
WP_144410536.1\|2767185_2767791_-	hypothetical protein	NA	NA	NA	NA
WP_157779345.1\|2768194_2769010_+	hypothetical protein	NA	NA	NA	NA
WP_029227337.1\|2769112_2769373_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_009903613.1\|2769391_2770144_+	phage antirepressor KilAC domain-containing protein	G3EN85	Psychrobacter_phage	1.1e-44	48.6
WP_080558117.1\|2770435_2770621_+	hypothetical protein	NA	NA	NA	NA
WP_009903609.1\|2770613_2770826_+	hypothetical protein	NA	NA	NA	NA
WP_029227335.1\|2770818_2771016_+	hypothetical protein	NA	NA	NA	NA
WP_009903605.1\|2771012_2771240_+	hypothetical protein	NA	NA	NA	NA
2771042:2771059	attR	NA	NA	NA	NA
WP_009903603.1\|2771232_2771625_+	hypothetical protein	NA	NA	NA	NA
WP_029227334.1\|2771621_2771849_+	hypothetical protein	NA	NA	NA	NA
WP_029227333.1\|2771848_2772397_+	hypothetical protein	NA	NA	NA	NA
WP_080558116.1\|2773187_2773481_+	HNH endonuclease	NA	NA	NA	NA
WP_009903590.1\|2773582_2774023_+	hypothetical protein	A0A286S1P9	Klebsiella_phage	1.0e-39	61.1
WP_009903588.1\|2774004_2775525_+\|terminase	terminase	B5WZR8	Pseudomonas_phage	1.6e-228	79.4
WP_045143272.1\|2775581_2777471_+\|capsid	phage major capsid protein	S4TNE3	Salmonella_phage	1.9e-130	43.7
WP_039337826.1\|2777483_2777663_+	hypothetical protein	NA	NA	NA	NA
WP_172820594.1\|2777737_2778952_+\|portal	phage portal protein	F8TVA0	EBPR_siphovirus	8.6e-89	46.7
WP_009906951.1\|2778941_2779259_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_144410535.1\|2779435_2779699_-	hypothetical protein	NA	NA	NA	NA
WP_144410526.1\|2780027_2781265_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	9.9e-157	95.1

DBSCAN-SWA_8

2965572 : 2976453

Agrobacterium_phage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025405293.1\|2965572_2967873_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	3.6e-168	41.9
WP_009892611.1\|2967869_2968184_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	2.6e-13	44.6
WP_004196460.1\|2968714_2968918_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.8e-23	81.8
WP_039337770.1\|2969029_2970625_-	multicopper oxidase family protein	NA	NA	NA	NA
WP_009903329.1\|2970789_2972049_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	6.8e-12	63.0
WP_009892615.1\|2972313_2972892_+	pseudouridine synthase	NA	NA	NA	NA
WP_080555088.1\|2973152_2973368_+	hypothetical protein	NA	NA	NA	NA
WP_019256450.1\|2973563_2974073_+	DUF192 domain-containing protein	A0A1B1IUW8	uncultured_Mediterranean_phage	5.0e-14	42.2
WP_009903323.1\|2974338_2976453_+	elongation factor G	E4ZFJ7	Streptococcus_phage	2.3e-57	27.0

DBSCAN-SWA_9

3702566 : 3757109

Burkholderia_virus(13.33%)

protease,transposase,integrase,portal,tRNA

attL 3711003:3711019|attR 3758072:3758088

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009902119.1\|3702566_3703424_-\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
WP_009893639.1\|3703532_3704168_-	LysE family translocator	NA	NA	NA	NA
WP_009902117.1\|3704288_3705275_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	3.9e-07	36.5
WP_009893641.1\|3705306_3705810_-	peptide deformylase	A0A067XQZ3	Caulobacter_phage	3.2e-13	31.5
WP_009902115.1\|3706042_3707230_+	DNA-protecting protein DprA	S6BFL3	Thermus_phage	2.3e-22	39.2
WP_009902114.1\|3707290_3707662_+	thioredoxin family protein	NA	NA	NA	NA
WP_009902112.1\|3707871_3710481_+	DNA topoisomerase III	A0A2P1ELA0	Moumouvirus	3.8e-17	25.6
WP_009893648.1\|3710709_3711765_-	LysR family transcriptional regulator	NA	NA	NA	NA
3711003:3711019	attL	NA	NA	NA	NA
WP_009902110.1\|3712202_3713219_+	D-2-hydroxyacid dehydrogenase family protein	NA	NA	NA	NA
WP_009902108.1\|3713338_3714208_-	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_009893658.1\|3714246_3714651_-	PaaI family thioesterase	NA	NA	NA	NA
WP_045143286.1\|3715143_3715476_-	hypothetical protein	NA	NA	NA	NA
WP_144410512.1\|3715778_3716899_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.8e-49	39.9
WP_144410528.1\|3718006_3718531_-	hypothetical protein	NA	NA	NA	NA
WP_009902101.1\|3718664_3719711_-	HNH endonuclease	NA	NA	NA	NA
WP_009902099.1\|3720068_3720569_-	hypothetical protein	NA	NA	NA	NA
WP_009902097.1\|3721210_3723244_+	hypothetical protein	NA	NA	NA	NA
WP_019254355.1\|3723350_3723833_+	hypothetical protein	NA	NA	NA	NA
WP_009902093.1\|3724517_3724802_+	hypothetical protein	NA	NA	NA	NA
WP_162486552.1\|3724874_3725720_-\|portal	phage portal protein	A4JWQ2	Burkholderia_virus	3.0e-133	85.1
WP_009902090.1\|3725876_3726458_+	Spy/CpxP family protein refolding chaperone	NA	NA	NA	NA
WP_009902086.1\|3727251_3727800_+	hypothetical protein	NA	NA	NA	NA
WP_009902084.1\|3728042_3729491_+	RNA polymerase sigma factor RpoD/SigA	A0A2I7SAT0	Vibrio_phage	3.4e-31	34.4
WP_009902082.1\|3729506_3731120_-	glutamate--cysteine ligase	NA	NA	NA	NA
WP_019256023.1\|3731269_3732211_-	3-methyladenine DNA glycosylase 2	NA	NA	NA	NA
WP_009902073.1\|3732207_3733302_-	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	1.0e-19	38.1
WP_009902070.1\|3733704_3734121_+	VOC family protein	NA	NA	NA	NA
WP_009902068.1\|3734248_3734803_-	YaeQ family protein	NA	NA	NA	NA
WP_009902065.1\|3735023_3735371_-	hypothetical protein	NA	NA	NA	NA
WP_009902063.1\|3735857_3736418_-	spermidine N1-acetyltransferase	NA	NA	NA	NA
WP_004524602.1\|3736577_3736748_+	hypothetical protein	NA	NA	NA	NA
WP_009902052.1\|3737082_3737238_-	lipoprotein	NA	NA	NA	NA
WP_009902051.1\|3737302_3738463_-	DUF4382 domain-containing protein	NA	NA	NA	NA
WP_009902049.1\|3738875_3739100_-	DUF1311 domain-containing protein	NA	NA	NA	NA
WP_009902046.1\|3740598_3741612_+	ParA family protein	Q7M293	Enterobacteria_phage	1.8e-31	31.5
WP_144410527.1\|3741604_3742267_+	hypothetical protein	NA	NA	NA	NA
WP_172820589.1\|3742378_3743577_-\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	2.3e-102	65.9
WP_009906996.1\|3743760_3744336_-	recombinase family protein	A0A219Y9V9	Aeromonas_phage	1.0e-23	41.2
WP_158345901.1\|3744811_3744940_+	hypothetical protein	NA	NA	NA	NA
WP_025405251.1\|3744966_3746067_+	hypothetical protein	NA	NA	NA	NA
WP_025405250.1\|3746035_3746977_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_009906999.1\|3747385_3747898_+	hypothetical protein	NA	NA	NA	NA
WP_162840133.1\|3748035_3748299_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_009907001.1\|3748298_3748778_+	hypothetical protein	NA	NA	NA	NA
WP_009907002.1\|3749148_3749325_+	hypothetical protein	NA	NA	NA	NA
WP_025405247.1\|3749317_3749575_+	hypothetical protein	NA	NA	NA	NA
WP_009907004.1\|3749571_3749913_+	hypothetical protein	NA	NA	NA	NA
WP_009907005.1\|3750057_3752910_+	DUF927 domain-containing protein	A0A1B0VP75	Pseudomonas_phage	6.6e-71	35.2
WP_144410526.1\|3753912_3755149_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	9.9e-157	95.1
WP_038711569.1\|3755181_3755781_-	DNA damage-inducible protein D	A0A1W6JPJ7	Morganella_phage	1.1e-47	66.0
WP_009906630.1\|3755879_3757109_-\|integrase	tyrosine-type recombinase/integrase	Q858E8	Salmonella_phage	1.2e-66	38.7
3758072:3758088	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP013361

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

2. NZ_CP013360

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection