CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP013376	Burkholderia cepacia strain INT3-BP177 chromosome 2, complete sequence	2 crisprs	cas3,csa3,RT,DinG,WYL	0	3	1	0
NZ_CP013375	Burkholderia cepacia strain INT3-BP177 chromosome 1, complete sequence	1 crisprs	cas3,DEDDh,csa3,DinG	0	0	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013376_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013376_1

1685901-1685982

Orphan

Consensus_repeat	Method
CGACGGACGGTTGCCGGCCGGCACGGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013376_1

>merge|NZ_CP013376|1|1685901-1685982|CRISPRCasFinder
CGACGGACGGTTGCCGGCCGGCACGGCCTGGGCGGGCAGGGCGCGTGTGTTGCTCGACGGACGGTTGCCGGTCGGCACGGCC

>NZ_CP013376|1|1|1685901-1685982|CRISPRCasFinder
CGACGGACGGTTGCCGGCCGGCACGGCC	TGGGCGGGCAGGGCGCGTGTGTTGCT
CGACGGACGGTTGCCGGTCGGCACGGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013376.1\|WP_146774181.1\|1680254_1680824_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013376.1\|WP_021159151.1\|1673123_1674149_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223659
NZ_CP013376.1\|WP_069254510.1\|1674692_1677545_+\|type-VI-secretion-system-tip-protein-VgrG	unknown	unknown	gnl\|CDD\|226032
NZ_CP013376.1\|WP_069254514.1\|1693501_1694017_-\|photosystem-reaction-center-subunit-H	unknown	unknown	gnl\|CDD\|368352
NZ_CP013376.1\|WP_021162006.1\|1694074_1694506_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341390
NZ_CP013376.1\|WP_048023016.1\|1686609_1686864_+\|DUF3562-domain-containing-protein	unknown	unknown	gnl\|CDD\|378806
NZ_CP013376.1\|WP_048023031.1\|1672431_1672938_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380376
NZ_CP013376.1\|WP_069255169.1\|1677570_1678845_+\|VRR-NUC-domain-containing-protein	unknown	unknown	gnl\|CDD\|214959
NZ_CP013376.1\|WP_021162008.1\|1694869_1695118_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013376.1\|WP_059650711.1\|1695259_1695559_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013376.1\|WP_081332342.1\|1678883_1680227_+\|DUF3396-domain-containing-protein	unknown	unknown	gnl\|CDD\|371775
NZ_CP013376.1\|WP_069254511.1\|1680980_1681268_+\|PAAR-domain-containing-protein	unknown	unknown	gnl\|CDD\|269829
NZ_CP013376.1\|WP_069254513.1\|1690495_1692487_+\|response-regulator	unknown	unknown	gnl\|CDD\|274362
NZ_CP013376.1\|WP_059591148.1\|1687219_1689019_+\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|185001
NZ_CP013376.1\|WP_042977308.1\|1695865_1696177_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|340422
NZ_CP013376.1\|WP_048023164.1\|1689077_1690115_-\|sigma-54-dependent-Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
NZ_CP013376.1\|WP_021159144.1\|1684093_1685029_+\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NZ_CP013376.1\|WP_060159263.1\|1692868_1693480_+\|DUF4142-domain-containing-protein	unknown	unknown	gnl\|CDD\|379301
NZ_CP013376.1\|WP_081332343.1\|1681349_1682021_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|223532
NZ_CP013376.1\|WP_059591153.1\|1682501_1683884_+\|amino-acid-permease	unknown	unknown	gnl\|CDD\|224038

Protein	Function_ID	Function_description	E-value
NZ_CP013376.1\|WP_021159151.1\|1673123_1674149_+\|hypothetical-protein	gnl\|CDD\|223659	COG0586, DedA, Uncharacterized membrane-associated protein [Function unknown].	2.26335e-24
NZ_CP013376.1\|WP_069254510.1\|1674692_1677545_+\|type-VI-secretion-system-tip-protein-VgrG	gnl\|CDD\|226032	COG3501, VgrG, Uncharacterized protein conserved in bacteria [Function unknown].	4.98661e-88
NZ_CP013376.1\|WP_042977308.1\|1695865_1696177_+\|hypothetical-protein	gnl\|CDD\|340422	cd16946, HATPase_BaeS-like, Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to Escherichia coli BasS. This family includes the histidine kinase-like ATPase (HATPase) domains of various two-component sensor histidine kinase (HKs) similar to Escherichia coli BaeS HK of the BaeS/BaeR two-component regulatory system (TCS), which responds to envelope stress. Proteins having this HATPase domain also contain a histidine kinase dimerization and phosphoacceptor domain (HisKA), and a HAMP sensory domain.	0.00168933
NZ_CP013376.1\|WP_021162006.1\|1694074_1694506_-\|CBS-domain-containing-protein	gnl\|CDD\|341390	cd04622, CBS_pair_HRP1_like, CBS pair domain found in Hypoxic Response Protein 1 (HRP1) -like proteinds. Mycobacterium tuberculosis adapts to cellular stresses by upregulation of the dormancy survival regulon. Hypoxic response protein 1 (HRP1) is encoded by one of the most strongly upregulated genes in the dormancy survival regulon. HRP1 is a 'CBS-domain-only protein; however unlike other CBS containing proteins it does not appear to bind AMP. The biological function of the protein remains unclear, but is thought to contribute to the modulation of the host immune response. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	1.16924e-44
NZ_CP013376.1\|WP_048023016.1\|1686609_1686864_+\|DUF3562-domain-containing-protein	gnl\|CDD\|378806	pfam12085, DUF3562, Protein of unknown function (DUF3562). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 62 to 84 amino acids in length. This protein has two completely conserved residues (A and Y) that may be functionally important.	3.03442e-08
NZ_CP013376.1\|WP_048023031.1\|1672431_1672938_+\|cupin-domain-containing-protein	gnl\|CDD\|380376	cd06121, cupin_YML079wp, Saccharomyces cerevisiae YML079wp and related proteins, cupin domain. This family includes eukaryotic, bacterial, and archaeal proteins homologous to YML079wp, a Saccharomyces cerevisiae cupin-like protein of unknown function that structurally resembles plant seed storage and ligand-binding proteins (canavalin, glycinin, auxin binding protein) as well as the bacterial RmlC epimerase. YML079wp is non-essential in yeast and localizes to the nucleus and cytoplasm. The presence of a hydrophobic ligand within a well-conserved binding pocket inside the cupin beta-barrel and sequence similarity with bacterial epimerases suggests a possible biochemical function for YML079wp and its homologs. Also included in this family are Shewanella oneidensis So0799, Agrobacterium fabrum Atu3615 and Branchiostoma belcheri Bbduf985. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold and forms a homodimer.	1.10789e-73
NZ_CP013376.1\|WP_069255169.1\|1677570_1678845_+\|VRR-NUC-domain-containing-protein	gnl\|CDD\|214959	smart00990, VRR_NUC, This model contains proteins with the VRR-NUC domain. It is associated with members of the PD-(D/E)XK nuclease superfamily, which include the type III restriction modification enzymes, for example StyLTI.	4.72679e-08
NZ_CP013376.1\|WP_081332342.1\|1678883_1680227_+\|DUF3396-domain-containing-protein	gnl\|CDD\|371775	pfam11876, DUF3396, Protein of unknown function (DUF3396). This family of proteins are functionally uncharacterized. This protein is found in bacteria and viruses. Proteins in this family are typically between 302 to 382 amino acids in length.	1.228e-30
NZ_CP013376.1\|WP_081332343.1\|1681349_1682021_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|223532	COG0456, RimI, Acetyltransferases [General function prediction only].	2.26095e-06
NZ_CP013376.1\|WP_069254511.1\|1680980_1681268_+\|PAAR-domain-containing-protein	gnl\|CDD\|269829	cd14744, PAAR_CT_2, proline-alanine-alanine-arginine (PAAR) domain with uncharacterized C-terminal extension. This domain is found in the PAAR (proline-alanine-alanine-arginine) repeat family of mostly beta- and gamma-proteobacteria, and forms a sharp conical extension on the VgrG spike, a trimeric protein complex of the bacterial type VI secretion system (T6SS). Most members contain C-terminal domain extensions corresponding to several uncharacterized domains such as S-type pyocin, DUF2235, DUF2345 and cytotoxic proteins. However, these terminal domains are exposed to solution, and do not distort the binding site of VgrG. The pointed tip of the PAAR domain is stabilized by a zinc atom positioned close to the cone's vertex and is likely to be important for its integrity during penetration of the target cell envelope. VgrG proteins are orthologous to the central baseplate spikes of bacteriophages with contractile tails, and genes encoding proteins with PAAR motifs have been frequently found immediately downstream from vgrG-like genes.	3.07684e-18
NZ_CP013376.1\|WP_069254514.1\|1693501_1694017_-\|photosystem-reaction-center-subunit-H	gnl\|CDD\|368352	pfam05239, PRC, PRC-barrel domain. The PRC-barrel is an all beta barrel domain found in photosystem reaction centre subunit H of the purple bacteria and RNA metabolism proteins of the RimM group. PRC-barrels are approximately 80 residues long, and found widely represented in bacteria, archaea and plants. This domain is also present at the carboxyl terminus of the pan-bacterial protein RimM, which is involved in ribosomal maturation and processing of 16S rRNA. A family of small proteins conserved in all known euryarchaea are composed entirely of a single stand-alone copy of the domain.	3.99124e-09
NZ_CP013376.1\|WP_069254513.1\|1690495_1692487_+\|response-regulator	gnl\|CDD\|274362	TIGR02956, sensor_protein_TorS, TMAO reductase sytem sensor TorS. This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). [Signal transduction, Two-component systems].	6.67714e-66
NZ_CP013376.1\|WP_048023164.1\|1689077_1690115_-\|sigma-54-dependent-Fis-family-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	1.50607e-122
NZ_CP013376.1\|WP_021159144.1\|1684093_1685029_+\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	6.8114e-17
NZ_CP013376.1\|WP_060159263.1\|1692868_1693480_+\|DUF4142-domain-containing-protein	gnl\|CDD\|379301	pfam13628, DUF4142, Domain of unknown function (DUF4142). This is a bacterial family of unknown function.	1.47059e-34
NZ_CP013376.1\|WP_059591148.1\|1687219_1689019_+\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|185001	PRK15041, PRK15041, methyl-accepting chemotaxis protein.	1.19202e-93
NZ_CP013376.1\|WP_059591153.1\|1682501_1683884_+\|amino-acid-permease	gnl\|CDD\|224038	COG1113, AnsP, Gamma-aminobutyrate permease and related permeases [Amino acid transport and metabolism].	0

>NZ_CP013376.1|WP_021159144.1|1684093_1685029_+|universal-stress-protein
MQPAQPIPTLARIALAVDPTPESLSAARYARTLLRPGMRLRIVCAIDNPRLVLPDIPRIDALLTSAREDMMREAQAVNERIAALFADSGIEVEQAIVDTSVTGGSVADALVNDTSEWRADVLIVGANPHHGLLRLVEGAMSDTLTTRARCALLIVPAAYALPSNGGLQRLMFAVDGSEPSLHAVRVGLGFATPTTLLYAAYVIDRAVRLTDIVPVRALEDAYRAEGEDALAKIGPLFHATGNPTKRSIVETRPTSDDVAHALMRDAVHWRAELLVVGTHGRRGIAAWLIGSVARRVAHLAQVPVLLVRGTE
>NZ_CP013376.1|WP_059591153.1|1682501_1683884_+|amino-acid-permease
MKQPEDQLHRGLEERHINLMALGATIGVGLFLGSATAIRVAGPAILLTYLLGGIAIFLIMRALGEMAIANPVAGAFSRYARDYLGPLAGYLTGWTYWFVWIVTCMAEITAVGVYMHMWFPSVPNWIWALAALVAMGSVNFIAVKLYGEFEFWFALIKIVTIVLMIIGGGLMIAFGIGNGGVAIGLSNLWAHGGFMPNGINGVIAALPIVMFAYLGVEMLGLTAGEARNPEKSLTKAVNSVFWRVLIFYIGALFVIMSLYPWDQIGTQGSPFVMTFSRLGIPAAAGIINFVVLTAALSSCNSGLFSTARMLYNLAQQGQAPGKLGKVNRNGVPVYGVIVSVALLLIGVLLNYLAPQHVFTWLTSVSTFGAIWTWCVILIAQMRFRRTLSADKIARLPIRVPFYPLGSFVALGFLVLVVVLMAFTPDTRVALVIGPVWIVLLGIAYALFYANRPAASVPTKS
>NZ_CP013376.1|WP_081332343.1|1681349_1682021_+|GNAT-family-N-acetyltransferase
MQETFTDSIMYPTESNVVPLSRQFLESSIALIDAAFSRDPTLAWCLSAQTPGFDARRTNYLRSYLQYHHDASLPVLGVWVRDALVAVSYFTPGSTTENTSSLAELGHQIASGCGKRSLHRIDLLRRVVESKLSCHDCSRIEFIAVSPLMQGHGIGASLLRTTLAYLQDIEPDKNVFLETGEVRNLPLYLRHGFSVRQRIGFPGLDQYLLRKDAVCGGLATSNE
>NZ_CP013376.1|WP_069254511.1|1680980_1681268_+|PAAR-domain-containing-protein
MTRYMIFDGDHTTVAGTVQANATPFALDGRHIAHEDDDVFCPVCKTIGKIKCIGPRIPMTGPDGRRVALSDDLCVCKCPAPPLLIPSQHVMSVDV
>NZ_CP013376.1|WP_146774181.1|1680254_1680824_+|hypothetical-protein
MTGEIEAIVRKNISGVCDSFVLNTVCVALQDNGFIEAAGQNLSSVRAIHRASERICPEIIKRDLRFQDFLVDRIMVASVRSQRHWLIEALGNLDSCVDRGNIFKHAITPQTSLLTLAWRIPMLLANVAFGIKASYFRKFTAHGKFDRWVEGNVNTEKIDARMILEELLTGNDGVPAKYRQRLEEALKRY
>NZ_CP013376.1|WP_081332342.1|1678883_1680227_+|DUF3396-domain-containing-protein
MTLSDPKPVLTPLQALSRYQEDLSVRLADNSMGVLPGVIGTVFFERGSQPEVRQAILDCFDRFTEMFGKHLKGGKDTDLGKFTKRNDKGIEKIRRAIIDSPPHLKVSVVLSSAMDQDTAAEYSIKTLTGSALAQDYVHPNGLLRVAKGRESGLSYLKFNVPMNLMVTSEGIAQYEGFLRYICGKLVVRAGYGGLAPILSFNYNRYMPQEWALAERFSGLDIDSTAHLQKSDYEANSYEGDSLEEMTAQYDYLRPGAKVARWGFIKGVSWYTILGELFIERLGGEAVIREKLDRPDIHVERANTCLMIRAGDFPRLGAPEEGLPEPYVFVNSVLRTLRDPKPDALHTYIPDLPSADVKNARKWVARFDLPDAPPIPEPPTIVPPPVNREPARQSVRGGSTCPEAGWWHTPAKAGSRRYFEAGETMPVIEGSSWGTTNWHWSPSEKQNG
>NZ_CP013376.1|WP_069255169.1|1677570_1678845_+|VRR-NUC-domain-containing-protein
MGGSLQPAGACETIKERVPEYAYLPPGTKGYLQEKVEKALKTAKYVPVKLRDGSIVHRLLMQSAMSVPMIIEEEFKWKWIFKYKAEVSFDMTPADAMIGGIPIPFLSNENPYGAERRRSLNPFPPGATVGLLRRPDVIIVDKEAILWPGRGTIDREGGRHVPNLLRLVEVKFPGDSLGEAQQEAYKLIAGEYKNRMTVIDVTDCNGELQKIPKPVPVPAPKTNDEKERQTVPIRSVPAVPHHVWYEDWWQKAHEFGEEVEHAVAPVWDAVHRGYSYVSAETSAFLRQHAAWMFTAGQWVADKAHSAWVWVDEKGHEIFRYTAAQLKAGWEAIVQMTDMTWDVLTHIDWAQVGVTMLKGAAIAVAIVVGVAIVILLLPELIAIFAALCAIIAAGAEAAAGLAAALGVVLGVVLGGGSAVAALAAN
>NZ_CP013376.1|WP_069254510.1|1674692_1677545_+|type-VI-secretion-system-tip-protein-VgrG
MALRRPAPRDLKNRDLYEAVHRGLLQHDRLLMLDTPLGKNALTPLRARGSSGIGGDYHWTIDVASLRDDTALLSLMHQPVTLWIQQRTALYADSVYRPVHGFVHQVGYLGGDGSVSTYQLEFSSALIFLSKTRNDEGWLEKDAREIISDVFNRYSQLQGRFRFDLTREPAVRSWCRQSESDLHFVYRLLEDEGMYLRWVHEPTKEGEPPKTTLVIVDRVSSMPEAKPAEYYRGNSDHEADGFTQWAVMQTMQSLSYMSRAFDYKRPTSHFQTESALQSTTYVMDGGRQSESRSIPAAPMTIYQPTAYGYPDSDSGEGRARRRVEEWDSRARRYFGVGGLRWLDAGSRFTLDNHPRHPDSDPKKREFLVIEARWFIENNVSIGQQATEYPRSLRATLAEQQAAHGTRFKTPEHPQDGMAGFFVIEVEAQEASVEYRSTLAHSKPNMTIEHAIVVTQQGSEAWTNERNQVRVHFAWDRKNPDGTFASSPLLSTMQADTGNGYGSVHVPRAGEWVLVAYWANDCDKPFILGRVNGGTTPSQWHSNVLLSGFQSQGFGGTGAFNSFVHDDATNQGGTRLVSYTGSSYASIAQGYLIQQSGNTRGRYLGSGLLLHADHYASVRGSRGVSISAHPVSRDSDQLDVDEAREQLTRSKDLLGSISDAIEQHQAESLKLGVDALTTFTDATKQSASGEATGGRTAGGGTGNANAFAAPLLLLGSPAGIGLSTHQSLHASADQQANWISGQDSYFAAGGSMHAAAIDHLSLFARNQGIKAVAGKGKVEIQARDGDLEMIAQQLVKLLSVAGRMEIAADQELVLYCGGATIRIKGGNVSIHAPGNVDFKGASFSFAGPVSESYAMPQFKPSYQAQYVLKSENDGTPMIRHAYEMKLPSGRTVLGHTNDLGETVPVFTPSAQSVSLKAFEQEKQDVEPWKYAGGGEPDIWADYLKGDPDERT
>NZ_CP013376.1|WP_021159151.1|1673123_1674149_+|hypothetical-protein
MWHFPIAIPSSLGPWAVFASVLITQLGVPVPAVPMLILGGTMAAMGQASWVSMFAAAIGATMLADSLWFFMGRTRGRRLLNGLVRFSLSLDTTLRFARNVFERYGAPLLVLSKFLPGLGLVSAPLLGTTAIGVGVFLFWDLAGASLWAAFWLVGGAAIHDQIVQFVLWVRASGGTILDAFLAIFITFLLYRWVRRVQFRRYLAQVRISPPQLVEMMTSDEPPLIFDARPKAIREREPYRIAGAVPVDLDSPDLLDPELLKRPIVVYCVCPNEATAKRLIAKMQRKKMIHNIRALKGGLDAWEKHGYPVEPMPADLDASRYFVRPEHGALEGEYTVRATLSK
>NZ_CP013376.1|WP_048023031.1|1672431_1672938_+|cupin-domain-containing-protein
MPISATDLIRQFDLQPHPEGGYFRETYRATDSVVRPADGAPRAASTAIYYLLCDGAYSSWHRIRSDEVWHFYAGDPIEVWVLDERDGLTIHRLGNPLTHPGTVFQAVVRAGSWFGARCAAPEHVALVGCTVAPGFEFAEFELADAAALAAAFPDYAEYVAQLAQRPDA
>NZ_CP013376.1|WP_048023016.1|1686609_1686864_+|DUF3562-domain-containing-protein
MSKDNLLDSLKEAARQRAIGADQLRAMLDDEVRALSSDARVHDYIHVFAIRHLRERMRRQDELANDTRADGPPAEADPRPGHRL
>NZ_CP013376.1|WP_059591148.1|1687219_1689019_+|methyl-accepting-chemotaxis-protein
MFSSIRARILAACVAIVVFALVATTLINYFIARSYNDDAIDRNLTSVASGHVVGIADWVATRSRMIASLQDAALAPDPLPVFKQMATAGGFTNVYAGYADKAFHFSDPTGIPPDYDPTGRPWYKQAAQAGKPVVTPPYVDAGTGNLVVTFAVPILRDGTLKGVVAADVAMDTVIANVKSIHPTPASFGMLIDSSGHVVAHPDPKLTLKPVADVSPELGATNGATIAAATAPVEVSVGGDAKLVRARPVPGTDWYALVLLDKNEATAGMRSLLTASLITLLVIVGVASLIIGAITATAFRRLSQVRQAMAAIGSGAGDLTQRLPADGRDEVADIARSFNSFVDKLNDVMREIRDASESVRTAANEIAAGNQDLSSRTESAAASLEETAASMEEITATVGQSAAAAGQADERAAAASRIASHGGVVVSDVVATMEKIEEASGRIGDIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAQEVRSLAQRSAQAAREVKVLVESTVASVSAGSGQVRQAGDTMREIVSNVANVTTIISEITHAANEQTRGIQEVNRAVTQLDEMVQQNAALVEQSTAAATALQSQANALATTVGRFKVA
>NZ_CP013376.1|WP_048023164.1|1689077_1690115_-|sigma-54-dependent-Fis-family-transcriptional-regulator
MINIAINGTGDADFQNDPLMPMGDTANRSKQRADGRRLSGRSSAMRTLLGRIEKIAPTRASVMIAGESGVGKDIVARRLHDLSARRDGPFVPVNCGAIPPDIAESQLFGHEKGSFTGAIAQREGFFEAARGGTLLLDEIAEMPASLQVKLLRALESNAIVRVGGTEPIPLDVRIVSATRHNPAEAVRDGRLREDLFYRLAAFALYVPPLRQRDSDVETIALEFVDTLNARHHAHKRLTDAAIAALRAYSWPGNVRELHNTIERAYILSDEGIDVTLPKPAVPPERLSEDTMALPLGATLHHAQQRFIAATLRHFDGNKPRAAKALGISLKTLYNRLALMRDNGRS
>NZ_CP013376.1|WP_069254513.1|1690495_1692487_+|response-regulator
MRTLTRELLRQGAWVVLAVGLASALQAWTVRVVGGHAPFAPLPFYAGVAAVAWLASFGGGLVAAAASVAVICALWWRNAPLATLLEQAGAFVAISFVECVLVMAVKPLLASDRLREIRDDGDAGAREPHGEPSPAARVPVPDDVLLRRVVDASPDAIVGVDTAHRITSWNPAARQIFGIDAAQAIGLDVAELIAPRWLRRHPLPRSFATLRAPVGPLDVLCVRRDGGRFRATFAASPIVDARGDCTGLSMTLRDAHERRRGERRNMRSLRGARDARAQADASNRLKDELLATVSHELRTPLNVIYGWVEVLRNVDGEGLAQQAVDAIDRSARSLSHMVADLLDASSLATGRLRLERVPVDLVRIVRDAMRELDATAQANGLDLSTKYEMATCVIPADRERVRQILSNLLSNAIKFTPSGGRVVVSLTRAGERVRLSVADTGQGIAPEYLPHLFETFSRPERAFASPRRGLGLGLSIVRNIAQLHGGEVVATSAGSGRGTTVTVTLPARWDADDPAEDLLHAAGTPDTVALDGRRVLVVDDDATSRASLAAALETMGAQVSTAQSGHDALEVVEHDAPNVVLSDLAMADGDGFWLLDRIRHLPGGSGRLPVVAVTAHAGNADRHRVMAAGFDAYLCKPVDMPTLASVIADVAPDAGHDRNPHDR
>NZ_CP013376.1|WP_060159263.1|1692868_1693480_+|DUF4142-domain-containing-protein
MKANRTRRPAATVLAAAVGLLAAAFPPAQASPASSAQVGPGVIRPGTTADEAGMTQRPTGIDAEFVDKAGMIGKVERQASQLALDRSSNPDVKAFARRMVDDHRRIAGELQQLGAAKGLPVQSRMLVDPAVTALRTREGRAFDTAYVALAGPRAHEAAIRLYEAEARNGRDPQLRAFAANTLPMLNAHLAAARQLERTVAAAH
>NZ_CP013376.1|WP_069254514.1|1693501_1694017_-|photosystem-reaction-center-subunit-H
MTTDRPSRDDTRIVGNDRRTAGGGPGPDVMAARTLEGDRVLTMDGDDIGQIDDIMLDVRSGRIAYAVVSSRGEPGIGDKLLAVPWNVLVLDVERQCFVLPVATERVREAPGFDRNRWPAMADPDWAEALHAYYGSSPYWLIEEGETALDSPPYEASPEGPEGTNGTKGGKR
>NZ_CP013376.1|WP_021162006.1|1694074_1694506_-|CBS-domain-containing-protein
MYRVTEIMSRDVVCVAPTDTIRHAAELMRRFDIGVLPVCDGDELVAIVTDRDLAVRGLSHGHSFDTPVQAVASMPVQWCVEDDGVGDVQQRMADVQLHRLPVLDRHRRLVGMVSLGDIATRAGGPERDELANTLEDVSLPRRR
>NZ_CP013376.1|WP_021162008.1|1694869_1695118_-|hypothetical-protein
MTVHAPGRHHAVPPAAGLLWLATSRPPSKDKTEERIDEGLEETFPASDPPAVGGATRIDPARPSGEHERRAPHVPSPPRDHG
>NZ_CP013376.1|WP_059650711.1|1695259_1695559_+|hypothetical-protein
MDASRERIRYDANVCGGDFGHVRERFDTWKRESLVYRPERRMFDGKDEVRELNRTVYDGPARAQRALVGQCAPSDPYALAVRLTAEGRTMWLVMAAYDD
>NZ_CP013376.1|WP_042977308.1|1695865_1696177_+|hypothetical-protein
MDIHVQSPDKRAIAQVLGRYFESRSLRYHIEELPGGVLQIGFRASGRPVAVTVSFDDAAYDTYTHWDASQKQLALGRLADGFSRMMSSRSPAALAGDYHVERF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013376_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013376_2

3371924-3372129

Orphan

Consensus_repeat	Method
GCGCCGCCGCCGAGGGCGCCGCCGAT	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP013376_2

>merge|NZ_CP013376|2|3371924-3372129|CRISPRCasFinder
GCGCCGCCGCCGACCGCCGCACCCAGCAGGCCGCCCGTGCGGCCGCCCATCGCGTTGCCTGCCGCGGTGCCTGCGCCGCCGCCGAGGGCGCCGCCGATGATCGCGCCGGTGCGCTCGCGACGGTTCGACGTCACCGCGCCGCCCGCGCCGCCGCCGATGGCGCCGCCGATCACCGAGCCCGTGCTGCCGCCGAGCGCACCGCCGAC

>NZ_CP013376|2|2|3371924-3372129|CRISPRCasFinder
GCGCCGCCGCCGACCGCCGCACCCAG	CAGGCCGCCCGTGCGGCCGCCCATCGCGTTGCCTGCCGCGGTGCCT
GCGCCGCCGCCGAGGGCGCCGCCGAT	GATCGCGCCGGTGCGCTCGCGACGGTTCGACGTC
ACCGCGCCGCCCGCGCCGCCGCCGAT	GGCGCCGCCGATCACCGAGCCC
GTGCTGCCGCCGAGCGCACCGCCGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013376.1\|WP_011353812.1\|3381455_3381989_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224427
NZ_CP013376.1\|WP_069255032.1\|3378608_3379484_-\|DUF393-domain-containing-protein	unknown	unknown	gnl\|CDD\|367833
NZ_CP013376.1\|WP_059496275.1\|3366492_3366870_-\|carboxymuconolactone-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|223672
NZ_CP013376.1\|WP_021159925.1\|3372633_3373293_-\|isoprenylcysteine-carboxylmethyltransferase-family-protein	unknown	unknown	gnl\|CDD\|224931
NZ_CP013376.1\|WP_069255028.1\|3364007_3364802_+\|3'-kinase	unknown	unknown	gnl\|CDD\|226100
NZ_CP013376.1\|WP_069255031.1\|3377112_3378612_-\|TIGR01777-family-protein	unknown	unknown	gnl\|CDD\|273800
NZ_CP013376.1\|WP_059676102.1\|3361650_3363771_-\|PBP1A-family-penicillin-binding-protein	unknown	unknown	gnl\|CDD\|273955
NZ_CP013376.1\|WP_021159932.1\|3379580_3380051_-\|DUF2269-domain-containing-protein	unknown	unknown	gnl\|CDD\|370783
NZ_CP013376.1\|WP_059487527.1\|3368677_3369613_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP013376.1\|WP_021159934.1\|3382150_3383353_+\|trans-2-enoyl-CoA-reductase-family-protein	unknown	unknown	gnl\|CDD\|237460
NZ_CP013376.1\|WP_060074462.1\|3370073_3370910_-\|(S)-ureidoglycine-aminohydrolase	unknown	unknown	gnl\|CDD\|183011
NZ_CP013376.1\|WP_069255030.1\|3374853_3376263_+\|serine-hydrolase	unknown	unknown	gnl\|CDD\|224594
NZ_CP013376.1\|WP_059676046.1\|3364975_3365326_+\|methylmalonyl-CoA-epimerase	unknown	unknown	gnl\|CDD\|179740
NZ_CP013376.1\|WP_069255027.1\|3361030_3361642_-\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NZ_CP013376.1\|WP_069255225.1\|3380047_3381367_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187579
NZ_CP013376.1\|WP_048023506.1\|3366883_3368320_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143421
NZ_CP013376.1\|WP_021159929.1\|3376344_3376968_-\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|198289
NZ_CP013376.1\|WP_048023513.1\|3373868_3374288_-\|HIT-family-protein	unknown	unknown	gnl\|CDD\|238608
NZ_CP013376.1\|WP_059621810.1\|3365500_3366496_-\|NAD(P)H-quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|176180
NZ_CP013376.1\|WP_069255026.1\|3360617_3361001_+\|lactoylglutathione-lyase	unknown	unknown	gnl\|CDD\|366361

Protein	Function_ID	Function_description	E-value
NZ_CP013376.1\|WP_011353812.1\|3381455_3381989_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	6.42957e-41
NZ_CP013376.1\|WP_069255032.1\|3378608_3379484_-\|DUF393-domain-containing-protein	gnl\|CDD\|367833	pfam04134, DUF393, Protein of unknown function, DUF393. Members of this family have two highly conserved cysteine residues near their N-terminus. The function of these proteins is unknown.	1.79926e-18
NZ_CP013376.1\|WP_059496275.1\|3366492_3366870_-\|carboxymuconolactone-decarboxylase-family-protein	gnl\|CDD\|223672	COG0599, COG0599, Uncharacterized homolog of gamma-carboxymuconolactone decarboxylase subunit [Function unknown].	5.98515e-21
NZ_CP013376.1\|WP_021159925.1\|3372633_3373293_-\|isoprenylcysteine-carboxylmethyltransferase-family-protein	gnl\|CDD\|224931	COG2020, STE14, Putative protein-S-isoprenylcysteine methyltransferase [Posttranslational modification, protein turnover, chaperones].	3.53209e-26
NZ_CP013376.1\|WP_069255028.1\|3364007_3364802_+\|3'-kinase	gnl\|CDD\|226100	COG3570, StrB, Streptomycin 6-kinase [Defense mechanisms].	4.16923e-83
NZ_CP013376.1\|WP_069255031.1\|3377112_3378612_-\|TIGR01777-family-protein	gnl\|CDD\|273800	TIGR01777, Hypothetical_UPF0105_protein_Rv2216/MT2273/Mb2239., TIGR01777 family protein. This model represents a clade of proteins of unknown function including the E. coli yfcH protein. [Hypothetical proteins, Conserved].	7.73667e-108
NZ_CP013376.1\|WP_059676102.1\|3361650_3363771_-\|PBP1A-family-penicillin-binding-protein	gnl\|CDD\|273955	TIGR02074, Includes:_Penicillin-insensitive_transglycosylase, penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NZ_CP013376.1\|WP_021159932.1\|3379580_3380051_-\|DUF2269-domain-containing-protein	gnl\|CDD\|370783	pfam10027, DUF2269, Predicted integral membrane protein (DUF2269). Members of this family of bacterial hypothetical integral membrane proteins have no known function.	6.15816e-57
NZ_CP013376.1\|WP_059487527.1\|3368677_3369613_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.76137e-60
NZ_CP013376.1\|WP_021159934.1\|3382150_3383353_+\|trans-2-enoyl-CoA-reductase-family-protein	gnl\|CDD\|237460	PRK13656, PRK13656, enoyl-[acyl-carrier-protein] reductase FabV.	0
NZ_CP013376.1\|WP_060074462.1\|3370073_3370910_-\|(S)-ureidoglycine-aminohydrolase	gnl\|CDD\|183011	PRK11171, PRK11171, (S)-ureidoglycine aminohydrolase.	0
NZ_CP013376.1\|WP_069255030.1\|3374853_3376263_+\|serine-hydrolase	gnl\|CDD\|224594	COG1680, AmpC, Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms].	3.53959e-38
NZ_CP013376.1\|WP_059676046.1\|3364975_3365326_+\|methylmalonyl-CoA-epimerase	gnl\|CDD\|179740	PRK04101, PRK04101, metallothiol transferase FosB.	6.70543e-10
NZ_CP013376.1\|WP_069255027.1\|3361030_3361642_-\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	2.12826e-61
NZ_CP013376.1\|WP_069255225.1\|3380047_3381367_-\|SDR-family-oxidoreductase	gnl\|CDD\|187579	cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like, atypical (a) SDRs. This subgroup of extended SDR-like proteins are atypical SDRs. They have a glycine-rich NAD(P)-binding motif similar to the typical SDRs, GXXGXXG, and have the YXXXK active site motif (though not the other residues of the SDR tetrad). Members identified include NDUFA9 (mitochondrial) and putative nucleoside-diphosphate-sugar epimerase. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.83213e-50
NZ_CP013376.1\|WP_048023506.1\|3366883_3368320_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143421	cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like. Succinate-semialdehyde dehydrogenase, mitochondrial (SSADH, GabD, EC=1.2.1.24) catalyzes the NAD+-dependent oxidation of succinate semialdehyde (SSA) to succinate. This group includes the human aldehyde dehydrogenase family 5 member A1 (ALDH5A1) which is a mitochondrial homotetramer that converts SSA to succinate in the last step of 4-aminobutyric acid (GABA) catabolism. This CD also includes the Arabidopsis SSADH gene product ALDH5F1. Mutations in this gene result in the accumulation of H2O2, suggesting a role in plant defense against the environmental stress of elevated reactive oxygen species.	0
NZ_CP013376.1\|WP_021159929.1\|3376344_3376968_-\|glutathione-S-transferase	gnl\|CDD\|198289	cd03180, GST_C_2, C-terminal, alpha helical domain of an unknown subfamily 2 of Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.	7.43255e-49
NZ_CP013376.1\|WP_048023513.1\|3373868_3374288_-\|HIT-family-protein	gnl\|CDD\|238608	cd01277, HINT_subgroup, HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides. This subgroup includes members from all three forms of cellular life. Although the biochemical function has not been characterised for many of the members of this subgroup, the proteins from Yeast have been shown to be involved in secretion, peroxisome formation and gene expression.	2.68358e-48
NZ_CP013376.1\|WP_059621810.1\|3365500_3366496_-\|NAD(P)H-quinone-oxidoreductase	gnl\|CDD\|176180	cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase. PIG3 p53-inducible quinone oxidoreductase, a medium chain dehydrogenase/reductase family member, acts in the apoptotic pathway. PIG3 reduces ortho-quinones, but its apoptotic activity has been attributed to oxidative stress generation, since overexpression of PIG3 accumulates reactive oxygen species. PIG3 resembles the MDR family member quinone reductases, which catalyze the reduction of quinone to hydroxyquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	8.50727e-153
NZ_CP013376.1\|WP_069255026.1\|3360617_3361001_+\|lactoylglutathione-lyase	gnl\|CDD\|366361	pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily.	3.0491e-05

>NZ_CP013376.1|WP_060074462.1|3370073_3370910_-|(S)-ureidoglycine-aminohydrolase
MSKTTYYAPHGGHPPQTDLLTDRAMFTEAYAVIPKGVMRDIVTSWLPFWMNTRLWVIARPLSGFAETFSQYIVEVNPGGGSDKPEQDKNAEAVLFVVEGEAELTLQGTKHVLKPGGYAFIPPGADWTLHNVSDAAVRFHWVRKHYQAVDGIPLPEAFVTNEQDVEPIPMPGTNGAWVTTRFVDMSDMRHDMHVNIVTFEPGGVIPFAETHVMEHGLYVLEGKAVYRLNQDWVEVEAGDFMWLRAFCPQACYSGGPGRFRYLLYKDVNRHMNLTLNPAR
>NZ_CP013376.1|WP_059487527.1|3368677_3369613_+|LysR-family-transcriptional-regulator
MDKVHTMSVFAKVVEMGSFTAVANHLDTTVGNISRAVSVLEDNLNTRLLQRSTRRLVVTDAGRRFYERSVAILSDIERAEAEARDALLEPRGVLRVHAVPGLGRRLVSQAVLAYRSAYPEVSVDLMLSQRMPNLLEEQLDVAIVIARTLPDSAYVSQKIGASHCVLAASPDYLARHPAPECVEDLADHTCVLLSTVDYAPDEWHLQGRAGDAVYRPTGSYFGVNDMDAMSTVLQEGAGIGLIAAFSAIDDLRKGSLVRVLPQFHTAQRNVYAMYSSRQFVDAKIKRFIDVLKVRVGDQLNAYAEELAITVS
>NZ_CP013376.1|WP_048023506.1|3366883_3368320_-|NAD-dependent-succinate-semialdehyde-dehydrogenase
MDISYDALHLFINGEWIGASERETAPVINPATQIEIGRVPLATAADLDRALQVAAQAFDVWRNTVPAERARILKRGAELMRERAEHIATVMTLEEGKPLAESRDEVLRAADYFEWFAEEARRIDGRVVPSNRPGVQQLVKKQAIGPVAAFTPWNFPAITPARKLSAALAAGCSVIIKPGEESPATALALARALDDAGLPKGVLQVVFGVPDEVSKHLIASPVIRKVTFTGSVPIGRLLSARAAEGVKPITLELGGHGPVLVFNDADVEKAAVEGAANRFRGTGQICISSTRFLIQREVYDAFVGHFVRAANALKVGNGMDAGTQVGPLANPRQLAKMEELIADAVERGATVLAGGKRIDGEGYFFEPTVLADVPKDARVMHEEPFGPIAVLMRFDALADGLAEANRLPYGLSAYAFTSSARTAIDVADGLEAGMIGINQYRIVSTELPFGGMKESGHGSEGGAEGIEYYLTRKFISQV
>NZ_CP013376.1|WP_059496275.1|3366492_3366870_-|carboxymuconolactone-decarboxylase-family-protein
MSHADFSSPREAARAFTPTLSAFVDDTLYPRIWNDPALSPRDRSLVTVAALIAGGHLDELPAHLRRAVTNGVTREELSAAITHLAFYAGFPAAISASAAAQATLGTQPRSDDVAGHSSMTQEGVK
>NZ_CP013376.1|WP_059621810.1|3365500_3366496_-|NAD(P)H-quinone-oxidoreductase
MKAITFSEFGEAEVLQLAEVQAPEVRPDDLLVRVHAAGVNRADLTHRRGGYGRPNFGDSTIMGLEIAGEVIETGPSVQGYKVGDRVMGVVGGGAYAELARIDWRMAMPIPATIDYVHAAAIPEVFVTAHEALLHLGRLQHGDSVLVHAAAGGVGSAAVQLAYATGATIFATAEASKLERIVQLGVDHAIDYKTQDFAEVIADKTDKRGVDVVIDFVGAPYFARNIASLANGGRLVQVGILGGGGDVSVSLEQILYRHLQIIGTVMKSRDQREKHAMVRRFREHWLDRFAGGAGLEPVVDSVFPLADAAAAHRRMESAVNVGKIILTMGENA
>NZ_CP013376.1|WP_059676046.1|3364975_3365326_+|methylmalonyl-CoA-epimerase
MRLRTVYLKVSDMETSASFWERLLGYEPLKRSGKWTEFMIGTNRLGLLLNDFGDEIKGSGSVPVFEFEEKALHEFVKRATENGASIVMDGLKIESMKSIVLSSPDGHEFELCMCRD
>NZ_CP013376.1|WP_069255028.1|3364007_3364802_+|3'-kinase
MFDRYLALWGLVPDGGPILTASGGLLPVLWQARPAMLKVATCDEERRGNALMTWWNGHGAAQVWRHDSDAILLERAQPAPSLAHLSASGHDDDTMRIACGVVARLHAHRAPEPVSVVPLRDWFRSLLSDDVGNDVLHCSATIARELLAGPPVDEVVLHGDIHHDNILHFGDRGWLAIDPKGLRGDRAFDYANLFCNPAHEIAVDPARFTQRVVCVSDAARLDRRRLLQWILAWAGLSAVWLMEDDLPPDTRLQVARLAAIALDL
>NZ_CP013376.1|WP_059676102.1|3361650_3363771_-|PBP1A-family-penicillin-binding-protein
MTDHTASPPPPPVPPPRRRRAWRTLAGALLGLTLACAGIGAWTVNRIWTQLPSVEHLAVYRPALPLRIFSRDGDLLAEYGVERREFVPLERIPPLMRHALLAAEDAKFYQHGAVDVGGLARATFANVVTGQPGQGGSTITMQVARNFYLTRDKVLSRKLAEILMAAKLEREYSKDKLLELYMNEIYLGERAYGFAAAANVYFGKPLDALNAGEAAVLAGLPKAPSAFNPVVNPARATARRNYVLGRMHALGQLDDATYRAAVDAPIALATTPPPGIVAAPYVAERARRMMVERFHDDAYTLGLDVTTTISMRDQRAAEAALQRQLSRQPGAKRDARNGLEGALVSLDAATGDMLALVGGADFNRNVFDHALQAYRQPGSSFKPFVYSAALEKGYFPGVLVDDTQRTLTHEETGARPWRPRNFGNRYEGFIPVRRGLVRSKNLVAVSLMQATDARYVQQHAVHFGFDAQRNPASLPLALGAGAVTPLELASAYSVFANGGTRMEPRLILSVKQRHGGAMYEATTPEGARVVSARNAFLMDSMLRDVVKAGTARGALALRRDDAAGKTGTSNGSKDVWFAGYSSGIVAVAWLGYDTPRPMGRATGATLALPVWLDYMKTAVDGRTPVDATPPQDVALVDGDFVYAEYTRGTCTADVPPYIRSRFACGGAAAQDASDAPAGSGKPDAPLPAAVDAAERERVLDLFRTDD
>NZ_CP013376.1|WP_069255027.1|3361030_3361642_-|trimeric-intracellular-cation-channel-family-protein
MHTLYLIAIVAEAMSGALMGMRRGMDRFGLALVGAVTALGGGTVRDVLLGHYPLGWIAHPEYLVITLAAATVASWAARHVARMKTLFVTVDAIGLAAFTIIGCDIGASTGAAPIIVVLAGAITGVCGGMLRDLLCNEMPLILSEELYASVAFVTGALYVGMQHLDVDAGAATVVALAAGFSMRMLAVRLGWKMRTFGAADVGH
>NZ_CP013376.1|WP_069255026.1|3360617_3361001_+|lactoylglutathione-lyase
MPLPMTRIILYVQDVTLLKAFYQRHFDLPVIEEIDGEWAVLNAGAIELALHLAGPAFRHAAAPSNANPATNNVKLVFRIDTDIDAHRDRLARDGVTVRDVKRFDGFPYRLLDGIDPEGNVFQVTQPD
>NZ_CP013376.1|WP_021159925.1|3372633_3373293_-|isoprenylcysteine-carboxylmethyltransferase-family-protein
MTVTRKVAALSGISTLVYLGLAVLGSGGFAAFFSHPPLTVVVVATLAMAVAAMFTEGNLSSGERENRDNRWVLAAFAVSGFLLAYLPALTDRLDFWTFGGDAVRWAGVALYIAGGVLRIWPVFVLGKRFSGLVAIQPGHTLVTDGIYRRIRNPSYLGLLVNSVGWALAFRSGVGVLLVVLTMIPLVARIRSEEALLRAQFGAEYDAYCARTWRLLPGVY
>NZ_CP013376.1|WP_048023513.1|3373868_3374288_-|HIT-family-protein
MPYDNNNPFARILRGELPCVKVAEDDTTLAIMDLMPQADGHVLVIPKEPAAQIFDLSGDAAAAGIRMTQRVAAAVRAALEPDGVFIGQFNGAAAGQTVPHVHFHVIPRWEGAELRMHAREIADAATLEALAQRIRARFV
>NZ_CP013376.1|WP_069255030.1|3374853_3376263_+|serine-hydrolase
MTIPFKKPILRGVALAAVAAIGYTGYMLSRLAPVATGYAAKALCSGVYVSGRPAASVIDVDIMAGVHPLLKLVRPSIDPDHHRAVATFAGFARREADFRPGLGCTLAIGPSPAALPAALPPLPDPPPAQPAPAAPATPPAGIDARKLQTALDRAFDEPDPARPRRTRAVVVMWRGQVIAERYAPGFTADTPLPGWSMTKTVTAALVGALVAQHKLSPDTSALLPEWRGSGDPRAAITLDELLRMTSGLQFNEDYDDPLSDVALMLFTQPDTARFASAKSLAATPGTQWSYSSGTSAIVARVMREALGGGEDDYLAFPRRALFAPLGMRSAVFEPDVSGTLVSASYMYASARDWARFGQLLLQDGVWDGQRLLPDGWVRYLTRATPQSSRQEYGAQLWVKVPEPFNDRDPHAVAMPADAFHAVGHEGQFVSVVPGRQLVVVRLGLSRPESAWNHEAFLARVLDAVPAPGA
>NZ_CP013376.1|WP_021159929.1|3376344_3376968_-|glutathione-S-transferase
MLHILGKIPSINVRKVLWLCTELNLPFEQEDWGAGFRTTNDPAYLALNPNALVPVIKDDDFVLWESNTIIRYLANRYGGDALYPAEPQARARVDQWIDWQGADLNRSWVGAFLGLVRKSPDHQDPAGIAQSIAGWTKHMQVLNAQLEKTGAYVAGDTFTLADIPIGLSVNRWFGTPFEHPELPAVSRYIERLATREGFKQYAGSANP
>NZ_CP013376.1|WP_069255031.1|3377112_3378612_-|TIGR01777-family-protein
MNTLPAYDWALNLLIVQGAMGAFDTLYHHELTQDLPHRPRARLELGIHAVRSVLYGLVFASIANVAFHGAWVAALAAVVVVEVVLTLWDFVVEDQSRKLPATERVLHTLLAVNGGALFGMIAMQLAVWAHEPTALQVLDLGWRGGLLSVFAVGVTVSGIRDGIAACRIAQRAPAANPFAGQPPGNVLVTGGTGFIGETLVNHLLDAGHTVTLLARDPLRAAYSFQGRVRSVTSAGQLQPHERFDTVINLAGAPVLGARWSKRRQAVLLASRVGVTESLMRWVETAEVKPCTWIQASAIGYYGVRPADERLDERSSAGSGFMSGLCRQWELAAQPLERHGVRTVVLRLGVVFGPGGALRPMLLPHYFGMGGRFGDGTQVMSWIHRDDVLRIIARVMSNAGMHGVYNAVAPAPLTQREFVQVVSKVLHRPAWLHVPAAPLRVAMGEMAELLLDGQRVMPARLHQDGFMFRFPTAEHALRDLTNRPHGDFAHAACRLPRGRV
>NZ_CP013376.1|WP_069255032.1|3378608_3379484_-|DUF393-domain-containing-protein
MESSELVLYFDGRCPLCVAQIRRLGARDAQRRLAFVDIAGPGFDPVPLGVGLPALNRELHARLPDGRMLTGVDGILAAHALTGRGWLVRLLRVPVVRGVLAPLYRRVARNRHAVSRWLGYRTEAACDGRACDSDRAAEPAEPAADRPARDDMRRIVVTWMYGAALAHLLVGIAVPWVAGTPWLDAYQRVIEVHFWAGTAPGPARAQQVWWMSLIGATVQCASVWMLALVHLGNRLRRREVWGWLLAGLSIWAPQDMLFSLQARVSGHVAIDAAALVAMVPPLVWLWRRDTP
>NZ_CP013376.1|WP_021159932.1|3379580_3380051_-|DUF2269-domain-containing-protein
MNTYLVIKALHILSSVLLVGTGFGTAFYLFFANRTQSVPAIAAVSRLVVRADWWFTTPAVIFQPASGLWLAHTAGWPWHTPWLLASIVLYAIAGACWLPVVWLQLELASMAKLAHANGDAALPERYWRYAKRWELLGYPAFFAMLSVYFLMVLKPM
>NZ_CP013376.1|WP_069255225.1|3380047_3381367_-|SDR-family-oxidoreductase
MNAVLPSTCPQGRTGARRMTVLVCGANGFIGRALCAQLEAGGHRVLRGVRHAAGPCDVAIDFAVDIDPDAWLARLKGVDVVINAVGILADRRGATLDAVHRAAPCALFSACCRAGVRRVIQISALGVERGGTRYFASKLAADRFLQTLPIDFRIVRPALVYGTDGASARFFRMLASLPVHVLPAGGRQRLRPVHVDDLAEVVARLVVQPGDTSAAGRAVIDVVGNDEVEYREMLARYRAALRFPPAARVTLPGPLAGAAAALLGTLPGAMFTRDTWTMLRGGNTGDPAAVTTVLGRPPRGIDGFIGTEAAALRRDALAMWRRPLLRGALAIVWIWTAIASAFIHPLPASLALLAPAHLTGLPALIALYAASALDFAFGIATVVAPSRRLWAAQATLIVAYSAVIAVTMPALLAEPFGPVLKNVPILAILLILFSEEEQA
>NZ_CP013376.1|WP_011353812.1|3381455_3381989_-|MarR-family-transcriptional-regulator
MELTPIAERFILHWGEMGSRWGVNRTVSQIHALLYLAGRPIAADEIAETLNVARSNVSTSLKELQAWRLAKVVHVLGDRRDHFETSTDIWELFKLIVEGRRQREIEPTLTVLRDCLTNPEIANESRETEQRIRDTLQFVETLTTWSDEMLRLKPDTLMKALGIGAKISQTVRRKPSK
>NZ_CP013376.1|WP_021159934.1|3382150_3383353_+|trans-2-enoyl-CoA-reductase-family-protein
MIIKPRVRGFICVTTHPVGCEANVKEQIDYVTSHGPIANGPKKVLVIGASTGYGLAARISAAFGSGADTLGVFFERAGSETKPGTAGWYNSAAFEKFAAEKGVYARSINGDAFSDKVKQVTIDTIKQDLGKVDLVVYSLAAPRRTHPKTGETISSTLKPIGKTVTFRGLDTDKEVIRDVTLEPATQEEIDGTVAVMGGEDWQMWIDALDEAGVLADGAKTTAFTYLGEQITHDIYWNGSIGEAKKDLDKKVLSIRDKLAAHGGDARVSVLKAVVTQASSAIPMMPLYLSLLFKTMKETGTHEGCIEQVYGLFKDSLYGATPHVDEEGRLRADYKELDPQVQAKVVAQWNHVTNDNLYELTDFAGYKTEFLRLFGFEIAGVDYDADVNPDVKIPGIIDTTA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP013376_2	2.3\|3372082\|22\|NZ_CP013376\|CRISPRCasFinder	3372082-3372103	22	CP047036	Rhodobacter sphaeroides strain DSM 158 plasmid pDx, complete sequence	28933-28954	2	0.909
NZ_CP013376_2	2.3\|3372082\|22\|NZ_CP013376\|CRISPRCasFinder	3372082-3372103	22	NZ_CP047042	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pDx, complete sequence	28906-28927	2	0.909
NZ_CP013376_2	2.3\|3372082\|22\|NZ_CP013376\|CRISPRCasFinder	3372082-3372103	22	NZ_CP047900	Pseudarthrobacter sp. YJ56 plasmid unnamed2, complete sequence	72688-72709	2	0.909
NZ_CP013376_2	2.3\|3372082\|22\|NZ_CP013376\|CRISPRCasFinder	3372082-3372103	22	NZ_CP051473	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10DE, complete sequence	36889-36910	2	0.909
NZ_CP013376_2	2.3\|3372082\|22\|NZ_CP013376\|CRISPRCasFinder	3372082-3372103	22	NZ_CP051473	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10DE, complete sequence	146015-146036	2	0.909
NZ_CP013376_2	2.3\|3372082\|22\|NZ_CP013376\|CRISPRCasFinder	3372082-3372103	22	NZ_CP030276	Rhodobacter sphaeroides 2.4.1 plasmid pDE, complete sequence	36896-36917	2	0.909
NZ_CP013376_2	2.3\|3372082\|22\|NZ_CP013376\|CRISPRCasFinder	3372082-3372103	22	NZ_CP030276	Rhodobacter sphaeroides 2.4.1 plasmid pDE, complete sequence	146039-146060	2	0.909
NZ_CP013376_2	2.3\|3372082\|22\|NZ_CP013376\|CRISPRCasFinder	3372082-3372103	22	NZ_CP015289	Rhodobacter sphaeroides strain MBTLJ-20 plasmid a, complete sequence	80206-80227	2	0.909
NZ_CP013376_2	2.3\|3372082\|22\|NZ_CP013376\|CRISPRCasFinder	3372082-3372103	22	NZ_CP015289	Rhodobacter sphaeroides strain MBTLJ-20 plasmid a, complete sequence	124016-124037	2	0.909
NZ_CP013376_2	2.3\|3372082\|22\|NZ_CP013376\|CRISPRCasFinder	3372082-3372103	22	NZ_CP022195	Yangia pacifica strain YSBP01 plasmid unnamed5, complete sequence	21990-22011	2	0.909
NZ_CP013376_2	2.3\|3372082\|22\|NZ_CP013376\|CRISPRCasFinder	3372082-3372103	22	NC_013858	Azospirillum sp. B510 plasmid pAB510d, complete sequence	498979-499000	2	0.909
NZ_CP013376_2	2.3\|3372082\|22\|NZ_CP013376\|CRISPRCasFinder	3372082-3372103	22	NZ_CP015212	Rhodobacter sphaeroides strain MBTLJ-13 plasmid a, complete sequence	36199-36220	2	0.909
NZ_CP013376_2	2.3\|3372082\|22\|NZ_CP013376\|CRISPRCasFinder	3372082-3372103	22	NZ_CP015212	Rhodobacter sphaeroides strain MBTLJ-13 plasmid a, complete sequence	145343-145364	2	0.909
NZ_CP013376_2	2.3\|3372082\|22\|NZ_CP013376\|CRISPRCasFinder	3372082-3372103	22	NZ_CP025513	Neorhizobium sp. SOG26 plasmid unnamed2, complete sequence	515843-515864	3	0.864
NZ_CP013376_1	1.1\|1685929\|26\|NZ_CP013376\|CRISPRCasFinder	1685929-1685954	26	NZ_CP039913	Agrobacterium tumefaciens strain CFBP6625 plasmid pAtCFBP6625b, complete sequence	46484-46509	4	0.846
NZ_CP013376_1	1.1\|1685929\|26\|NZ_CP013376\|CRISPRCasFinder	1685929-1685954	26	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	357604-357629	5	0.808
NZ_CP013376_1	1.1\|1685929\|26\|NZ_CP013376\|CRISPRCasFinder	1685929-1685954	26	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	489674-489699	5	0.808
NZ_CP013376_1	1.1\|1685929\|26\|NZ_CP013376\|CRISPRCasFinder	1685929-1685954	26	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	222031-222056	5	0.808
NZ_CP013376_1	1.1\|1685929\|26\|NZ_CP013376\|CRISPRCasFinder	1685929-1685954	26	NC_014811	Mycolicibacterium gilvum Spyr1 plasmid pMSPYR101, complete sequence	8407-8432	6	0.769
NZ_CP013376_2	2.2\|3372022\|34\|NZ_CP013376\|CRISPRCasFinder	3372022-3372055	34	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	350060-350093	8	0.765

1. spacer 2.3|3372082|22|NZ_CP013376|CRISPRCasFinder matches to CP047036 (Rhodobacter sphaeroides strain DSM 158 plasmid pDx, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

2. spacer 2.3|3372082|22|NZ_CP013376|CRISPRCasFinder matches to NZ_CP047042 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pDx, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

3. spacer 2.3|3372082|22|NZ_CP013376|CRISPRCasFinder matches to NZ_CP047900 (Pseudarthrobacter sp. YJ56 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
ggcgccgccgatcgccgagccg	Protospacer
*************.*******

4. spacer 2.3|3372082|22|NZ_CP013376|CRISPRCasFinder matches to NZ_CP051473 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10DE, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

5. spacer 2.3|3372082|22|NZ_CP013376|CRISPRCasFinder matches to NZ_CP051473 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10DE, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

6. spacer 2.3|3372082|22|NZ_CP013376|CRISPRCasFinder matches to NZ_CP030276 (Rhodobacter sphaeroides 2.4.1 plasmid pDE, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

7. spacer 2.3|3372082|22|NZ_CP013376|CRISPRCasFinder matches to NZ_CP030276 (Rhodobacter sphaeroides 2.4.1 plasmid pDE, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

8. spacer 2.3|3372082|22|NZ_CP013376|CRISPRCasFinder matches to NZ_CP015289 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid a, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

9. spacer 2.3|3372082|22|NZ_CP013376|CRISPRCasFinder matches to NZ_CP015289 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid a, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

10. spacer 2.3|3372082|22|NZ_CP013376|CRISPRCasFinder matches to NZ_CP022195 (Yangia pacifica strain YSBP01 plasmid unnamed5, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
ggcgccgccgctcaccgagccg	Protospacer
********** **********

11. spacer 2.3|3372082|22|NZ_CP013376|CRISPRCasFinder matches to NC_013858 (Azospirillum sp. B510 plasmid pAB510d, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
ggcgccgccgatcaccgtgccg	Protospacer
***************** ***

12. spacer 2.3|3372082|22|NZ_CP013376|CRISPRCasFinder matches to NZ_CP015212 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid a, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

13. spacer 2.3|3372082|22|NZ_CP013376|CRISPRCasFinder matches to NZ_CP015212 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid a, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

14. spacer 2.3|3372082|22|NZ_CP013376|CRISPRCasFinder matches to NZ_CP025513 (Neorhizobium sp. SOG26 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.864

ggcgccgccgatcaccgagccc	CRISPR spacer
ggcgccgccgatcaccgagttg	Protospacer
*******************..

15. spacer 1.1|1685929|26|NZ_CP013376|CRISPRCasFinder matches to NZ_CP039913 (Agrobacterium tumefaciens strain CFBP6625 plasmid pAtCFBP6625b, complete sequence) position: , mismatch: 4, identity: 0.846

tgggcgggcagggcgcgtgtgttgct	CRISPR spacer
aaggcgggcagggcacgtgtgttgcc	Protospacer
 .************.**********.

16. spacer 1.1|1685929|26|NZ_CP013376|CRISPRCasFinder matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 5, identity: 0.808

tgggcgggcagggcgcgtgtgttgct	CRISPR spacer
ggggcgggcagggggcgtgcgttggc	Protospacer
 ************ *****.**** .

17. spacer 1.1|1685929|26|NZ_CP013376|CRISPRCasFinder matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 5, identity: 0.808

tgggcgggcagggcgcgtgtgttgct	CRISPR spacer
ggggcgggcagggggcgggtgttggc	Protospacer
 ************ *** ****** .

18. spacer 1.1|1685929|26|NZ_CP013376|CRISPRCasFinder matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.808

tgggcgggcagggcgcgtgtgttgct	CRISPR spacer
ggggcgggcagggggcgggtgttggc	Protospacer
 ************ *** ****** .

19. spacer 1.1|1685929|26|NZ_CP013376|CRISPRCasFinder matches to NC_014811 (Mycolicibacterium gilvum Spyr1 plasmid pMSPYR101, complete sequence) position: , mismatch: 6, identity: 0.769

tgggcgggcagggcgcgtgtgttgct	CRISPR spacer
gcggcgggcagggcgcgtgtgcgtgt	Protospacer
  *******************.   *

20. spacer 2.2|3372022|34|NZ_CP013376|CRISPRCasFinder matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 8, identity: 0.765

gatcgcgccggtgcgctcgcgacgg-----ttcgacgtc	CRISPR spacer
catcgcgcgggtgcgctcgcggcggcggccttcg-----	Protospacer
 ******* ************.***     ****

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1735239 : 1818349

Enterobacteria_phage(20.0%)

transposase,plate,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069254525.1\|1735239_1736646_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_069254526.1\|1736661_1737984_+	DotU family type VI secretion system protein	NA	NA	NA	NA
WP_069254527.1\|1737985_1741615_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_104768556.1\|1741596_1742295_+	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_069254528.1\|1742370_1744743_+	protein kinase	S4VYW6	Pandoravirus	7.3e-07	26.7
WP_081078301.1\|1744729_1745854_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_060324697.1\|1745927_1746482_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_048024664.1\|1746474_1747983_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_027791618.1\|1748054_1748546_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_059650667.1\|1748562_1749111_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_060055671.1\|1749115_1750987_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_069254529.1\|1750983_1752078_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_069254530.1\|1752090_1754751_+	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	1.0e-78	30.9
WP_069254531.1\|1754747_1756952_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	4.8e-45	28.8
WP_069254532.1\|1756967_1758233_+	hypothetical protein	NA	NA	NA	NA
WP_081332344.1\|1758245_1762886_+	hypothetical protein	A0A2H4JHK7	uncultured_Caudovirales_phage	4.0e-25	49.6
WP_059586690.1\|1763085_1764576_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_069254534.1\|1764895_1765954_-	hypothetical protein	NA	NA	NA	NA
WP_042974993.1\|1766031_1766292_-	hypothetical protein	NA	NA	NA	NA
WP_069254535.1\|1766820_1771095_-	DUF4132 domain-containing protein	NA	NA	NA	NA
WP_069254536.1\|1771263_1773501_-	hypothetical protein	Q9EYF6	Enterobacteria_phage	6.7e-79	33.3
WP_021158780.1\|1773497_1774622_-	VWA domain-containing protein	Q9EYF7	Enterobacteria_phage	1.3e-118	71.1
WP_069254537.1\|1774722_1777218_-	hypothetical protein	NA	NA	NA	NA
WP_155771166.1\|1777228_1777387_-	hypothetical protein	NA	NA	NA	NA
WP_069254538.1\|1777395_1778502_-	AAA domain-containing protein	NA	NA	NA	NA
WP_059484897.1\|1779064_1780039_-	nitronate monooxygenase	NA	NA	NA	NA
WP_069254539.1\|1780373_1781366_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_060056204.1\|1781552_1782131_+	hypothetical protein	NA	NA	NA	NA
WP_069254540.1\|1782418_1783615_+	porin	NA	NA	NA	NA
WP_042974287.1\|1783999_1784491_+	peptidoglycan-associated lipoprotein Pal	NA	NA	NA	NA
WP_069254541.1\|1784641_1785106_-	hypothetical protein	NA	NA	NA	NA
WP_069254542.1\|1785562_1786822_-	cytochrome c	NA	NA	NA	NA
WP_069254543.1\|1786818_1787526_-	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_048024633.1\|1787522_1790399_-	xanthine dehydrogenase family protein molybdopterin-binding subunit	NA	NA	NA	NA
WP_069255170.1\|1790911_1792462_+	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	3.4e-21	37.4
WP_027791638.1\|1792705_1792981_+	hypothetical protein	NA	NA	NA	NA
WP_059484890.1\|1793223_1794264_+	deacylase	NA	NA	NA	NA
WP_048024629.1\|1794367_1794664_+	type II toxin-antitoxin system MqsR family toxin	NA	NA	NA	NA
WP_059861535.1\|1794666_1795068_+	type II toxin-antitoxin system MqsA family antitoxin	NA	NA	NA	NA
WP_060226132.1\|1795385_1795946_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_021158756.1\|1796002_1796950_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_069254544.1\|1797018_1798068_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_069254545.1\|1798075_1799428_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_081076770.1\|1799498_1801286_+	amino acid ABC transporter permease/ATP-binding protein	G9BWD6	Planktothrix_phage	8.7e-29	37.0
WP_048024621.1\|1801320_1802253_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_048024619.1\|1802358_1803453_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_060324644.1\|1803505_1804585_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_059492203.1\|1804771_1805689_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_021162132.1\|1805685_1806117_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_155771201.1\|1806648_1808124_+	exo-alpha-sialidase	NA	NA	NA	NA
WP_048024611.1\|1808188_1809217_-	alcohol dehydrogenase AdhP	A0A2K9L7I1	Tupanvirus	1.6e-30	27.9
WP_069254547.1\|1809688_1811716_+	TonB-dependent receptor	NA	NA	NA	NA
WP_081332345.1\|1812184_1813804_+	HAMP domain-containing protein	NA	NA	NA	NA
WP_021162139.1\|1814402_1815809_+	alpha,alpha-trehalose-phosphate synthase (UDP-forming)	NA	NA	NA	NA
WP_048024606.1\|1815816_1816284_-	peroxiredoxin	NA	NA	NA	NA
WP_059588827.1\|1816366_1818349_-\|protease	ATP-dependent zinc metalloprotease FtsH	E5EQU5	Bathycoccus_sp._RCC1105_virus	2.9e-102	42.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP013375

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013375_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013375_1

1572227-1572416

Orphan

Consensus_repeat	Method
CGTGGGCGGCCTCGTCGGCGACAAC	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP013375_1

>merge|NZ_CP013375|1|1572227-1572416|PILER-CR
CGTGGGCGGCCTCGTCGGCCACAACGCGGGCCGGGTGGACGCATCGACGTTCAAGGGCATCGTCGCGGCGACCGACGGCGCGCGTGTGGGTGGCCTCGTCGGCGAAAACCGCGGCGTCGTGCATGCGTCGACGGCAGTCGGCAGGGTAATGGGCGGCGCGTCGAACGTCGGCGGCCTCGTCGGCGCCAAC

>NZ_CP013375|1|1|1572227-1572416|PILER-CR
CGTGGGCGGCCTCGTCGGCCACAAC	GCGGGCCGGGTGGACGCATCGACGTTCAAGGGCATCGTCGCGGCGACCGACGGCGCGCG
TGTGGGTGGCCTCGTCGGCGAAAAC	CGCGGCGTCGTGCATGCGTCGACGGCAGTCGGCAGGGTAATGGGCGGCGCGTCGAA
CGTCGGCGGCCTCGTCGGCGCCAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013375.1\|WP_060074688.1\|1559741_1560992_+\|YbfB/YjiJ-family-MFS-transporter	unknown	unknown	gnl\|CDD\|340869
NZ_CP013375.1\|WP_059706713.1\|1577820_1578525_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213191
NZ_CP013375.1\|WP_048025939.1\|1580085_1580904_-\|5-deoxy-glucuronate-isomerase	unknown	unknown	gnl\|CDD\|226241
NZ_CP013375.1\|WP_069253410.1\|1566525_1569600_+\|filamentous-hemagglutinin-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|214908
NZ_CP013375.1\|WP_059486871.1\|1558702_1559617_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176133
NZ_CP013375.1\|WP_042973137.1\|1554375_1555596_-\|CoA-transferase	unknown	unknown	gnl\|CDD\|224717
NZ_CP013375.1\|WP_021162379.1\|1580947_1581877_-\|myo-inosose-2-dehydratase	unknown	unknown	gnl\|CDD\|275172
NZ_CP013375.1\|WP_069253911.1\|1561393_1563034_+\|ShlB/FhaC/HecB-family-hemolysin-secretion/activation-protein	unknown	unknown	gnl\|CDD\|225387
NZ_CP013375.1\|WP_021162382.1\|1578709_1579456_+\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|187620
NZ_CP013375.1\|WP_059486866.1\|1553730_1554285_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|369095
NZ_CP013375.1\|WP_069253412.1\|1574917_1575853_+\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119324
NZ_CP013375.1\|WP_059863512.1\|1577071_1577824_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213186
NZ_CP013375.1\|WP_021157113.1\|1574470_1574908_+\|acyl-CoA-thioesterase	unknown	unknown	gnl\|CDD\|223894
NZ_CP013375.1\|WP_069253408.1\|1555845_1558470_+\|alanine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234701
NZ_CP013375.1\|WP_027787758.1\|1551388_1553098_-\|glutamine--tRNA-ligase/YqeY-domain-fusion-protein	unknown	unknown	gnl\|CDD\|235424
NZ_CP013375.1\|WP_069253413.1\|1575845_1577075_+\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119323
NZ_CP013375.1\|WP_069253409.1\|1563098_1566245_+\|filamentous-hemagglutinin-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|214908
NZ_CP013375.1\|WP_059497824.1\|1573794_1574331_+\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|225373
NZ_CP013375.1\|WP_059497814.1\|1579508_1580003_-\|heme-degrading-domain-containing-protein	unknown	unknown	gnl\|CDD\|179430
NZ_CP013375.1\|WP_011351716.1\|1553342_1553552_+\|ornithine-acetyltransferase	unknown	unknown	gnl\|CDD\|274783

Protein	Function_ID	Function_description	E-value
NZ_CP013375.1\|WP_060074688.1\|1559741_1560992_+\|YbfB/YjiJ-family-MFS-transporter	gnl\|CDD\|340869	cd06180, MFS_YjiJ, Uncharacterized protein YjiJ and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Escherichia coli YjiJ and other uncharacterized proteins. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	9.56012e-67
NZ_CP013375.1\|WP_059706713.1\|1577820_1578525_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213191	cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter. LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids. The E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.	1.51119e-83
NZ_CP013375.1\|WP_048025939.1\|1580085_1580904_-\|5-deoxy-glucuronate-isomerase	gnl\|CDD\|226241	COG3718, IolB, Uncharacterized enzyme involved in inositol metabolism [Carbohydrate transport and metabolism].	4.32946e-152
NZ_CP013375.1\|WP_069253410.1\|1566525_1569600_+\|filamentous-hemagglutinin-N-terminal-domain-containing-protein	gnl\|CDD\|214908	smart00912, Haemagg_act, haemagglutination activity domain. This domain is suggested to be a carbohydrate- dependent haemagglutination activity site. It is found in a range of haemagglutinins and haemolysins.	4.80692e-22
NZ_CP013375.1\|WP_059486871.1\|1558702_1559617_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176133	cd08442, PBP2_YofA_SoxR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.53598e-73
NZ_CP013375.1\|WP_042973137.1\|1554375_1555596_-\|CoA-transferase	gnl\|CDD\|224717	COG1804, CaiB, Predicted acyl-CoA transferases/carnitine dehydratase [Energy production and conversion].	4.46812e-174
NZ_CP013375.1\|WP_021162379.1\|1580947_1581877_-\|myo-inosose-2-dehydratase	gnl\|CDD\|275172	TIGR04379, myo-inositol_catabolism_protein, myo-inosose-2 dehydratase. Members of this family include the enzyme myo-inosose-2 dehydratase, product of the gene iolE, as found in inositol utilization cassettes in many species. [Energy metabolism, Sugars].	2.27692e-151
NZ_CP013375.1\|WP_069253911.1\|1561393_1563034_+\|ShlB/FhaC/HecB-family-hemolysin-secretion/activation-protein	gnl\|CDD\|225387	COG2831, FhaC, Hemolysin activation/secretion protein [Intracellular trafficking and secretion].	2.13399e-110
NZ_CP013375.1\|WP_021162382.1\|1578709_1579456_+\|glucose-1-dehydrogenase	gnl\|CDD\|187620	cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs. 1,3,6,8-tetrahydroxynaphthalene reductase (4HNR) of Magnaporthe grisea and the related 1,3,8-trihydroxynaphthalene reductase (3HNR) are typical members of the SDR family containing the canonical glycine rich NAD(P)-binding site and active site tetrad, and function in fungal melanin biosynthesis. This subgroup also includes an SDR from Norway spruce that may function to protect against both biotic and abitoic stress. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	2.1385e-91
NZ_CP013375.1\|WP_059486866.1\|1553730_1554285_+\|alpha/beta-hydrolase	gnl\|CDD\|369095	pfam06821, Ser_hydrolase, Serine hydrolase. Members of this family have serine hydrolase activity. They contain a conserved serine hydrolase motif, GXSXG/A, where the serine is a putative nucleophile. This family has an alpha-beta hydrolase fold. Eukaryotic members of this family have a conserved LXCXE motif, which binds to retinoblastomas. This motif is absent from prokaryotic members of this family.	1.62448e-55
NZ_CP013375.1\|WP_069253412.1\|1574917_1575853_+\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119324	cd06582, TM_PBP1_LivH_like, Transmembrane subunit (TM) of Escherichia coli LivH and related proteins. LivH is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivH forms a heterodimer with another TM, LivM, to generate the transmembrane pore. LivM is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	3.12596e-53
NZ_CP013375.1\|WP_059863512.1\|1577071_1577824_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213186	cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system. The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).	4.26701e-91
NZ_CP013375.1\|WP_021157113.1\|1574470_1574908_+\|acyl-CoA-thioesterase	gnl\|CDD\|223894	COG0824, FcbC, Predicted thioesterase [General function prediction only].	5.28701e-31
NZ_CP013375.1\|WP_069253408.1\|1555845_1558470_+\|alanine--tRNA-ligase	gnl\|CDD\|234701	PRK00252, alaS, alanyl-tRNA synthetase; Reviewed.	0
NZ_CP013375.1\|WP_027787758.1\|1551388_1553098_-\|glutamine--tRNA-ligase/YqeY-domain-fusion-protein	gnl\|CDD\|235424	PRK05347, PRK05347, glutaminyl-tRNA synthetase; Provisional.	0
NZ_CP013375.1\|WP_069253413.1\|1575845_1577075_+\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119323	cd06581, TM_PBP1_LivM_like, Transmembrane subunit (TM) of Escherichia coli LivM and related proteins. LivM is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivM forms a heterodimer with another TM, LivH, to generate the transmembrane pore. LivH is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	2.24332e-52
NZ_CP013375.1\|WP_069253409.1\|1563098_1566245_+\|filamentous-hemagglutinin-N-terminal-domain-containing-protein	gnl\|CDD\|214908	smart00912, Haemagg_act, haemagglutination activity domain. This domain is suggested to be a carbohydrate- dependent haemagglutination activity site. It is found in a range of haemagglutinins and haemolysins.	5.9546e-22
NZ_CP013375.1\|WP_059497824.1\|1573794_1574331_+\|NUDIX-domain-containing-protein	gnl\|CDD\|225373	COG2816, NPY1, NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair].	8.84335e-28
NZ_CP013375.1\|WP_059497814.1\|1579508_1580003_-\|heme-degrading-domain-containing-protein	gnl\|CDD\|179430	PRK02487, PRK02487, heme-degrading domain-containing protein.	7.88385e-77
NZ_CP013375.1\|WP_011351716.1\|1553342_1553552_+\|ornithine-acetyltransferase	gnl\|CDD\|274783	TIGR03789, pdsO, proteobacterial sortase system peptidoglycan-associated protein. A newly defined histidine kinase (TIGR03785) and response regulator (TIGR03787) gene pair occurs exclusively in Proteobacteria, mostly of marine origin, nearly all of which contain a subfamily 6 sortase (TIGR03784) and its single dedicated target protein (TIGR03788) adjacent to to the sortase. This protein family shows up in only in those species with the histidine kinase/response regulator gene pair, and often adjacent to that pair. It belongs to the pfam00691 domain family, which is the peptidoglycan-associated region of flagellar motor protein MotB, OmpA (whose N-terminal region forms an outer membrane beta barrel), and peptidoglycan-associated lipoprotein Pal. Its function is unknown. We assign the gene symbol pdsO, for Proteobacterial Dedicated Sortase system OmpA family protein. [Protein fate, Protein and peptide secretion and trafficking].	0.000878755

>NZ_CP013375.1|WP_069253410.1|1566525_1569600_+|filamentous-hemagglutinin-N-terminal-domain-containing-protein
MNKAYSLVWNEAQGGWCAVSETARRHGKTGGGKRLLAAGVSLLGLAATSAYALPTGGAVASGKADIATSADGKMMSINQHTDKLITNWQDFSVAGGERVSFQQPDVKSIALNRVIGTNGSQIHGQIDANGKVFVVNPNGVVFGAGAQVNVGGLVASTKNISDADFLAGNYRFSGASGQSVENAGTIEAAKGGSVALLGARVSNTGVIRAKAGRVALGAGNAFTVNFDGNGLLNLQVEGGAMDAQAHNGGLLSAEGGEVLMTARAANGLLNAVVNNSGTIEAQGLKEREGKIVLDGGLVQVAGKLNAAGGDVTTRGEQVKVAVDTQVDTRSSSGRTGTWTIESANANVDGADAAIGAATLSRALGTTNVALTNTSGDLTVDGAVNWTSDHALALTSQKGDVALKRAVAASGAKASVKANAAGEIRVDDKLALTGDQAHLELNAKKGHRFTQDNASATLSGRNASFSSNGEGYQVIHDVADLRNVDLDLNGRYVLGNAIDGRGAAFRSIGANSAFEGVFDGLGNTVSRLKVNNSGSSVGLFAENRGRIANLALDSIAVNGASTSIKSSMTIGGLAGANRGGTISNVRATRMSISSSGTGYSVAGGLVGENNAGVIDGARFQGSITGNDRTVNIGGIAGTNASSRIVNSRADAEIRNVRSPSSTMTNLVGGIAGLSWDSTISDSSSTGRITVGNAMYAGGLVGHAVGGAIDRSNSSMAVSAGQAGMVGGAVGSNVYTALSNVSASGNVSATSGADVGGLVGRSDYATILASSASGNVSATAGSRVGGFIGTNANSRISQSHATGNVTGNGSAATGGFAGVNDGGSMLADVSAKGRTADAGRGIVGGLVGQNAGAILHGDAYGDVSAGDASSIGGLVGTNRGSVVSSSSTSNVVSLRGSYAGGLIGENRGKQAVVSSSTAGGTVTATGGQYAGGFVGANDGLIDGSDSSGTVYAAGTYVGGFAGQNSGTIRSSRTSSKIDYPAQARPVFTAGFAGLNTGSIESSQATGAASKEPFVAFNIGMIDGKSW
>NZ_CP013375.1|WP_069253409.1|1563098_1566245_+|filamentous-hemagglutinin-N-terminal-domain-containing-protein
MNKAYSLVWNDVQGGWCAVSETARRRGKTGSGKRLLAAGVSLLGLAATSAYALPTGGAVASGKADIATSADGKTMSINQHTDKLITNWQDFSVAGGERVSFKQPDVKSIALNRVIGTNGSQIHGQIDANGKVFVVNPNGVVFGAGAQVNVGGLVASTKDISDKDFLAGTYRFSGTSGQSVENAGTIAATEGGSVALLGARVSNTGVIRAKAGRVALGAGDAFTVNFDGNGLLNLQVEGGAMGAQAHNGGLLSAEGGEVLMTARAANGLLNAVVNNSGPIEAQGLKERNGKIVLDGGLVQVAGKLNAAGGDVTTRGEQVKVAGDTQVDTRSSSGRTGTWTIESANASVANADAALDAATLSRTLATTNVALTNTSGDLTVDGAVNWTSDHTLALTSQKGDVALKRAVAASGAKASVKANAAGEIRVDDKLALTGDQAHLELNAKKGYRFTQDKASATLSGRNASFSSNGEGYQVIHDVAGLRNVDRDLNGRYVLGNAIDGKGVAFQSIGANSAFEGVFDGLGNTVSRLNVTGFAPSIGLFSENKGRIANLELDSLIVNNQANVRNSQVGGLAGVNRGTISNVRAAGMTVSSTSPIRGESVVGGLVGVNDHGVIDGARFQGRISGNEKATTIGGIAGNSVGGARIANSHADAEITSKDASATGLYMLGGLVGMNLESTVSNSSSGGKLSAGVNAVAGGLVGYSAGGAIDHSTSSMAVSAGKDAAVGGAVGWNAGADLSNVSAIGNVSATSGATIGGLVGGNEGNVRDSWASGTVTAAAGSTIGGFVGSNDNGAISGSHASGNVSGNGAAAVGGFAGNNAGGVLADVSSQGRVTGAASERVGGLAGANTGTIRQAVAAGDVSAGNASKVGGLVAINDGKIEDSRSSGTVRGGLDNTIGGLVGENNGTIASSSSTSNVAAGSGSYVGGLVGFNKGIDAVVSGSKAFGNVTVANGLAIGGFVGWNYGTIADSESSGTVTSTATIGGGFAGGNSGTIRLSRTSSKFDYPAQARPSLYGGFVGINTGSIKSSETTGAAASERFAGMNRGIVEAKR
>NZ_CP013375.1|WP_069253911.1|1561393_1563034_+|ShlB/FhaC/HecB-family-hemolysin-secretion/activation-protein
MCLSLLWGAGVAGVPGQAHAQVPNAGATMRDVETSRPALPPKAAPDLEIVPSESAAQPQPDAGPRIAVRAFQIGGNTVFDTATLQALVAGLAGDALTFADLQGAAERITAYYRERGYVLARAYLPKQDIEDGVVRIEVAEGRYGKIEIRNHSRALDAVLRQPLAALHPGDVVRGSSLERSLLLLDDLAGVGARGTLRPGEVPGTTDLVVDAERGPPASGSLEFDNFGGVSTGRYRVSGSVDVNAPLRLGDRLSLRGLVSDERQRYYRAAYQVPVGPASTRVGVAYSSLRYRVAGRFSDLEMSGRASVQTVYVAQPLVRARDLSVTAQVQYENKNLHDTYGTFSRQNDKNVGLWTFGLSGNSQDGWLGGGRNGFSVMFGVGRLRSNDVFESNPLSKSIGGFKKLNVDAQRIQALGGRFQLYGQVSAQFASRNLDSSEKFSLGGPYGVRAYALGEGSGDQGWQASAELRYLAAPGWQVSMFVDAGAVQLNRHPWTGERNTQHMQAAGIGATWFGAKRQVSLTAALPLGRGGDSPTRAPSVWVQAAQYF
>NZ_CP013375.1|WP_060074688.1|1559741_1560992_+|YbfB/YjiJ-family-MFS-transporter
MSRTDAPSAAAGAPSVDDTDRRARAVALACMVGLAIVLGVGRFAFTPLLPLMLADGSIGLKAGGWLASANYAGYFVGAVSCAALRVAPARMVRVGLVATVLLTAAMGVGHLLPVWLAVRFVAGVVSAWTFVFMSQWGLRRLAELVAPEWSGVIYAGPGVGIVVTGLIGSALAGQRAASGWLGFAALSAVLSVAIWRTFGSAPVSAAMPPAVTARHAATVAAPHDARRHRADAAWLVVLYGMPGFGYIITATFLPVIARAALPAGSPWPDLFWPMFGAALIVGAVSASRLPGHWDNRLLLAAGCATQALGIAAGIVWPNAAGFSVGSLLLGLPFTAITLFAMREARRLHGERAAGLMGYATASYGVGQIAGPLVAAPLVARYGSFTPALWIAAAALLAGAAGFVAMTAVAGAHRRRA
>NZ_CP013375.1|WP_059486871.1|1558702_1559617_-|LysR-family-transcriptional-regulator
MDLAALAIFRAVVRENGVTRAAAKLNRVQSNVTTRIKQLEEELGAALFVRDGRRLVLTPAGHTLLPYAERLLALADEARDAVREDTPRGRLRLGTMESTAASRLPTVLARYHHAWPDVSLELVTGTTGWLIERVRDFEIDAALFARPPAPDTLPDTFETVPIFREDLVLLTPRGHPPVRTPRDVILPTLIAFERGCTYRKYVEQWYAAHGVKPARVLELGSYHAIVACVAAGAGVAVAPRSVLDLQPETGNIAAHVIPELEGIDTLLAWRQGYASAALAALRDALGEAERQQDAVQKAHVALPA
>NZ_CP013375.1|WP_069253408.1|1555845_1558470_+|alanine--tRNA-ligase
MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDPRPYSRATTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIKFAWELLTTVYQLPKDKLWVTVYQEDDEAYDIWAKEVGVPTERIIRIGDNKGARYASDNFWTMGDTGPCGPCTEIFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKQSVDTGMGLERLAAVLQHVHSNYEIDLFQNLIKAAARVTEISDLTNNSLKVIADHIRACSFLIVDGVIPGNEGRGYVLRRIVRRAIRHGYKLGRKGAFFHKLVADLVAEMGVAYPELKEAEQRVTDVLRQEEERFFETIEHGMSILEAALADVEAKGGKVLDGELAFKLHDTYGFPLDLTADVCRERGMTVDEPAFDDAMARQREQARAAGKFKATQGLEYTGAKTTFHGYEEIAFDDAKIVALYVDGSSVNEVKAGQDAVVVLDHTPFYAESGGQVGDQGVLANAATRFAVADTLKVQADVIGHHGTLEQGTLKVGDVLRAEIDAHRRARTQRNHSATHLMHKALREVLGAHVQQKGSLVDAEKTRFDFAHNAPMTDDEIRRVEQIVNDEILANAPGIVRVMPYDEAVKGGAMALFGEKYGDEVRVLDLGFSRELCGGTHVHRTGDIGLFKIVVEGGVAAGIRRVEAITGDNALRYVQELDARVNEAAAALKAQPSELTQRIAQVQDQVKSLEKELGALKSKLASSQGDELAQQAVEIGGVYVLAATLDGADAKTLRETVDKLKDKLKNAAIVLAAVEGGKVSLIAGVTPDASKKVKAGELVNFVAQQVGGKGGGRPDMAQAGGTEPANLPGALAGVKGWVEERL
>NZ_CP013375.1|WP_042973137.1|1554375_1555596_-|CoA-transferase
MGALSHIRVLDLTRVLAGPWCAQTLADFGADVIKVERPGAGDDTRHWGPPYLKDADGADTAEAAYYLAANRNKRSVTVDIATPEGQQIVRELAAQSDVVLENYKVGQLKKYGLDYESLRTVKPDLVYCSVTGFGQTGPYAHRAGYDFIVQGIGGFMSITGERDGEPGGGPQKAGVAIADLATGLYSTIAVLAALTHRDRTGEGQYIDMALLDVQVALLANMNTNFLASGKPPVRWGNAHPNIVPYQTFQTSDGWIIVAVGNDGQFRKFVEAGGRPELADDERFATNPSRVRHRDTLVPILAEMVKARGKADWIDVLEAAGVPCGPINDLDEVFDNEQVVARGMQVSLPHPSGANAKLVRNPIRMSVTPPDARTAPPLLGAQTDDVLRDMLGYDDAKIARLRAKQAI
>NZ_CP013375.1|WP_059486866.1|1553730_1554285_+|alpha/beta-hydrolase
MSSFPVLVLPGYANSGPLHWQSRWERADARFSRVAMPDWDRAFRNGWCLALDRAVEAARGPVLIAGHSLGTLTTAWWATRYARPAALAKVRGALLVALPDPGGPAFPADAHGFGPVPLERLPFPTCVVASSDDPYGSSAFARRCANAWGSAFHDIGPRGHINADSGLGDWPEARGWLDALARRG
>NZ_CP013375.1|WP_011351716.1|1553342_1553552_+|ornithine-acetyltransferase
MMKKTTFIVRTAVIVAALSQLGACAMTHTQRNAGIGAAAGGALGYLVTGGPLGTVAGAAAGGIVGANVR
>NZ_CP013375.1|WP_027787758.1|1551388_1553098_-|glutamine--tRNA-ligase/YqeY-domain-fusion-protein
MSTERNDAPAASNFIRNIIDDDNRTGKWGGRVETRFPPEPNGYLHIGHAKSICLNFSVARDYGGVCHLRFDDTNPEKESVEYVDSIVDAVRWLGFDWRKDAVDHQYFASDYYDKLYEFAELLIQRGKAYVDSQSAEEMRANRGSLTEGGKPSPFRDRTPEENLDLFRRMKAGEFKEGEHVLRAKIDMASPNMNMRDPVIYRIRYAHHYRTGDAWCVYPMYDYTHCISDALEGITHSLCTLEFEDHRPLYDWVLNELAEAGMFTRPLPQQIEFSRLNLTYAITSKRKLLQLVTEGHVDGWDDPRMPTIVGVRRRGFTPESIHLFCERIGVTKIDSWIDMSIFEGALRDDLDDKAARTVAVLDPLKLVIDNYPEDLEEACTAPVHPHHPDRGVRTFPISRELWIEREDFVENPPKGYFRLFPGNKVRLRYGYVIECTGFDKDADGNVTAVHCNYFPDSKSGTEGANNYKVKGNIHWVSAKHAQPAEVRIYDRLFKEPHPDAGGANFLEALNPDSKKIVQAYVEPGNSDIAPETRVQFERHGYFVADRVDSKPGKPVFNRIVGLRDSWGKPA
>NZ_CP013375.1|WP_059497824.1|1573794_1574331_+|NUDIX-domain-containing-protein
MTTADYRFCPRCASPLTERADPDHEGGRIRQACPDGTCGYVHWNNPLPVVAAIVELDGKILLARNAAWPEGMFALITGFLENGETPEDGIAREVFEETGLKAEHVSLVGVYEFIRKNELIIAYHVRASGTVVLSPELLEYKLVDPPLLRPWRAGTGVALADWMRARGLDFEFVDRPGQ
>NZ_CP013375.1|WP_021157113.1|1574470_1574908_+|acyl-CoA-thioesterase
MSDKPQPRPRDAYRHFLPITTRWMDNDVYGHVNNVVYYSYFDTVVNEYLIRAGVLDVEHGQTIGLVVETQCNYFAPLVFPQSVDAGLRVVKLGTSSVRYEVGLFAQGDAAPAAQGHFVHVYVDRGTRRPVPLPDALRAALEPLTA
>NZ_CP013375.1|WP_069253412.1|1574917_1575853_+|branched-chain-amino-acid-ABC-transporter-permease
MHALALQVFNGLSYGLLLFMLSAGLTLIFSVQGVLNFAHASFYMLGAYVGYSIAAQAGFWPALVLAPLAVGLLGAGCERALLRRVQAHGHTNELLLTFGLAYLIGEGAKLVWGLAPLPAPVPPLFDGAPVSVFGLALPRYRLFMMAMSATMLVALGALLRVSRIGLVVRAALTHRAAVEALGYDVPRVMTGLFGAGTALAALAGVIGAPLAVIEPALAETVGSVVFAVVVIGGLGSLGGAFVASLAVGFAQTFAAASDTSLRDLASWTGIVLPDSVAAVSIAQLAPLVPYLLLVAVLVARPRGLFGERVDA
>NZ_CP013375.1|WP_069253413.1|1575845_1577075_+|branched-chain-amino-acid-ABC-transporter-permease
MRSRVLAGCTRWALFAACFVLPAWLWPHGAVLGYLAQTAALVVLALSYNLQLGTTGLLSFGHAAFAGLGAFAAAHWFNHMGGPLPLLPLVGGVAGAGFGFVAGLLATRRSGTAFAMITLGLGECVAAAAWSVPAWFGGLGGVPIDRAGGTPWGGWQFGAPTHAYAVIAAWCVASAWAMHALTHTPLARLANAVRDNPARVAALGTDPRRVRLAMVTCASFFAGIAGTLTLIDVELATPDSVSMARSATVLIATVIGGTGAFFGPAAGAAVLTALSVVVAGVSRAWALYLGVLFVVIVVAAPRGIAGIAQAVAHALRRGAPGAERWRLLCGIGACVFWGVAVVCAAELGYAWRFALDDGSGLAFGAWGIDADTPAGWAVACSAAGIGALLWGWRARFAQGARPGKREDRR
>NZ_CP013375.1|WP_059863512.1|1577071_1577824_+|ABC-transporter-ATP-binding-protein
MNGNAIALHGVVQRFGAQTVLDGVELSIAAGERHALIGPNGAGKSTLFGVIAGATRPTRGQVVLHGVDLRGRGPVVASRLGIGRSFQQTSAFARLTVFDNLRCAALHAPAERRRWWNRLRESASVDLAAARVLHDIGLDARRGALAAELSYAEQRALDLGIALASGARTLLLDEPTAGMSREQAARMIALIRATTQGRTVLMIEHDMDAVFGFAERITVLVRGAVVATGAPDAIRADSRVRAAYLGEGRA
>NZ_CP013375.1|WP_059706713.1|1577820_1578525_+|ABC-transporter-ATP-binding-protein
MSALLDIRGLRAWYGLQPVLDGVDLALAPGETLALLGRNGSGRSTLAKAVLGLVRTAGSVRIAGAECAGARTFEIARRGVAYVAESRDVFPLLTVRDNLRLGLRGAGGAAERAALERLFDRFPLLAARADVKAGRLSGGEQQVLALVRALAGRPRVLIVDEPAEGLAPLAVDEVGACLAALQADGVAILLIEQRLQFAPRLARRVAVMGRGRIVYDGALDGLGGEVADAWLSAG
>NZ_CP013375.1|WP_021162382.1|1578709_1579456_+|glucose-1-dehydrogenase
MSKLAGKVAIVTGGSKGIGAAIAKALAAEGASVVVNYASSKAGADAVVGAIVEAGGRAVAVGGDVSKAADAQRIVDTAIDTYGRLDVLVNNSGVYEFAPIEAITEEHYRRQFDTNVFGVLLTTQAAVKHLGEGASIINISSVVTSITPPASAVYSGTKGAVDAITGVLALELGPRKIRVNAINPGMIVTEGTHSAGIIGSDLDKQVRSETPLGRLGEPDDIASVAVFLASDDARWMTGEHLVVSGGLN
>NZ_CP013375.1|WP_059497814.1|1579508_1580003_-|heme-degrading-domain-containing-protein
MVTTLFRLDPHPFDDDASNPALPRFDAALARRMGEIAVNLASRRGLPIAVSIVGEQAPLFYCALDGSHANDSDAIRRRQNTVLRFGLSSLAVGERFRRAGWSLQSQGLSDDDYALDGGGVPLRVAGAGIVGAMTIAGLDSEHNHALVVESLQWHVGRYALAPHA
>NZ_CP013375.1|WP_048025939.1|1580085_1580904_-|5-deoxy-glucuronate-isomerase
MTISPLLVKASADREICNVTPESAGWKHVGFRALRLKAGDTETLDTGTRELCVVVLTGTVRAEVDGTTHDALGKRDSVFEDVSPDALYVPGGKTVTLVATRDAEIALCTAPYASGDKPVQRLDGERMRRSVRGQGTNTRYVCDILMGDNPAAERLLVVEVVTPASHSSSYPPHKHDRDAAPDETSLEETYYHRIDPPQGFAFQRVYTDDRSLDEACAVENHDVVMVPRGYHPVVAPHGYNLYYLNVMAGPSRAWAFRNDPAHEWMLDAAPKR
>NZ_CP013375.1|WP_021162379.1|1580947_1581877_-|myo-inosose-2-dehydratase
MSWNVRIGINPLSWMNDDLPSLGGETPLETALKEGAEIGYAGFELGNKFPKTGPELKAKLAGFGLVCVSGWYSGFLAEVAPGMSDADAVAAEIERCRAHMTKLQYNDVNVVVYGECAGTIQGNIDTPVAKRPRFVDEDAWRRYAARLDAFGAHLLDTYGIKLAYHHHMGAYVESPDDVDRLMALTDPAKVFLLFDTGHAYFGGAADPVTLLKKHVSRVVHVHCKDVRPQVVTQARNSGWSFLNGVINGTFTVPGDGALDYEATLRTLKDAGYEGWLVVEAEQDPAVAPSYAYAKKGYESLRAIVDRLSA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

447755 : 491628

Pseudomonas_phage(33.33%)

plate,protease,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027788532.1\|447755_448283_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	9.7e-21	52.0
WP_069253170.1\|448555_448756_+	hypothetical protein	NA	NA	NA	NA
WP_069253171.1\|448759_448942_+	pyridoxal-phosphate dependent enzyme	NA	NA	NA	NA
WP_080741844.1\|450789_451047_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_069253173.1\|451168_451753_-	hypothetical protein	NA	NA	NA	NA
WP_069253174.1\|452433_453168_-	response regulator transcription factor	NA	NA	NA	NA
WP_081332231.1\|453169_454255_-	histidine kinase	NA	NA	NA	NA
WP_059491945.1\|454669_455212_+	hypothetical protein	NA	NA	NA	NA
WP_027788527.1\|455561_455765_+	hypothetical protein	NA	NA	NA	NA
WP_059486527.1\|455824_456625_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_069253175.1\|456988_460168_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	9.3e-58	26.5
WP_124628665.1\|464813_465206_+	hypothetical protein	NA	NA	NA	NA
WP_069253176.1\|466132_466456_+	hypothetical protein	NA	NA	NA	NA
WP_155771070.1\|466548_467325_+	hypothetical protein	NA	NA	NA	NA
WP_059622467.1\|467428_467917_+	DUF4265 domain-containing protein	NA	NA	NA	NA
WP_059622469.1\|467969_468410_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_081057301.1\|468412_468772_+	hypothetical protein	NA	NA	NA	NA
WP_081332232.1\|468768_469464_+	hypothetical protein	NA	NA	NA	NA
WP_069253178.1\|469556_470339_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_011350756.1\|470335_471682_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_042976613.1\|471784_472396_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_042976611.1\|472769_473408_+	hypothetical protein	NA	NA	NA	NA
WP_006484395.1\|473454_473970_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_006477094.1\|473985_475476_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_006477093.1\|475546_476050_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_021161818.1\|476112_476598_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_021161817.1\|476675_478511_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_048023630.1\|478474_479575_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_059677144.1\|479619_482289_+	type VI secretion system ATPase TssH	A0A223W0B1	Agrobacterium_phage	3.5e-90	32.0
WP_021161813.1\|482328_483450_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_059498632.1\|483535_484465_-	OmpA family protein	NA	NA	NA	NA
WP_021161811.1\|484469_485459_-	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_059486504.1\|485455_489400_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_060048024.1\|489701_490547_-	M15 family metallopeptidase	NA	NA	NA	NA
WP_069253179.1\|490668_491628_+\|tail	phage tail protein	NA	NA	NA	NA

DBSCAN-SWA_2

1129315 : 1137608

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060224288.1\|1129315_1130716_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.9e-76	38.1
WP_059485225.1\|1130723_1131674_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	7.6e-16	27.5
WP_059485224.1\|1131737_1132730_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	9.1e-28	30.9
WP_021157453.1\|1132803_1133151_+	DNA uptake protein	NA	NA	NA	NA
WP_042973431.1\|1133365_1134268_+	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	3.7e-52	40.2
WP_081332246.1\|1134346_1135690_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_021157450.1\|1135733_1136657_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	6.7e-41	34.9
WP_059860332.1\|1136687_1137608_-	alpha/beta hydrolase	Q6TUZ7	Yaba_monkey_tumor_virus	3.9e-17	27.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP013376

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP013375

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection