CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP013400	Burkholderia seminalis strain FL-5-4-10-S1-D7 chromosome 2, complete sequence	2 crisprs	cas3,csa3,DinG,PD-DExK,WYL	0	1	1
NZ_CP013399	Burkholderia seminalis strain FL-5-4-10-S1-D7 chromosome 3, complete sequence	1 crisprs	RT,WYL	2	3	2
NZ_CP013398	Burkholderia seminalis strain FL-5-4-10-S1-D7 chromosome 1, complete sequence	1 crisprs	cas3,DEDDh,csa3,DinG,RT	0	1	4

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013400_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013400_1

2255-2415

Orphan

Consensus_repeat	Method
TCCCGAAAAACCTCACCT	PILER-CR

3 spacers

The CRISPR arrays of NZ_CP013400_1

>merge|NZ_CP013400|1|2255-2415|PILER-CR
TCCCGAAAAGCCTCACCTTTGCCCATTTTTCGGGCAAATTCCATTCCCGAAAAGCCTCACCTGTGAGCGAGCGCACCGCCTGTGATCCATGCCCCGAAAAAGCTCACCTCAGCGGGATCAGGGCAGGAAAACCCGGATTTCCCTCCCGAAAAACCTCACCT

>NZ_CP013400|1|1|2255-2415|PILER-CR
TCCCGAAAAGCCTCACCT	TTGCCCATTTTTCGGGCAAATTCCAT
TCCCGAAAAGCCTCACCT	GTGAGCGAGCGCACCGCCTGTGATCCATG
CCCCGAAAAAGCTCACCT	CAGCGGGATCAGGGCAGGAAAACCCGGATTTCCC
TCCCGAAAAACCTCACCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013400.1\|WP_049036016.1\|9545_9962_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013400.1\|WP_049036013.1\|10898_11378_+\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|377770
NZ_CP013400.1\|WP_034187543.1\|11767_12853_-\|tartrate-dehydrogenase	unknown	unknown	gnl\|CDD\|273963
NZ_CP013400.1\|WP_034187547.1\|8134_9163_+\|L-threonine-3-dehydrogenase	unknown	unknown	gnl\|CDD\|180054
NZ_CP013400.1\|WP_034187552.1\|0_1368_-\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP013400.1\|WP_049036022.1\|5631_6009_-\|DUF2471-domain-containing-protein	unknown	unknown	gnl\|CDD\|371166
NZ_CP013400.1\|WP_059559277.1\|3190_4372_+\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|378704
NZ_CP013400.1\|WP_059559282.1\|10229_10835_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP013400.1\|WP_034187551.1\|4509_5529_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|334163
NZ_CP013400.1\|WP_034187549.1\|6148_6760_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380339
NZ_CP013400.1\|WP_059559279.1\|6921_8121_+\|glycine-C-acetyltransferase	unknown	unknown	gnl\|CDD\|235893

Protein	Function_ID	Function_description	E-value
NZ_CP013400.1\|WP_049036013.1\|10898_11378_+\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|377770	pfam07080, DUF1348, Protein of unknown function (DUF1348). This family consists of several highly conserved hypothetical proteins of around 150 residues in length. The function of this family is unknown.	2.62999e-98
NZ_CP013400.1\|WP_034187543.1\|11767_12853_-\|tartrate-dehydrogenase	gnl\|CDD\|273963	TIGR02089, Probable_tartrate_dehydrogenase/decarboxylase, tartrate dehydrogenase. Tartrate dehydrogenase catalyzes the oxidation of both meso- and (+)-tartrate as well as a D-malate. These enzymes are closely related to the 3-isopropylmalate and isohomocitrate dehydrogenases found in TIGR00169 and TIGR02088, respectively. [Energy metabolism, Other].	0
NZ_CP013400.1\|WP_034187547.1\|8134_9163_+\|L-threonine-3-dehydrogenase	gnl\|CDD\|180054	PRK05396, tdh, L-threonine 3-dehydrogenase; Validated.	0
NZ_CP013400.1\|WP_034187552.1\|0_1368_-\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	1.98032e-18
NZ_CP013400.1\|WP_049036022.1\|5631_6009_-\|DUF2471-domain-containing-protein	gnl\|CDD\|371166	pfam10616, DUF2471, Protein of unknown function (DUF2471). The function of this family is unknown. Members all come from Burkholderia spp. BDAG_04162 is annotated as Serine/threonine-protein kinase, but this could not be confirmed.	8.23957e-37
NZ_CP013400.1\|WP_059559277.1\|3190_4372_+\|DNA-binding-protein	gnl\|CDD\|378704	pfam11740, KfrA_N, Plasmid replication region DNA-binding N-term. The broad host-range plasmid RK2 is able to replicate in and be inherited in a stable manner in diverse Gram-negative bacterial species. It encodes a number of co-ordinately regulated operons including a central control korF1 operon that represses the kfrA operon. The KfrA polypeptide is a site-specific DNA-binding protein whose operator overlaps the kfrA promoter. The N-terminus, containing an helix-turn-helix motif, is essential for function. Downstream from this family is an extended coiled-coil domain containing a heptad repeat segment which is probably responsible for formation of multimers, and may provide an example of a bridge to host structures required for plasmid partitioning.	8.44206e-14
NZ_CP013400.1\|WP_059559282.1\|10229_10835_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.4769e-13
NZ_CP013400.1\|WP_034187551.1\|4509_5529_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|334163	pfam00589, Phage_integrase, Phage integrase family. Members of this family cleave DNA substrates by a series of staggered cuts, during which the protein becomes covalently linked to the DNA through a catalytic tyrosine residue at the carboxy end of the alignment. The catalytic site residues in CRE recombinase are Arg-173, His-289, Arg-292 and Tyr-324.	1.28286e-12
NZ_CP013400.1\|WP_034187549.1\|6148_6760_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|380339	cd02209, cupin_XRE_C, XRE (Xenobiotic Response Element) family transcriptional regulators, C-terminal cupin domain. This family contains transcriptional regulators containing an N-terminal XRE (Xenobiotic Response Element) family helix-turn-helix (HTH) DNA-binding domain and a C-terminal cupin domain. Included in this family is Escherichia coli transcription factor SutR (YdcN) that plays a regulatory role in sulfur utilization; it regulates a set of genes involved in the generation of sulfate and its reduction, the synthesis of cysteine, the synthesis of enzymes containing Fe-S as cofactors, and the modification of tRNA with use of sulfur-containing substrates. This family belongs to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	4.73902e-19
NZ_CP013400.1\|WP_059559279.1\|6921_8121_+\|glycine-C-acetyltransferase	gnl\|CDD\|235893	PRK06939, PRK06939, 2-amino-3-ketobutyrate coenzyme A ligase; Provisional.	0

>NZ_CP013400.1|WP_034187552.1|0_1368_-|replication-initiation-protein
MATTKRAKKTDVDVVSASSAELRKAVEAIAIQPKSGKITLLTRKLFNVLLAVAQQADDSGDTYRALLSDIVANSAFDSNDTALVKEHLRRMVSVQVEWSTGTSSQKPGRKWGISTLIADAEILEDPTTRRVWVEFSFAPKIKKKLLDPVQYARLSLQFQSQLRSSAGLALYEICVRYLTNPSHLTMREPWEWWRPILSGTPDTEAGDEAKREYKYFKRDYLRPAIAEVNAVTNIFVELIEHREGRRVAEIQFRVTERKQPMLALDEHPNVFDSTLVDRMVKLGIPLKEAQTLYADSEENRIRAALQMTEQRMRSTTLPPVRSAPALFKDALKKGYAPPVESVDALPAGTPSAKVAAAQPDDLKARLLSEFSAFRRKEAKVLYEEQGDAEREVARESFEAEALPTMGSHLRDDWRKRGLDSKLAETAFFDWLAQKTWGEPTDGDLLSFTLNQSRAA
>NZ_CP013400.1|WP_059559277.1|3190_4372_+|DNA-binding-protein
MTLDEMRQVIRDELESLRASGARRQELSLHACKRLFFDLGIRPSAANVRDLTQTGSASDIPKDIDHFWERIRSASKIRLDGAAIPKAVEEKAGALLGALYEEALKAARDSLDDDREQVRAGMADAERRLRDATIRQQTLEEALARGEARNEQLQARVTELEVQLVSQSTHGSASEATLLTTIARLEKELAAAAARVDTEQAQNAALRDRIDALQAELQQRTEHYAQQIKDAVAEAERRVKPMLVELDSLRSMASSYQSGLRDVQRKEFDFLQQLSSAKARADRLEEQLRTQGDELERATRDANALRASRGMNPEIAALIRRLADAGQLDAEAFSAIGTALDQDIPVPAECPHCDGEPELSHSEEGFEVACPECEHASGAWPSRFEAVARFARS
>NZ_CP013400.1|WP_034187551.1|4509_5529_-|tyrosine-type-recombinase/integrase
MSLPTSPGTAARPEEPDLFDRGASDWIVSPEAAFDAWLAMQDYRRSSADVYRAQWGAFLTWMRAHQKNLATVDTATIANFVGELPIRKTQRMRYLRLIERVLDHIRRTEYASTNPARFIAQDGEANWRKARDNEPTGFLTPAERATLLAYLFSPIGVSGSAYWKERRDRALVAAFLGAGIKTGEARALTISCINTSGTSLRIEAAHPDYARETHLASFAIALLEAWLTERKRQDIPGELVFPASHAGRPMHKATMLRAIDAIVESAGLTSSRTARASPQTLRNTYAAELFEHDVPPERVGKWLGFMRPVSSNRLHRAWKNWRDGLAAHNGDATDSDETH
>NZ_CP013400.1|WP_049036022.1|5631_6009_-|DUF2471-domain-containing-protein
MTEEQDLAALSFKAAAHDLELIVRHIAGRYIRQRVPLTWRLLHAIEAEALADLGFASRHEAGMRQLFERPSDMTFPETDDPIDFGRSNALPAVFSFAVLAYEAAAASHDTAPRERAHRPSKAWGD
>NZ_CP013400.1|WP_034187549.1|6148_6760_-|helix-turn-helix-transcriptional-regulator
MASSPGSRRTPAGAAPQPPAATPPRVGEQIQRLRNERKLTLDDLSRAAGVSKSMLSEIERDKANPTIAVAWRLTNALGITLDELFSQPKAPETIRVDGPHDIPTLAGHDGRYQLRVWGPIDLAGKFEWYELTLPGGGALVSNAHEPGTREHLTVLQGAMEIEAAAASRRLKVGDTARYPADEPHAIRNPGKAEARALLIVIHR
>NZ_CP013400.1|WP_059559279.1|6921_8121_+|glycine-C-acetyltransferase
MRDAFLAQVRGTLDQIRADGFYKTEREIASPQAAAVTLAGGAGVLNFCANNYLGLANDPRLIDAAKAGLDQDGFGMASVRFICGTQTVHKQLERALAAFLGTEDSILYSSCFDANGGLFETLLDENDAIISDELNHASIIDGIRLCKAKRFRYKNNDLADLEAKLKEADAAGARHKLIATDGVFSMDGIIADLKGICDLADRYGALVMVDDSHAVGFIGAHGRGTPEHCGVEGRVDIITGTLGKALGGASGGYVAARREVIELLRQRSRPYLFSNTLTPSIAAASLKVLELLGSDEGAKLRARVRENGVRFRQQMTEAGFTLVPGAHPIIPVMLGDAQLATNMADKLLGEGVYVIGFSFPVVPRGRARIRTQMSAAHTPEQIDQTVAAFVRVGQSLGII
>NZ_CP013400.1|WP_034187547.1|8134_9163_+|L-threonine-3-dehydrogenase
MKALAKLERGPGLTLTRVKRPEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQKTIPVPMHVGHEYVGEIVEMGQEVRGFAIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLASIFDPFGNATHTALSFNLVGEDVLITGAGPIGIMAVAIAKHVGARNVVITDINDYRLELARKMGATRAVNVARESLRDVMADLHMTEGFDVGLEMSGVPSAFTSMLEAMNHGGKVALLGIPPAQTAIDWNQVIFKGLEIKGIYGREMFETWYKMVAMLQSGLDLSPIITHRFAADDYEQGFAAMLSGESGKVILDWTA
>NZ_CP013400.1|WP_049036016.1|9545_9962_-|hypothetical-protein
MKHDVPKRDGGNDRAPLDVRQARVRAALRLRGVMKLTIVTIAVAHVLTFAFDRLLVAAGFAPDAATVLLFRFVTCALVSFWLQADALRAYRYAAQHGFVTVPGAHGDPVDVAPQCPKRWLVVLNLQLEPRWLKGEESR
>NZ_CP013400.1|WP_059559282.1|10229_10835_+|TetR/AcrR-family-transcriptional-regulator
MNPSHDSSGEPGVRDRLLDAAEALIYSGGIHATGIDAIVKRSGAARKSVYSHFESKEALVVAALERRDERWMRWFVDATQARGKAPRAQLLGMFDVLRDWFGQPDFHGCAFLNTSGEIPDADDPVRVVAREHKARLLAFVRACFDAYADEAGIERRGLARLARQWLVLIDGAIGVALVSGDANVARDARATAELLLDTVSR
>NZ_CP013400.1|WP_049036013.1|10898_11378_+|nuclear-transport-factor-2-family-protein
MSASPEVRPPVPPFTLETARQKVRAAEDAWNTRDPQRVSLAYTPQSRWRNRAEFVTGRDEIVGLLQRKWTRELDYRLIKELWAFDGNRIAVRFAYEWRDDAGNWFRSYGNENWEFDENGLMAHRHASINDLPIREADRLYHWPLGRRPDDHPGLSDLGL
>NZ_CP013400.1|WP_034187543.1|11767_12853_-|tartrate-dehydrogenase
MTDRTYRIAVIPGDGIGREVMPEGLRALAAVTARFGIRFDFVEIDWASCDYYAQHGKMMPDDWKAQLSGMDAILFGAVGWPATVPDHISLWGSLLKFRREFDQYINLRPARLFDGVPSPLAGRRPGDIDFMIVRENTEGEYSSVGGTMFEGTDREVVMQQSIFTRHGTERVLKFAFELAQRRAKRLTVATKSNGIAISMPWWDARAADMAERYPEIAVDKQHIDILCARFVLQPDRFDVVVASNLFGDILSDLGPACTGTIGIAPSANLNPDRTFPSLFEPVHGSAPDITGQYIANPVAMIWSAAMMLDFLGNGAGREREAHDAIVAAIEDVLRTGPRTRDLGGDAGTQAVGEAIAARIAG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013400_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013400_2

2276691-2276786

Orphan

Consensus_repeat	Method
CGACACGCCGCCGTTGATCGTGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013400_2

>merge|NZ_CP013400|2|2276691-2276786|CRISPRCasFinder
CGACACGCCGCCGTTGATCGTGCCCGAGTTGGTAAACGTGTTGCCCTGCCCGGGAGTGCCGTTCGTGCCGAGCGACACGCGGCCGTTGATCGTGCC

>NZ_CP013400|2|1|2276691-2276786|CRISPRCasFinder
CGACACGCCGCCGTTGATCGTGCC	CGAGTTGGTAAACGTGTTGCCCTGCCCGGGAGTGCCGTTCGTGCCGAG
CGACACGCGGCCGTTGATCGTGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013400.1\|WP_059556830.1\|2278114_2278774_-\|YdcF-family-protein	unknown	unknown	gnl\|CDD\|99750
NZ_CP013400.1\|WP_059556836.1\|2289418_2290336_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP013400.1\|WP_034189341.1\|2259264_2259927_+\|response-regulator	unknown	unknown	gnl\|CDD\|182612
NZ_CP013400.1\|WP_049028320.1\|2288247_2288694_+\|3-dehydroquinate-dehydratase	unknown	unknown	gnl\|CDD\|238262
NZ_CP013400.1\|WP_034189337.1\|2262901_2263102_+\|membrane-protein	unknown	unknown	gnl\|CDD\|377540
NZ_CP013400.1\|WP_034189331.1\|2279004_2280039_-\|rod-shape-determining-protein	unknown	unknown	gnl\|CDD\|237564
NZ_CP013400.1\|WP_059556832.1\|2282745_2283876_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|236724
NZ_CP013400.1\|WP_034189338.1\|2262020_2262389_+\|antibiotic-biosynthesis-monooxygenase	unknown	unknown	gnl\|CDD\|367760
NZ_CP013400.1\|WP_034189326.1\|2286959_2288243_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340927
NZ_CP013400.1\|WP_059556827.1\|2261540_2261987_+\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
NZ_CP013400.1\|WP_034189512.1\|2283940_2284651_-\|response-regulator	unknown	unknown	gnl\|CDD\|236738
NZ_CP013400.1\|WP_006482135.1\|2266063_2266315_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013400.1\|WP_059556831.1\|2280309_2282727_+\|BamA/TamA-family-outer-membrane-protein	unknown	unknown	gnl\|CDD\|132844
NZ_CP013400.1\|WP_059556834.1\|2285985_2286771_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP013400.1\|WP_059556828.1\|2263581_2264529_-\|PenA-family-class-A-beta-lactamase	unknown	unknown	gnl\|CDD\|185339
NZ_CP013400.1\|WP_034189335.1\|2264654_2265545_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176176
NZ_CP013400.1\|WP_059556826.1\|2259923_2261300_+\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|182388
NZ_CP013400.1\|WP_034189342.1\|2258679_2259033_-\|NirD/YgiW/YdeI-family-stress-tolerance-protein	unknown	unknown	gnl\|CDD\|225653
NZ_CP013400.1\|WP_059556833.1\|2284870_2285785_+\|glutaminase	unknown	unknown	gnl\|CDD\|234880
NZ_CP013400.1\|WP_034189334.1\|2266411_2268634_-\|amylo-alpha-1,6-glucosidase	unknown	unknown	gnl\|CDD\|225942

Protein	Function_ID	Function_description	E-value
NZ_CP013400.1\|WP_059556830.1\|2278114_2278774_-\|YdcF-family-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	2.06142e-33
NZ_CP013400.1\|WP_059556836.1\|2289418_2290336_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.38168e-78
NZ_CP013400.1\|WP_034189341.1\|2259264_2259927_+\|response-regulator	gnl\|CDD\|182612	PRK10643, PRK10643, two-component system response regulator PmrA.	1.46317e-83
NZ_CP013400.1\|WP_049028320.1\|2288247_2288694_+\|3-dehydroquinate-dehydratase	gnl\|CDD\|238262	cd00466, DHQase_II, Dehydroquinase (DHQase), type II. Dehydroquinase (or 3-dehydroquinate dehydratase) catalyzes the reversible dehydration of 3-dehydroquinate to form 3-dehydroshikimate. This reaction is part of two metabolic pathways: the biosynthetic shikimate pathway and the catabolic quinate pathway. There are two types of DHQases, which are distinct from each other in amino acid sequence and three-dimensional structure. Type I enzymes usually catalyze the biosynthetic reaction using a syn elimination mechanism. In contrast, type II enzymes, found in the quinate pathway of fungi and in the shikimate pathway of many bacteria, are dodecameric enzymes that employ an anti elimination reaction mechanism.	8.31344e-64
NZ_CP013400.1\|WP_034189338.1\|2262020_2262389_+\|antibiotic-biosynthesis-monooxygenase	gnl\|CDD\|367760	pfam03992, ABM, Antibiotic biosynthesis monooxygenase. This domain is found in monooxygenases involved in the biosynthesis of several antibiotics by Streptomyces species. It's occurrence as a repeat in Streptomyces coelicolor SCO1909 is suggestive that the other proteins function as multimers. There is also a conserved histidine which is likely to be an active site residue.	1.32798e-12
NZ_CP013400.1\|WP_034189331.1\|2279004_2280039_-\|rod-shape-determining-protein	gnl\|CDD\|237564	PRK13930, PRK13930, rod shape-determining protein MreB; Provisional.	6.10548e-166
NZ_CP013400.1\|WP_059556832.1\|2282745_2283876_-\|sensor-histidine-kinase	gnl\|CDD\|236724	PRK10604, PRK10604, sensor protein RstB; Provisional.	3.24503e-66
NZ_CP013400.1\|WP_034189326.1\|2286959_2288243_+\|MFS-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.41384e-133
NZ_CP013400.1\|WP_059556827.1\|2261540_2261987_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	2.8774e-16
NZ_CP013400.1\|WP_034189512.1\|2283940_2284651_-\|response-regulator	gnl\|CDD\|236738	PRK10701, PRK10701, DNA-binding transcriptional regulator RstA; Provisional.	6.94947e-84
NZ_CP013400.1\|WP_034189337.1\|2262901_2263102_+\|membrane-protein	gnl\|CDD\|377540	pfam05656, DUF805, Protein of unknown function (DUF805). This family consists of several bacterial proteins of unknown function.	0.000129159
NZ_CP013400.1\|WP_059556831.1\|2280309_2282727_+\|BamA/TamA-family-outer-membrane-protein	gnl\|CDD\|132844	cd07205, Pat_PNPLA6_PNPLA7_NTE1_like, Patatin-like phospholipase domain containing protein 6, protein 7, and fungal NTE1. Patatin-like phospholipase domain containing protein 6 (PNPLA6) and protein 7 (PNPLA7) are included in this family. PNPLA6 is commonly known as Neuropathy Target Esterase (NTE). NTE has at least two functional domains: the N-terminal domain putatively regulatory domain and the C-terminal catalytic domain which shows esterase activity. NTE shows phospholipase activity for lysophosphatidylcholine (LPC) and phosphatidylcholine (PC). Exposure of NTE to organophosphates leads to organophosphate-induced delayed neurotoxicity (OPIDN). OPIDN is a progressive neurological condition that is characterized by weakness, paralysis, pain, and paresthesia. PNPLA7 is an insulin-regulated phospholipase that is homologus to Neuropathy Target Esterase (NTE or PNPLA6) and is also known as NTE-related esterase (NRE). Human NRE is predominantly expressed in prostate, white adipose, and pancreatic tissue. NRE hydrolyzes sn-1 esters in lysophosphatidylcholine and lysophosphatidic acid, but shows no lipase activity with substrates like triacylglycerols (TG), cholesteryl esters, retinyl esters (RE), phosphatidylcholine (PC), or monoacylglycerol (MG). This family includes subfamily of PNPLA6 (NTE) and PNPLA7 (NRE)-like phospholipases.	2.9597e-60
NZ_CP013400.1\|WP_059556834.1\|2285985_2286771_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	5.97772e-55
NZ_CP013400.1\|WP_059556828.1\|2263581_2264529_-\|PenA-family-class-A-beta-lactamase	gnl\|CDD\|185339	PRK15442, PRK15442, beta-lactamase TEM; Provisional.	2.84796e-79
NZ_CP013400.1\|WP_034189335.1\|2264654_2265545_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176176	cd08487, PBP2_BlaA, The C-terminal substrate-binding domain of LysR-type trnascriptional regulator BlaA which involved in control of the beta-lactamase gene expression; contains the type 2 periplasmic binding fold. This CD represents the C-terminal substrate binding domain of LysR-type transcriptional regulator, BlaA, that involved in control of the expression of beta-lactamase genes, blaA and blaB. Beta-lactamases are responsible for bacterial resistance to beta-lactam antibiotics such as penicillins. The blaA gene is located just upstream of blaB in the opposite direction and regulates the expression of the blaB. BlaA also negatively auto-regulates the expression of its own gene, blaA. BlaA (a constitutive class A penicllinase) belongs to the LysR family of transcriptional regulators, whereas BlaB (an inducible class C cephalosporinase or AmpC) can be referred to as a penicillin binding protein but it does not act as a beta-lactamase. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.7703e-120
NZ_CP013400.1\|WP_059556826.1\|2259923_2261300_+\|HAMP-domain-containing-protein	gnl\|CDD\|182388	PRK10337, PRK10337, sensor protein QseC; Provisional.	1.20009e-64
NZ_CP013400.1\|WP_034189342.1\|2258679_2259033_-\|NirD/YgiW/YdeI-family-stress-tolerance-protein	gnl\|CDD\|225653	COG3111, COG3111, Periplasmic protein with OB-fold [Function unknown].	1.78105e-27
NZ_CP013400.1\|WP_059556833.1\|2284870_2285785_+\|glutaminase	gnl\|CDD\|234880	PRK00971, PRK00971, glutaminase; Provisional.	0
NZ_CP013400.1\|WP_034189334.1\|2266411_2268634_-\|amylo-alpha-1,6-glucosidase	gnl\|CDD\|225942	COG3408, GDB1, Glycogen debranching enzyme [Carbohydrate transport and metabolism].	2.95579e-119

>NZ_CP013400.1|WP_034189334.1|2266411_2268634_-|amylo-alpha-1,6-glucosidase
MPNHAEATTTQAPQVAPVAPTAASGPAFIAPEADPQALARNNQYVLKSGDAFVVSDALGDIGGHDDGLFVDDMRVLSTWRLTFGGRAPSLLSGATSADNASFTAHLTNRPLPPLGGHETPEGVIHIERMRVLAGDVLYEALTLTNYGASEAEVPLSLSFAADFKDMFEVRGTQRPKRGTVVAPRVDAGAVRLRYDGLDRVERNVTVHFSPAPDALSVDRADYTLTIAAQACVSIYLTVDATLGPAHGEGPGCGRVALRTALVGVHREMRARRESMARVNTGNPLFDAWLDRSLADLGLLTTQLDTGPYPYAGIPWFSTPFGRDAVITSLQMLWLQPSLARGVLRFLAEHQARETSAFRDAEPGKIMHEFRRSEMAATGEVPFALYYGGVDTTPLFIVLAGAYVERTGDDALIDELWPALERAAQWVIDKCDRNPYGLLDYQRTSERGLANQGWKDSHDSVFHADGRFPDGPIALVEVQAYACAALDAMSACSHRRGHAADATRYALRAKALRDQVDALFWMPEGHFYGIALDGHGDLCRVFASNAGHLLAFGLPDAERGAAVAGVLGSTLFQTGWGIRTLAAGQPRFNPMAYHNGSVWPHDNALIARGLARYGDKTAAVNLLRALFEAAVSFEMRLPELFCGFPRRRGEPPTAYPVACLPQAWAAGAPFMMLQACLGVSIDATRHEVRVERPALPEGVDWLRIDALRVGDETVSLTFRRVDGQVVAAAEQPGRVKVVAVL
>NZ_CP013400.1|WP_006482135.1|2266063_2266315_-|hypothetical-protein
MTTDNRPDDGEHKLENLEAAVDHLHKSIESQSIAVGAAKGILFSLIETLGALIGDPDLPEHARSGYEALRDKASELRGGLDRH
>NZ_CP013400.1|WP_034189335.1|2264654_2265545_+|LysR-family-transcriptional-regulator
MTKLRPHLPLNALRAFESSARHLNFTRAGLELSVTQAAVSQQVRSLEERLGCTLFTRLPRGLGLTDEGRALLPVLSDAFSRIETVLKQFDGGRFREVLTLGVVGTFALGWLMPRLKQFGDTHPFVELRLRTNNNVVDLAAEGLDFAIRFGEGNWPATRNERLLDAPLTALCAPEIARRLARPADLANETLLRSYRTDEWHGWFDAAQLEPWTVNGPVFDSSRLMVEAAMQGAGIALAPACMFARELQLGLLARPLDIDVCAGGYWLTSLKSKPLTPAMTLFRDWIVAEAADTTPDA
>NZ_CP013400.1|WP_059556828.1|2263581_2264529_-|PenA-family-class-A-beta-lactamase
MTYSSKRRTLLLAAATAPLVLTVTACASRQAAKADAADPAAVAAAAAADAVAPAAAAAALADLERDAGGRLGVCAIDTASGRVIAHRPDERFPFCSTFKAMLSAAVLAQSVDRPGWLQQRVTYTKADLVNYSPVSGKHVGSGMTVAALCEAAIQYSDNSAANLLMKLIGGPSAVTAFARSIGDDTFRLDRWETELNTALPGDPRDTTTPAAMAASMRVLTLGDALPAEQRAQLVAWLRGNKVGDKRIRAGVPAGWTVGDKTGTGDYGTTNDAGVIWPASGAPIVLVVYYTQAQADARAKDGVIASVAQIVARTFG
>NZ_CP013400.1|WP_034189337.1|2262901_2263102_+|membrane-protein
MEHFTAWQLLVSLVLVAIVVYPYVRIVRRTGHSGWWILTMFVPVLNFIMLWVFAFARWPAVDDRQR
>NZ_CP013400.1|WP_034189338.1|2262020_2262389_+|antibiotic-biosynthesis-monooxygenase
MPHFKPMDPAFPIQQQIAIDAEPVVLVNVFTLAPADEADFLAAWKDDAAFMKQQPGFISTQLHRALGDSPTYLNYAIWASTATFRAAFTHPAFVAKLSAYPSSAVASPHLFQKVGVAGICTA
>NZ_CP013400.1|WP_059556827.1|2261540_2261987_+|winged-helix-turn-helix-transcriptional-regulator
MTKSEKLTTVALSVFRLNGLLIEWGNTFSGPHGLTSARWQVLGAISMAPDAPTIPQIADAMGITRQAVLKQVNVLTEEGLVLSLPNPAHKRSPLYALTPRGEAAYRAVAEQWQQHVRDIAGDFSAADLDAAIRVLSAMSRAHGQDGHA
>NZ_CP013400.1|WP_059556826.1|2259923_2261300_+|HAMP-domain-containing-protein
MTHVQRAIARWRNASLRRRLLTWLLPAACVIGLVASAGTYWGALRELDDLLDDQMRSMSKQIVVGPNGELSFSDRANGKHGFEASDPDAVLLQVWRNGTLVYSTDRDSKLPAPAQKGIASVDVGGQSWRTYVTERGGTTIRLAQARHARWEAIAGIAVHLLWPVFSMLPLLAIGLWFGIGAGLRPLRTIASGLKRRNANNLEPVDVASMPNEVRPLAEAINDLLARLDRSFTLQRHFIADAAHELRTPIMGLSIQSQLLRRAATAEEREHILAQIQAGTTRLGHLAEQLLTLARLEPDAQAAASTSEPVDLAALCRSVVSDRARVADAHRIDLGAIVAAPVMAAGNADTLRVLLNNLVDNAIRYAGAGARVDVSARVDGTTPVLEVADDGPGIPEAERTDVWERFYRGEGAQAVTSSGSGLGLSIVKRIAEQHRATVALGTTQGGRGLTVTVRFPAPV
>NZ_CP013400.1|WP_034189341.1|2259264_2259927_+|response-regulator
MRVLLVEDDPLIGSGLEQGLKQEGFAVDWVKDGDAASLALRSTGYGLLLLDLGLPNRDGLSVLAALRRRDENLPAIIITARDGVPDRIAGLDSGADDYLVKPFELDELLARIRAVNRRHAGRAQTTLAIGPLRLDPVKHLVWLDDEEVPLSPKEFVLLHELMREPGAVISREQFEERLYSWGEEIESNAVQVHIHNLRKKLGHDMIRTVRGVGYRIGDGT
>NZ_CP013400.1|WP_034189342.1|2258679_2259033_-|NirD/YgiW/YdeI-family-stress-tolerance-protein
MKHLARILAVALATLPAAVYAQYTGPSALTTTTVKELLANGKDDQHVQLQGRIVKHVGGEDYEFADATGTIRVEIDHKLWAAGQPVSDKNEVKVTGEFERKWSGSVKVDADHVEVLR
>NZ_CP013400.1|WP_059556830.1|2278114_2278774_-|YdcF-family-protein
MKYRTRRSLAARAGRLLAVFACLWGAAAIAIVAYGMRMPGEPADVAVIFGNALDETGAPKPVLAARLDVGVRCYRAGQCPAFLVSGAIDGPGLNEATAMRDYLVARGVPADRIAVDDQGDNTLATARHTLAYMQAHHVSRVLIVSQYYHLARARLAFERVGIARANISAAYPHRFQWRDVYSSWREVPAYAMYAVRLWANPDAQPRSFRPMLYLMSLFS
>NZ_CP013400.1|WP_034189331.1|2279004_2280039_-|rod-shape-determining-protein
MSTPLFGKLFAQPVAIDPGTASTRIYTHERGVVLNQPSVVCFRKGGATDARPTLEAVGELAKALLGREPGHLEAVRPMRHGVIADAHAAEQMIRSFIDMSRTRSRFGRRVEVTLCVPSDATAVERRAIREAAFAAGVSDVELIEESLAAGLGAGLPVTEPVGSMVIDIGGGTTEVAVIALGGIVYREAIRVGGSQFDAAIVNHVRNLYGVLLGEQTAEHVKKTIGSATSAVPRTSTRAVGRGIGDGLPRSVELSNHDVADALAAPLKQVIGAVKSVLENAPAELVTDIAHRGVVLTGGGALLADLERLLYDETGLVARIADEPATCAVRGAGEAMGRLSMCPVD
>NZ_CP013400.1|WP_059556831.1|2280309_2282727_+|BamA/TamA-family-outer-membrane-protein
MTATVSSRWARVRPLCTTLVAFWCCTVAAQPLPATEPAAAPTVTAAAGAPAALPTAPAAPATPANACTADGGPAGRPSVGLVLSGGGARGYAHLGVLKVLEDNRIPIDCIAGTSMGAVVGGLYASGMAAGEMQKRLSEVNLADIAFDVTDRADLPQTSREDERLYINGLTLGFGKKGVKAPVGLVQGNRLQALLANWTAAVPTNQPFDRLPIPYRAVATDLQTGQMVVLDHGSLPLAIRASMAMPGLFAPAEINGRALVDGGLVSNLPVDTARQMGANVVIAVDIGSQLRPLDALASPADVMQQMVGILIRQNVTAQRKQLDTHDVLLTPDLGGLAFTDFQNAKQAIAAGAAAATAALPKLRRFALTPEQYAAYRSAHAQPLPPPIRITRIDIQTSGGVPKRVVSNALHVKPGDTYDPQTVSQDLLGLTTGGNFESVTQQIVSHGDDNVLEINAREKYWGPNFLLFGLGMSSSSTDEGGFRLHVGYRRPWLTESGLEFRADTTIGSDLQSARVEFRQPLSMAYGVYLSPYAEYQRRYANLYDDTGDVKITQYLMQTARAGIDFGLPIARLGDFRIGIGYVTGHGSPTYNLPFDDGSGQNLLWPSFTSQALTARARFVIDQLDDPMFPRKGYFGELRVERSLVSRNGRSASAFDDGINNAPYTEIYGKAMIAQQFGRHSVSATIEGGKSIGGTNLINAFNFTLGGFQHLSAYAADQLNGNELAYGQITYMNQLMTFNASPIKALSVGASAEVGNVWSSGQQIGGGALKQSYTFFTSLSTAFGPVYIGVALAPGGRRNFYLQLGRTY
>NZ_CP013400.1|WP_059556832.1|2282745_2283876_-|sensor-histidine-kinase
MIRRTRSHPDAPPLPTLRYVKWRWLHFRRAWTDTRADRIPSWSRLYVRTYLHLLGLVLLTALVPALALCVELSPQVVWHAFDALPGDIYIVLAFVFAAPALAAYRWMRPVWSDLVMVRERAIDFTGGRFNTRARESHSVIIGPLARTLNALAMRMERLIAAQRDLTNGISHELRTPLARVRFALEMLREPASAVEYQGALESIAQDVTELEELIDMSLTFARLEYSSLQSNLEMTAPVAWFEHQIHDAQLLYPERAIEARIAIASDLRVKMDRRLMSYAMRNLLRNASKYAKSHIVVGLSLVHGNIGIFVEDDGPGVPESERERIFDAFVRLDRRTGGYGLGLSITRQVLHAHNGRIAVVDPVELGGARFEISWPV
>NZ_CP013400.1|WP_034189512.1|2283940_2284651_-|response-regulator
MSFRILLVEDDTRLSTLIAGYLRKNDYEVDTVLHGDAAVPAILSIRPDLVILDVNLPGKDGFEICREARKQYDGVIIMVTARDEPFDELLGLEFGADDYVHKPVEPRILLARIKAQLRRAPVRAAEGTAPQPERYAFGKFSIDRTDRTVVLPDGSTPDLTSAEFDLLWALVCHAGEVVSRDDLMLQLRGVEFDGLDRTIDGRISKLRRKLRDDASNPQRIKTIRSKGYQFSKHAWE
>NZ_CP013400.1|WP_059556833.1|2284870_2285785_+|glutaminase
MNYQPILERIHTELAPWIGQGRVADYIPELAKVPADKFGMAVVTLDGNVYTVGDAHERFSIQSISKLFACTLAFQLLGDELWERVGREPSGNAFNSLVQLESERGKPRNPFINAGALVVTDVLCRRFVKAETALVEFVRRTIGANDINYDSRVALSELQHAERNRAMAHFMASFGNMQMPPDTVIDAYCRQCAITMNCVELASAALFLANGGVAPVTGERIVDPSSAKRLSALMLTCGTYDAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAVCVWAPGLDANGNSLAGTLALEWLTTYTGRSIF
>NZ_CP013400.1|WP_059556834.1|2285985_2286771_-|IclR-family-transcriptional-regulator
MSLKNGLRVLDFLASQGEGAGLVEIADALGMPRSSCHRVLAELVDSGYVRQLADHSRYILTMRMTSNGLEFLSLTGIADIAQPIIERVAARTGELARLSLVDGETIIWVGKADGQRTGFRYDPDMGQAARLSCTSTGHAWLMTMADEQAAALVLKQGFGEPNEFGPNAPTTLKALLGFLHAARVRGYAMIDEVFAPGMAAVATPVVSGSRCVGVISLAGPRKRLTAEKIHVYSEWLREAANELAQLSNMAGFPGRPPLGKG
>NZ_CP013400.1|WP_034189326.1|2286959_2288243_+|MFS-transporter
MARRAVAGATVGTALEWFDFALYGVVAATIFPKLFFPSLDPTASLLASLASFWAGLAARPLGAVICGMLGDRWGRRNLMLVTVSVMGASSFLMGLLPTYQQVGILAPTLLVSLRIIQGFALGGESTGAQLMAVEHASAKKRGLYSGLLGICSPLSQILANFALFALSGLLSAQDFESYGWRIPFLASFVLVLLGIYIRMKVSETPAFEALRKKGEGARAANPLGIVFRFHWRTALRLTLFFCGPAALFYLIVVFSLSYLTKNLGVPKQTGFMLLMVANVCAIAGALAGGYLSDRIGRKGALLIGSFCTLVCCLIYFPILNQHSVATTMAVMGAFLGFTQFQSGIQPVWFAESFPTEARYTGSALSYSGANLLTGGPMPIVAVALLNAFHGSPWAIVAVCGSLNLLSFLMIATSRETKDTALERSATH
>NZ_CP013400.1|WP_049028320.1|2288247_2288694_+|3-dehydroquinate-dehydratase
MTRKLYILNGSNLNMLGAREPHLYGHTTLKDIERNCLALAADLKFDCVFRQTNSESQLIDWIQEAFLQDAALIINPAGFSFGRIPVLDAVKLVRRPVVEVHITNIHRRSEEYRHSTISVAATAVICGAGANGYLLSIRAVDDLWSNQS
>NZ_CP013400.1|WP_059556836.1|2289418_2290336_-|LysR-family-transcriptional-regulator
MDRLTSLGVFVAAVEEGSFAAAARRFGLSAAMAGKHVSAIESELNARLLQRTTRRLSLTDTGQAYYERCKQILEAFDDANREASDSQGTARGVLRVAAPVTFGAMHLGDVLARYVEDHPQVNVDVLLGDRYVDLIDAGVDVAIRIGRLREPELVTRRLAPCRMVVCASPAYLERHGMPRKPGDLLRAPRLAFSEAVSAGDWTLFDARNRAYVIDGPCRIAANNTQMLLAAALAGAGVAYGPTFVFGEHLRRGELVPLLPAYRATELAIQAVYPSARRIPLKVRRFVDYLTEAFGDDPPWDRMAKL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP013400_1	1.2\|2317\|29\|NZ_CP013400\|PILER-CR	2317-2345	29	NZ_KY000060	Agrobacterium tumefaciens strain CFBP2407 plasmid pTi_CFBP2407, complete sequence	59895-59923	7	0.759

1. spacer 1.2|2317|29|NZ_CP013400|PILER-CR matches to NZ_KY000060 (Agrobacterium tumefaciens strain CFBP2407 plasmid pTi_CFBP2407, complete sequence) position: , mismatch: 7, identity: 0.759

gtgagcgagcgcaccgcctgtgatccatg	CRISPR spacer
atgagcgagcgcagcgcctgtgcagcgtc	Protospacer
.************ ********   *.*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

827689 : 879577

Burkholderia_phage(86.67%)

plate,holin,capsid,portal,tRNA,head,tail,terminase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069245881.1\|827689_830482_-	hypothetical protein	A0A1S5NPU9	Burkholderia_phage	0.0e+00	94.8
WP_069245882.1\|830484_830739_-	hypothetical protein	A0A1S5NPT7	Burkholderia_phage	1.3e-34	97.6
WP_069245883.1\|830735_831098_-	hypothetical protein	E5E3T4	Burkholderia_phage	5.8e-49	80.8
WP_156810503.1\|831101_831449_-	hypothetical protein	A0A1S5NV61	Burkholderia_phage	1.8e-39	59.6
WP_069245885.1\|831453_831648_-	hypothetical protein	E5E3T5	Burkholderia_phage	2.7e-21	89.1
WP_069246043.1\|831691_831880_-	hypothetical protein	E5E3T6	Burkholderia_phage	6.5e-20	73.4
WP_017923635.1\|831891_832086_-	hypothetical protein	A0A1S5NR87	Burkholderia_phage	2.0e-19	75.0
WP_006757081.1\|832174_832423_-	ogr/Delta-like zinc finger family protein	A0A1S5NNI9	Burkholderia_phage	2.6e-40	97.6
WP_017923636.1\|832450_832639_-	hypothetical protein	A4PE59	Ralstonia_virus	1.2e-10	64.9
WP_012327650.1\|832667_832859_-	hypothetical protein	E5E3U0	Burkholderia_phage	1.0e-12	67.3
WP_069246044.1\|832875_833061_-	hypothetical protein	A4JWR7	Burkholderia_virus	2.0e-05	54.0
WP_017923638.1\|833178_833670_+	helix-turn-helix transcriptional regulator	E5E3U2	Burkholderia_phage	3.9e-24	42.9
WP_017923639.1\|833660_834041_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_069245886.1\|834506_835658_-	phage late control D family protein	A0A1S5NV58	Burkholderia_phage	1.6e-193	97.1
WP_027809278.1\|835654_836083_-\|tail	phage tail protein	A0A1S5NTH4	Burkholderia_phage	3.6e-74	99.3
WP_069245887.1\|836096_839348_-	hypothetical protein	A0A1S5NRM8	Burkholderia_phage	0.0e+00	91.5
WP_017922482.1\|839344_839464_-\|tail	GpE family phage tail protein	E5E3Q0	Burkholderia_phage	1.0e-10	78.9
WP_069245888.1\|839463_839775_-\|tail	phage tail assembly protein	E5E3Q1	Burkholderia_phage	9.4e-40	84.5
WP_017922484.1\|839808_840318_-\|tail	phage major tail tube protein	E5E3Q2	Burkholderia_phage	1.8e-88	93.5
WP_069245889.1\|840347_841520_-\|tail	phage tail sheath protein	A0A1S5NNH8	Burkholderia_phage	4.7e-225	98.7
WP_069245890.1\|841631_842381_-	site-specific DNA-methyltransferase	A0A1S5NPU0	Burkholderia_phage	3.9e-140	96.0
WP_082160890.1\|842358_842541_-	Com family DNA-binding transcriptional regulator	A0A1S5NPS9	Burkholderia_phage	8.2e-28	96.7
WP_069245891.1\|842690_843032_-	hypothetical protein	A0A1S5NQ35	Burkholderia_phage	2.2e-42	83.2
WP_083262754.1\|843067_843478_-	hypothetical protein	A0A1S5NV54	Burkholderia_phage	8.1e-07	34.6
WP_069245894.1\|846830_847382_-\|tail	phage tail protein I	A0A1S5NRL9	Burkholderia_phage	6.4e-100	96.7
WP_069245895.1\|847374_848280_-\|plate	baseplate assembly protein	A0A1S5NR72	Burkholderia_phage	4.1e-160	97.0
WP_069245896.1\|848276_848642_-	hypothetical protein	A0A1S5NNH3	Burkholderia_phage	1.1e-55	90.9
WP_069245897.1\|848638_849346_-\|plate	phage baseplate assembly protein V	A0A1S5NNH1	Burkholderia_phage	1.3e-92	82.4
WP_069245898.1\|849469_849934_-	hypothetical protein	NA	NA	NA	NA
WP_069245899.1\|850020_850470_-	phage virion morphogenesis protein	A0A1S5NPT5	Burkholderia_phage	3.4e-67	92.6
WP_069245900.1\|850469_850880_-\|tail	phage tail protein	A0A1S5NPS3	Burkholderia_phage	1.4e-70	97.1
WP_069245901.1\|850876_851368_-	hypothetical protein	A0A1S5NQ26	Burkholderia_phage	2.7e-73	93.9
WP_069245902.1\|851364_852165_-	DUF3380 domain-containing protein	A0A1S5NV50	Burkholderia_phage	1.3e-138	95.9
WP_027809292.1\|852157_852478_-\|holin	phage holin family protein	A0A1S5NTF8	Burkholderia_phage	2.7e-50	98.1
WP_012327676.1\|852477_852852_-	membrane protein	A0A1S5NRL1	Burkholderia_phage	7.8e-57	100.0
WP_012327677.1\|852854_853067_-\|tail	tail protein	A0A1S5NR68	Burkholderia_phage	7.6e-33	95.7
WP_069245903.1\|853066_853549_-\|head	head completion/stabilization protein	A0A1S5NNA6	Burkholderia_phage	1.9e-79	92.5
WP_069245904.1\|853653_854340_-\|terminase	terminase endonuclease subunit	A0A1S5NNA5	Burkholderia_phage	9.1e-120	96.1
WP_017922499.1\|854336_855356_-\|capsid	phage major capsid protein, P2 family	A0A1S5NPT2	Burkholderia_phage	6.6e-175	90.6
WP_069245905.1\|855392_856217_-\|capsid	GPO family capsid scaffolding protein	A0A1S5NPS0	Burkholderia_phage	1.4e-130	89.4
WP_069245906.1\|856361_858113_+	oxidoreductase	E5E3S6	Burkholderia_phage	0.0e+00	88.9
WP_069245907.1\|858112_859159_+\|portal	phage portal protein	A0A1S5NV43	Burkholderia_phage	4.8e-197	96.6
WP_069245908.1\|859186_859903_-	hypothetical protein	A0A1S5NTJ1	Burkholderia_phage	6.2e-127	89.3
WP_156810504.1\|860277_860436_+	hypothetical protein	NA	NA	NA	NA
WP_069245910.1\|860853_861885_+	ParA family protein	H2BD62	Pseudomonas_phage	1.6e-64	40.9
WP_156810505.1\|861884_862487_+	hypothetical protein	NA	NA	NA	NA
WP_059558415.1\|862975_863539_-	hypothetical protein	NA	NA	NA	NA
WP_069245912.1\|863688_864681_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_034185731.1\|864817_865117_-	hypothetical protein	NA	NA	NA	NA
WP_034185732.1\|865507_866266_-	TIGR00730 family Rossman fold protein	A0A1D8KUT5	Synechococcus_phage	6.7e-23	38.4
WP_034185733.1\|866267_869021_+	DNA polymerase I	A0A218MKQ4	uncultured_virus	2.6e-72	32.4
WP_049036581.1\|869299_870634_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_034185735.1\|871029_871905_+	carboxymethylenebutenolidase	NA	NA	NA	NA
WP_059558411.1\|871959_872829_-	sulfurtransferase	NA	NA	NA	NA
WP_034185737.1\|872946_874053_-	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_034185738.1\|874323_874617_+	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_034185739.1\|874613_875498_+	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_034185740.1\|875579_877484_+	1-deoxy-D-xylulose-5-phosphate synthase	NA	NA	NA	NA
WP_011355803.1\|877638_878448_+	GTP cyclohydrolase I FolE2	NA	NA	NA	NA
WP_034185741.1\|878536_879577_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.7e-93	52.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP013399

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013399_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013399_1

997308-997591

Orphan

Consensus_repeat	Method
NNNNNNTGTCGACNTCGACGTCNACNGGCATC	CRT

4 spacers

The CRISPR arrays of NZ_CP013399_1

>merge|NZ_CP013399|1|997308-997591|CRT
TGTCGACGTCGACCTCCACCGGGTTGTCTTCGGCAAACAGCGCGATCACGTCGTTGTCGACCTCGACGTCGACCGGCATCACGTCGCTGTCGACGGGCCTGAGTTCGACCAACAGCACGGTGACGTCGCTGTCGACGTCGACGTCCACCGGGTTGTCTTCGGCAAACAGCGCGATCACGTCGTTGTCGACCTCGACGTCGACGGGCATCACGTCACTGTCGACGGGCCTGAGTTCGACCAACAGCACGGTGACGTCACTGTCGACCTCGACGTCGACGGGCATC

>NZ_CP013399|1|1|997308-997591|CRT
TGTCGACGTCGACCTCCACCGGGTTG	TCTTCGGCAAACAGCGCGATCACGTCGT
TGTCGACCTCGACGTCGACCGGCATC	ACGTCGCTGTCGACGGGCCTGAGTTCGACCAACAGCACGGTGA
CGTCGCTGTCGACGTCGACGTCCACC	GGGTTGTCTTCGGCAAACAGCGCGATCACGTCGT
TGTCGACCTCGACGTCGACGGGCATC	ACGTCACTGTCGACGGGCCTGAGTTCGACCAACAGCACGGTGACGTCAC
TGTCGACCTCGACGTCGACGGGCATC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013399.1\|WP_059562610.1\|987192_988713_-\|sensor-domain-containing-diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NZ_CP013399.1\|WP_049035342.1\|999939_1000335_+\|outer-membrane-protein-assembly-factor-BamE	unknown	unknown	gnl\|CDD\|225465
NZ_CP013399.1\|WP_059562690.1\|1000413_1000602_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013399.1\|WP_059562599.1\|980062_980938_+\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|226145
NZ_CP013399.1\|WP_034191810.1\|980960_981971_+\|zinc-binding-alcohol-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|176222
NZ_CP013399.1\|WP_059562620.1\|993146_993980_-\|response-regulator	unknown	unknown	gnl\|CDD\|381147
NZ_CP013399.1\|WP_059562636.1\|1009982_1010228_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013399.1\|WP_059562626.1\|1001206_1007101_+\|excinuclease-ABC-subunit-UvrA	unknown	unknown	gnl\|CDD\|223256
NZ_CP013399.1\|WP_034192020.1\|1000764_1000983_+\|DUF3820-family-protein	unknown	unknown	gnl\|CDD\|378970
NZ_CP013399.1\|WP_034191796.1\|1009570_1009957_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133388
NZ_CP013399.1\|WP_049034464.1\|1010470_1010875_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013399.1\|WP_034191798.1\|1008025_1008508_-\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380353
NZ_CP013399.1\|WP_059562604.1\|983147_984671_+\|altronate-dehydratase	unknown	unknown	gnl\|CDD\|377287
NZ_CP013399.1\|WP_059562633.1\|1008573_1009482_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP013399.1\|WP_059562628.1\|1007180_1007915_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270341
NZ_CP013399.1\|WP_059562607.1\|985066_987025_-\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239491
NZ_CP013399.1\|WP_059562602.1\|982002_983151_+\|D-mannonate-oxidoreductase	unknown	unknown	gnl\|CDD\|235147
NZ_CP013399.1\|WP_034191804.1\|989854_990745_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP013399.1\|WP_059562616.1\|990805_993154_-\|histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP013399.1\|WP_059562613.1\|988994_989735_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235816

Protein	Function_ID	Function_description	E-value
NZ_CP013399.1\|WP_059562610.1\|987192_988713_-\|sensor-domain-containing-diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	7.81005e-53
NZ_CP013399.1\|WP_049035342.1\|999939_1000335_+\|outer-membrane-protein-assembly-factor-BamE	gnl\|CDD\|225465	COG2913, OlmA, Outer membrane lipoprotein OmlA (small protein A) [Cell envelope biogenesis, outer membrane].	1.14853e-22
NZ_CP013399.1\|WP_059562599.1\|980062_980938_+\|amidohydrolase-family-protein	gnl\|CDD\|226145	COG3618, COG3618, Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only].	1.14046e-62
NZ_CP013399.1\|WP_034191810.1\|980960_981971_+\|zinc-binding-alcohol-dehydrogenase-family-protein	gnl\|CDD\|176222	cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family. This group contains members identified as related to zinc-dependent alcohol dehydrogenase and other members of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group includes various activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	2.48351e-174
NZ_CP013399.1\|WP_059562620.1\|993146_993980_-\|response-regulator	gnl\|CDD\|381147	cd19920, REC_PA4781-like, phosphoacceptor receiver (REC) domain of cyclic di-GMP phosphodiesterase PA4781 and similar domains. Pseudomonas aeruginosa cyclic di-GMP phosphodiesterase PA4781 contains an N-terminal REC domain and a C-terminal catalytic HD-GYP domain, characteristics of RpfG family response regulators. PA4781 is involved in cyclic di-3',5'-GMP (c-di-GMP) hydrolysis/degradation in a two-step reaction via the linear intermediate pGpG to produce GMP. Its unphosphorylated REC domain prevents accessibility of c-di-GMP to the active site. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	1.10878e-47
NZ_CP013399.1\|WP_059562626.1\|1001206_1007101_+\|excinuclease-ABC-subunit-UvrA	gnl\|CDD\|223256	COG0178, UvrA, Excinuclease ATPase subunit [DNA replication, recombination, and repair].	0
NZ_CP013399.1\|WP_034192020.1\|1000764_1000983_+\|DUF3820-family-protein	gnl\|CDD\|378970	pfam12843, QSregVF_b, Putative quorum-sensing-regulated virulence factor. QSregVF_b is a family of short Pseudomonas proteins that are potential virulence factors. The structure of UniProtKB:Q9HY15 a secreted protein has been solved and deposited as Structure 3npd, from pfam13652. It is predicted that these two adjacent proteins form a single transcriptional unit based on the prediction that together they interact with their adjacent protein PotD, which is the putrescine-binding periplasmic protein in the polyamine uptake system comprising PotABCD. These two adjacent proteins are predicted to be quroum-sensing-regulated virulence factors.	1.0826e-36
NZ_CP013399.1\|WP_034191796.1\|1009570_1009957_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133388	cd01282, HTH_MerR-like_sg3, Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 3). Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	1.18864e-42
NZ_CP013399.1\|WP_034191798.1\|1008025_1008508_-\|cupin-domain-containing-protein	gnl\|CDD\|380353	cd02224, cupin_SPO2919-like, Silicibacter pomeroyi SPO2919 and related proteins, uncharacterized sugar phosphate isomerase with a cupin domain. This family includes proteins similar to sugar phosphate isomerase SPO2919 from Silicibacter pomeroyi and Afe_0303 from Acidithiobacillus ferrooxidans, but are as yet uncharacterized. Structures of these proteins show a cupin fold with a conserved "jelly roll-like" beta-barrel fold that form a homodimer.	7.97895e-41
NZ_CP013399.1\|WP_059562604.1\|983147_984671_+\|altronate-dehydratase	gnl\|CDD\|377287	pfam04295, GD_AH_C, D-galactarate dehydratase / Altronate hydrolase, C-terminus. Family members include the C termini of D-galactarate dehydratase (EC:4.2.1.42) which is thought to catalyze the reaction D-galactarate = 5-keto-4-deoxy-D-glucarate + H2O, and altronate hydrolase (altronic acid hydratase, EC:4.2.1.7), which catalyzes D-altronate = 2-keto-2-deoxygluconate + H2O. As purified, both enzymes are catalytically inactive in the absence of added Fe2+, Mn2+, and beta-mercaptoethanol. Synergistic activation of altronate hydrolase activity is seen in the presence of both iron and manganese ions, suggesting that the enzyme may have two ion binding sites. Mn2+ appears to be part of the enzyme active centre, but the function of the single bound Fe2+ ion is unknown. The hydratase has no Fe-S core.	0
NZ_CP013399.1\|WP_059562633.1\|1008573_1009482_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.63586e-27
NZ_CP013399.1\|WP_059562628.1\|1007180_1007915_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270341	cd13623, PBP2_AA_hypothetical, Substrate-binding domain of putative amino-acid transport system; the type 2 periplasmic binding protein fold. This putative amino acid-binding protein belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.80756e-91
NZ_CP013399.1\|WP_059562607.1\|985066_987025_-\|phosphatase-PAP2-family-protein	gnl\|CDD\|239491	cd03397, PAP2_acid_phosphatase, PAP2, bacterial acid phosphatase or class A non-specific acid phosphatases. These enzymes catalyze phosphomonoester hydrolysis, with optimal activity in low pH conditions. They are secreted into the periplasmic space, and their physiological role remains to be determined.	1.76012e-33
NZ_CP013399.1\|WP_059562602.1\|982002_983151_+\|D-mannonate-oxidoreductase	gnl\|CDD\|235147	PRK03643, PRK03643, tagaturonate reductase.	2.0644e-65
NZ_CP013399.1\|WP_034191804.1\|989854_990745_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	5.47087e-67
NZ_CP013399.1\|WP_059562616.1\|990805_993154_-\|histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.75103e-43
NZ_CP013399.1\|WP_059562613.1\|988994_989735_-\|SDR-family-oxidoreductase	gnl\|CDD\|235816	PRK06500, PRK06500, SDR family oxidoreductase.	3.19581e-79

>NZ_CP013399.1|WP_059562620.1|993146_993980_-|response-regulator
MPSRLPSSAPPRTTPDLAGAHILVVDDRPNDLRLLTEILRAARCRISVAFDGLQAYHRAQAIAPDLILMDVRMPRMDGFAASRLLASTPSTQAIPVIILTAAGELEDRIAGLETGAIDYIVKPFEPAEVIARIRNHLKRARRSQPFAHLPELPDHPDAALVRAATDVLLRDLRHPPALDDLAKQVGTHEKRLSRVFRDQLGQTVFEYLRDTRLRAAMHFLSDTSMGIGDIAEEIGFSTPGNFATAFRERFGITPSDWRRQRHTGDTPAAQGGRHGDA
>NZ_CP013399.1|WP_059562616.1|990805_993154_-|histidine-kinase
MRRRHAAWAAGWRAVLLLVIALAVTCATARAASTPNPAQLDGVSVFEDASTTMTAEQVAARLAGPARRVPAASTSTFNVEFSRSAWWVRATLTNRGSVARPLVLVIRDARIDHADFHVGQDGSWTLVSRFPAADAGSDAARQPSRYPVLDVTLPAGASLPVLIRVTSRKEMRLAPAAFTRAAWDAQERRATMWDFGFFGGLLALLWCALLIGFFSRSGVFHVLAAMALGTTLFEAAYRGYVAMALPPALREWSARGEVIAVYAAIACFIVFILTVARREQARLPLRAVYMAFLALECIGMVGAAGGDLLTFTWFCLRLNAVLGIVNISLALMLAIRRTPTGRVMLIAIAFATFNMLIRVLDGMDALPPLLSWLKSDIYPNPVIAIVGLATHLLVLAAWIHHVGRQRTEARKRLEHWQLTEQDRLRDEVARRTVALNDALQQVTTHMQQKIETLGYVSHDLRAPLSTINGYAKLLLQSATRSQARLIRSIDRSIRYQLTLIDELLAFTKAELQPLGVAPDATDLPGLLDDIGHYALALCAQQDNRFVYRPATPLPRMVSIDGMRLQQVLLNLLSNASKFTRDGTVTLSVHAAREGNAWRLLFEVADTGIGIDISGTRDIFRAYQQVQAVNGGTGLGLFIAQRIVGAMGGELAVASQPGVGTAFSFPVVAPALGHALVPVSELVRRFHPGDEAGPERVAPAMDGPPDDALDALILLARDGRLTDIETWLGQVADEHGYAAFVQRVREHLDTLDLHAIEKLAGALKRVRVASASFDAEADAAGPA
>NZ_CP013399.1|WP_034191804.1|989854_990745_+|LysR-family-transcriptional-regulator
MDRFHELNAFIAVVEAGGFSAAARRTGDSQSGISKAIGTLESRLGVRLFNRSTRSVTLTDDGQRYYDRTKPLIEELDDADSELASSTHDASGLIRIAVSATFGRLHVLPLIPELLASNPGLQVDLVLSDFVRDMVEDRIDLAIRVGAVHDPDAVVRRVAGTPLVCVGSRRYFEQHGIPRTPAELVDHNCLLYGGLTEAVNWPFTGPQGRFSVAVRGNLSSNSVETIRAGVLAGVGIGLFARISLADELRHPDVMTILDEYVSEVRDISVVWPKRRFVPARVRRATEFFATALPRRV
>NZ_CP013399.1|WP_059562613.1|988994_989735_-|SDR-family-oxidoreductase
MPTLAGKFAVVSGATTGIGFAIAQRFVAEGAHVFIFGRRQAQLDAAAERLGHGVTALQADAASLADLDRVAAAVRDETGRVDIVVSNAGFTEQAPIDTLTPEHFDKAFNLMARGPVFLVQKLLPLMQNRGSIVLVSSAMHVMGIPGHTAYAATKAALRSYARTWAAEFKDRGIRVNMLSPGVTDTPILDAQTATRDELVSMYRSMVPLGRLARADEIASAALFLASDESSYVTGADLMADGGIGQV
>NZ_CP013399.1|WP_059562610.1|987192_988713_-|sensor-domain-containing-diguanylate-cyclase
MSASTSIEKIADWAGRHYLVVGALGTLMSLAALSISAITLWATRSEVVEHAHETSRNVAAVLVSEIARTVETSNNALVALAADLGKPAVRHMDAGLRHDLLFQRSAAQYVTGMGVTDRDGKLIDACCGPSHHWNFSDRDYFKVHRDAPNVGLYVSEAYRARSRGGKESIALSRRIEQPDHTFNGIAVVAIDLAYFDQLLSRLDVGPHGISAVLRADGTILARNPSLNDHQMVRLRRSNTFDRMLNQDSGFYAAHSRIDGTLRLYTFQRVPGTPLIAVVAPAEGDVLDGFIRMSWSVGISASLLCALFCAVVWLLAFALRDNLRKQTLLTGLSRTDPLTGLHNRRALDFALADQWERLHRNGHGSLSLLFIDADHFKQYNDRHGHARGDTGLRFLAACIRAHTQRRGDFAARYGGEEFVAVLPDTDERGAAKVAEAIRREVERNRLDGFDDPVPAFTVSIGCATARAGWPASVDTWSREADLALYAAKRDGRNRVRHAPSPRNEQAA
>NZ_CP013399.1|WP_059562607.1|985066_987025_-|phosphatase-PAP2-family-protein
MFVSSSRLPLHVAALSTAVVLAACGGGDDVVATPSTNAAIPAPPADPGFVDSAPVPSVPAFVDNIATNQRGDARYATLSTNAAVRVVSRFLDLWQPSTMLVDAGVTAPANGAFPAVSPSTCTGLPGNGTPCGTILNDAVLQANVQYVVNATTARTPQQADAAYYDDRRGKGYSVTDGMGPLTSAWRTAAQQTTSITSVPADATSVLYNDTGNNVGVGGSANASFGKVVDLLNEMGNNASTEPSKRFYKYARPYRWSTSVVVDPTLVPAESTTPATDGGFISGHQAEAMRDAVTMAWLVPERFQEMVGRGLELGENRILAGMHSPLDVIGGRMLALAISAANLAVYANDAQAAYGQAHQTLQQLTGTTDATFQAFARSGTTATDRFADYTTNKTAFARRMTYGFGALDATGAPPVVPKGAEILLQTRFPYLGADQRRVVLKTTELPSGYPVMDDAEGWGRLNLFAAADGYGAFNGNVTVAMDASKGGLNAADLWRNDIAGSGKLTLQGSGVLTLAGNNSYTGGTQVGGGTLAAASATAFGNGDVYVGAGGGVRIAAGAPVTIATRYTQLDGATLELDIDGNGGGRLRVGGAFTVAGGTLHVKFVNGYQPKAGDTIALIDAAAGAAKFATVTVDGFKATPVYTATGVSITLSAA
>NZ_CP013399.1|WP_059562604.1|983147_984671_+|altronate-dehydratase
MNQPAVVILHHDDNVAVALDALAPDVPVDANGTTLRVAAAVPAGHKLATAPIARGARIVKCGQPIGVALRDIAAGEHVHVHNVGMPERHVLDHGAAGAAPDAPTDLGDTFDGFVRPDGRVGTRNYIGVIASVNCSASVCHAIADAYRHEALTPFGHVDGVVAITHQSGCGMAANGDGVELLRRTLVGYARNPNFAGVLLVGLGCEVNQVRVLAERLDAAAPGTVRTLVIQDEGGVRETVARGVSIVRELLEAADGARRRAVPAARLTVGLQCGGSDGYSGITANPALGAAVDLLVRNGGTAILSETPEIYGAEHLLIARAASRDIGERLLGRLRWWERYVADGGGEMNNNPSPGNIAGGITTILEKSLGAVSKGGCSTLRAVYDYAEPVRQRGLVFMDTPGYDPVSATGQIAGGANLVCFTTGRGSVFGSKPVPTVKIATTTGLYERMRADMDFDSGGIVTGSSSVDDAGARLFRLMLDVASGRRTCSEENGIGEREFVPWLRGAIM
>NZ_CP013399.1|WP_059562602.1|982002_983151_+|D-mannonate-oxidoreductase
MTPPILQFGTSRFLLAHVDLFVSQALDEGGAMGGIGIVQSTGNPASRARIDALRSGAHYPVRIRGRDGGRIVDEVVECRAVHRAWDAESDWAEIRRAAIESVRAIVSNTGDAGYRADPHDSAQVLAHPDRAPRGFPAKLLVLLQARWQVRPADGVTMLPCELVADNGDTLRGGVLALAREWRLPDAFVDYLQHRCLWVNSLVDRIVSEPIHPVGAVAEPYALWAIERRAGMALPCRHARIVVTDDLRSHERLKLFFLNLGHSWLAEQWLVTGRPESETVLDAMNDVRLRDGLEAVWRDEVAPVFAALGQQETAERYLDSVRERFLNPYLAHRLADIAGNHREKVARRIAPLLALADSLALPGGQPRLRRIAARCATTGSFAS
>NZ_CP013399.1|WP_034191810.1|980960_981971_+|zinc-binding-alcohol-dehydrogenase-family-protein
MLSVICESPGVLRVQHRELPVRGSGEVLLRVQRVGICGTDLHIFTGNQPYLEYPRVMGHELSAVVVEAEPESGLGVGDAVYVMPYLSCGHCVACRHGNTNCCVNIKVLGVHRDGALAEYLSVPAQFVHKADGISLDQAAMLEFLAIGAHAVRRADIRAGQRALVVGAGPIGMAAMTFAKLRGADVTCLDTRADRLAFCRQHLGVDAAVEVGPDDAARLAALTDGEYFDAVFDATGNLDAMNRGFEFVAHGGKYTLISIVRGHVAFSDPEFHKRETTLLASRNATAEDFATVLDAMRAGRIPDRALNTHRMRLEDVPDALPRLLDAGQTVVKALVEC
>NZ_CP013399.1|WP_059562599.1|980062_980938_+|amidohydrolase-family-protein
MTVRIDAHQHYWRIGARAGNWPPAELDAIHRDFGPADLAPLLDAARIERTVLVQSLPSEADTHYLLDLAADTPTVGAVVGWVDMKADDARARIAAFACAPKARGLRPMLQDLPDDAWIDDPRLDRAVAAMLEHVLSFDALVMPRHLDALHAFARRHPDLPIVIDHGAKPFVERGELQPWLSSMRRLASLPNLHCKLSGLWTEAGPSAGLDAVRARTRPYVRALAELFGPTRLMWGSDWPVLRLASTCGGYGEWLAACEDDCARWLGSAALAGLFGGNARRFYRIDTARHDE
>NZ_CP013399.1|WP_049035342.1|999939_1000335_+|outer-membrane-protein-assembly-factor-BamE
MNANLAKFAAAALVAAAGLTGCATQQGDPPFPSPDTATLPEGTYPNLANLAQVQPGVTKNQLYELLGPPHFHEWIFHVRTWNYLFQFRDAGKVATCQYQVQFDSDSRVAKTRWDKPECEAFGGKGAAGNAG
>NZ_CP013399.1|WP_059562690.1|1000413_1000602_-|hypothetical-protein
MLSVYVVKTGEQFLCTAEDGDIGMAPAVEDATSFRSYEESEKAAHVHADPGYEIVAVCVLRH
>NZ_CP013399.1|WP_034192020.1|1000764_1000983_+|DUF3820-family-protein
MQTADLAHLVTVTMPFGKYKGRLIADLPGPYLNWLAREGFPRGEIGRQLALMHEIDHNGLRDLLEPLRTRSS
>NZ_CP013399.1|WP_059562626.1|1001206_1007101_+|excinuclease-ABC-subunit-UvrA
MSSSNLIRIRGARQHNLKNLDLDLRTGEMTVVTGPSGSGKSSLVFDTLYAEGQRRYVETFSAYARQFLDRMDRPQVERVDGVPPAIAIDQTNPVRSSRSTVGTMTELNDHLKLLYARAAELFDRQTARQVRHDTPETIYADLVARTRADDPRVVVTFPVELPEAVSDEEIAQWLSASGYTRVQAQREVASPTGPRKMLDVVADRFRVQQADKVRVVEAIEASLKRGGGRVNVYVLAPEAEHAVAEPQVWRFSTGLHDPDSDLRYAEPQAALFSFNSAYGACETCRGFGRVIGVDLGLVIPDARKTLRGGAIKPMQTPAWKECQDDLMRYAAKAGIRRDVAWSELTDAERDWVVNGSPDWNGKWQSQWYGVKRFFGYLESKAYKMHIRVLLSKYRSYTPCDVCGGARLKTESLQWRLGSKENADGVLAPAERFMPRGVDWSRAQLEALPGLTVHDLMLLPIERIRRFFDGISLPSALLDDALKLLLAEVRTRLKYLCDVGLGYLTLDRQSRTLSGGEVQRINLTTALGTSLTKTLFVLDEPSIGLHPRDLTRIVEAMQRLRDAGNTLVVVEHDPSVMLAADRLIDMGPGPGERGGTIVYDGTPADIRSAPTLTGEYLGGRKQVAHASNWARRAVDAHTPRIVLEGASEHNLRDVTVEIPLQRLVCVTGVSGSGKSTLLQDVLYPAMARHHGKATESPGAYRSLTGADQVGDVVFVDQSPIGKTTRSNPASYVGAFDEIRKLFAKAPLALQRGYGAGTFSFNSGDGRCPTCGGSGFEHIEMQFLSDVYLRCPDCDGSRYRAEILEVRIERGGRALNIADVLDLTVSEAAAFFATDAEVLRVLQPIVDVGLEYVKLGQPVPTLSGGEAQRLKLAGFLAESAAAANGRRVATEEARIARAKLFMFDEPTTGLHFDDIAKLMQAFGKLLAAGHSLIVIEHNLDVIRAADWLIDLGPEGGDGGGLVLCAGTPDDVKACAESHTGVALLQYDREMDAEAALADEGVPLQAVLNAARERRAIEGEDVVRIVNAREHNLKALDVDIPHGKFNVITGVSGSGKSTLAFDILFHEGQRRYLESLNAYARSIVQPAGRPEVDAVYGIPPTVAIEQRLSRGGRKSTVATTSEVWHFLRLLYVKLGLQHCIHDGTPVTSQSVESIAAQLLRDHRGEHVGLLAPLVVNRKGVYTDLAKWAKARGSTHLRVDGEFVPVDPWPKLDRFREHTIELPVADLVVSPDNEAELRRRLDETLELGKGVMHLLAPLDGLHDAMRNNHSTARVGTVKVLSVKRACPVCGTSYPELDPRMFSYNSKHGWCTTCVGTGVTLTREQRAAYDDTVLAEDGRGREQTLPSDEQEPEGVGNEPCPDCGGTRLNPTARAVTFDAHPIVEVAQWTVSDTRRWIDALELTGRDAQIARDIVSEIGSRLAFLEEVGLGYLSLDRAAPSLSGGEAQRIRLAAQLGSNLQGVCYVLDEPTIGLHPRDNQILLDALRKLGDKGNTLVVVEHDEDTIRRADHIIDIGPGAGKRGGALVAQGAVADLAAQADSVTGRLLARPMTHPLQPRRSVSLPGKKGGAAVPEAWLTVHGARLHNLRDVTVGIPLARLVAVTGVSGSGKSTLARDVLMTNLLDAVGRSVLSSPATRRARKAAQQDAPAANRRSSVLARSAPRPSLNVTHAWQGCASLSGWEQIDRVLEVDQTPIGKTPRSCPATYIGVWDTIRKLFADTLEARARGYTASRFSFNTGDGRCPACEGQGVRTIGMSFLPDVKVPCDVCHGQRFNPETLAVTWRGRNIGDVLTMEIDEAVEFFAPISNIAHPLQLMKDVGLGYLTLGQPSPTLSGGEAQRIKLVTELTKVRDDITRRGQKAPHTLYVLDEPTVGLHMADVAKLIRVLHRLVDAGHSVVVIEHDLDVIAEADWIIDLGPEGGVGGGTIVAAAPPEALVKVGASHTGQALKPVLARTSSDEGEAEREGEARVG
>NZ_CP013399.1|WP_059562628.1|1007180_1007915_-|ABC-transporter-substrate-binding-protein
MPIASSVRSAFTPTGKLRASINLGNPILANRDPATGEPFGVSIDLARAFAERLSAELELVVFDTAGQSVQALTEERADFGFFAVDPLRGETVAFTAPYVLIEGFYLVPDASPIRTNADVDQPHNRVAVGKGSAYDLFLTRELKAARIVRAPTSQAVVPTFLEQHLEVAAGVKQQLEADAAKTTGLRLLDARFMEIRQAMGVPKSRGEAAAAVLNAFVEDMKASGFVAESLRRHGITGASVAPAV
>NZ_CP013399.1|WP_034191798.1|1008025_1008508_-|cupin-domain-containing-protein
MSRPDFIKHWTELEEPDAHCYRGDTEPMALDAPLSAALGITRIGIHHVRLLPGRRTSYPHAESTEQEFVYVLEGKPDVWIDGVLHPVAEGDSVAFPAGTGICHTFINNTKDEVRLMVIGERPRDDNRIRYPLNEAYERTRADRWVDWPDRPLGPHDGMPD
>NZ_CP013399.1|WP_059562633.1|1008573_1009482_-|alpha/beta-hydrolase
MPHTLLRHVLSTLVAMLAALAVISTAGAATTNYTVTAPDGVTLAVQESGNPSGPAIVLIHGLLGSHLNWDAQVDSALLQRYRIITYDLRGHGLSGKPAGTAAYLDGRRWADDLAAVIASSHANRPVLVGWSLGGAVISNYLAAHGDSRIAGAVYVDGVIELKADQLVAHADIYRDIISADLKTHLDGERAFLGQCFHTQPDTATADRLLANAAMASWDMQRAVPSMTVAAAEGLGNTRVPVLLLYGERDALVNTHGAIARAKAIAPRVQIRLYANSGHAPFIEEPARFNRDLADFVDRVATH
>NZ_CP013399.1|WP_034191796.1|1009570_1009957_+|MerR-family-transcriptional-regulator
MTRSPGQNLLTIGELARQTGASVRSIRHYDEQGLLTSVRASNGYRAFPAAAVTQVRQIQRMIATGFSLAEIRSFPDCMRMIEGAGACPETTDAQRKRLASIERQIADLERRRARLLKTLAEGAVPPLD
>NZ_CP013399.1|WP_059562636.1|1009982_1010228_+|hypothetical-protein
MLIMQGLQDLQVGSADAQRLKQANPAVELVLVADANHVLKAVHTADRRANLAAYPDPDLPLADGIVERIAAFVWKSTTGQR
>NZ_CP013399.1|WP_049034464.1|1010470_1010875_+|hypothetical-protein
MAKPILIVLLKGPFPEAFYFVETLLKPLGFLLANPDSGRITHWSDDGQQIEVSRAKIVDEASTGVVKNVQFWRSDSDDLFVSWIDASPGWEFSFHLNGVIPELKIALVTALASAILVDLKLQYEDESAFRIDFD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP013399_1	1.2\|997388\|43\|NZ_CP013399\|CRT	997388-997430	43	NZ_CP013399.1	997259-997301	1	0.977
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NZ_CP013400.1	2602961-2602988	2	0.929

1. spacer 1.2|997388|43|NZ_CP013399|CRT matches to position: 997259-997301, mismatch: 1, identity: 0.977

acgtcgctgtcgacgggcctgagttcgaccaacagcacggtga	CRISPR spacer
acgtcgctctcgacgggcctgagttcgaccaacagcacggtga	Protospacer
******** **********************************

2. spacer 1.1|997334|28|NZ_CP013399|CRT matches to position: 2602961-2602988, mismatch: 2, identity: 0.929

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
tcgtcggcaaacagctcgatcacgtcgt	Protospacer
** ************ ************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP013399_1	1.2\|997388\|43\|NZ_CP013399\|CRT	997388-997430	43	NZ_CP013426	Burkholderia sp. MSMB0856 plasmid pMSMB0856, complete sequence	151743-151785	3	0.93
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	439328-439355	5	0.821
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NZ_CP015737	Shinella sp. HZN7 plasmid pShin-01, complete sequence	117289-117316	5	0.821
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	2094374-2094401	5	0.821
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1023232-1023259	5	0.821
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	351739-351766	5	0.821
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NC_020839	Rhodobacter phage RC1 genomic sequence	1877-1904	6	0.786
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NC_020866	Rhodovulum phage RS1 genomic sequence	37864-37891	6	0.786
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1403124-1403151	7	0.75
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NC_013283	Cronobacter turicensis z3032 plasmid pCTU1, complete sequence	53107-53134	7	0.75
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1221773-1221800	7	0.75
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NZ_CP029341	Streptomyces sp. SM17 plasmid pSM17C, complete sequence	21650-21677	7	0.75
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	1409349-1409376	7	0.75
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	1406077-1406104	7	0.75
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	1584882-1584909	7	0.75
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	1584849-1584876	7	0.75
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	1583643-1583670	7	0.75
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	1583679-1583706	7	0.75
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	1583679-1583706	7	0.75
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	1583668-1583695	7	0.75
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	1583668-1583695	7	0.75
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	1584669-1584696	7	0.75
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	1583679-1583706	7	0.75
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	1583690-1583717	7	0.75
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	1583491-1583518	7	0.75
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	NZ_CP009804	Streptomyces sp. FR-008 plasmid pSSFR2, complete sequence	93-120	7	0.75
NZ_CP013399_1	1.1\|997334\|28\|NZ_CP013399\|CRT	997334-997361	28	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	583543-583570	7	0.75
NZ_CP013399_1	1.3\|997457\|34\|NZ_CP013399\|CRT	997457-997490	34	NC_020866	Rhodovulum phage RS1 genomic sequence	37858-37891	10	0.706
NZ_CP013399_1	1.3\|997457\|34\|NZ_CP013399\|CRT	997457-997490	34	NC_020839	Rhodobacter phage RC1 genomic sequence	1877-1910	10	0.706

1. spacer 1.2|997388|43|NZ_CP013399|CRT matches to NZ_CP013426 (Burkholderia sp. MSMB0856 plasmid pMSMB0856, complete sequence) position: , mismatch: 3, identity: 0.93

acgtcgctgtcgacgggcctgagttcgaccaacagcacggtga	CRISPR spacer
acgtcgctgtccacgggcctgagttcgaccaacagctcggtgg	Protospacer
*********** ************************ *****.

2. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 5, identity: 0.821

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
ccctcggcaaacagcacgatcaggtcgc	Protospacer
.*.************.****** ****.

3. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NZ_CP015737 (Shinella sp. HZN7 plasmid pShin-01, complete sequence) position: , mismatch: 5, identity: 0.821

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
acatgggcaggcagcgcgatcacgtcgt	Protospacer
 * * ****..*****************

4. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 5, identity: 0.821

tcttcggcaaacagcgcgatca-cgtcgt	CRISPR spacer
acttcggcaaacaccgcgatcagcagcg-	Protospacer
 ************ ******** *. **

5. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

tcttcggcaaacagcgcgatca-cgtcgt	CRISPR spacer
acttcggcaaacaccgcgatcagcagcg-	Protospacer
 ************ ******** *. **

6. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 5, identity: 0.821

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
gccttggcaatcagcgagatcacgtcgt	Protospacer
 *.*.***** ***** ***********

7. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NC_020839 (Rhodobacter phage RC1 genomic sequence) position: , mismatch: 6, identity: 0.786

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
tcgtcggcaaacagcgcgaccaccaagg	Protospacer
** ****************.***   *

8. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NC_020866 (Rhodovulum phage RS1 genomic sequence) position: , mismatch: 6, identity: 0.786

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
tcgtcggcaaacagcgcgaccaccaagg	Protospacer
** ****************.***   *

9. spacer 1.1|997334|28|NZ_CP013399|CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.75

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
agaaaggcaaatagcgcgatcacatcgt	Protospacer
     ******.***********.****

10. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NC_013283 (Cronobacter turicensis z3032 plasmid pCTU1, complete sequence) position: , mismatch: 7, identity: 0.75

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
atttcggcaaacagcgcgatatcgttcg	Protospacer
 .******************  ***.

11. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 7, identity: 0.75

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
agaaaggcaaatagcgcgatcacatcgt	Protospacer
     ******.***********.****

12. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NZ_CP029341 (Streptomyces sp. SM17 plasmid pSM17C, complete sequence) position: , mismatch: 7, identity: 0.75

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
gaggcggcgaacagcgccatcacgtcgg	Protospacer
    ****.******** *********

13. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.75

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
agaaaggcaaatagcgcgatcacatcgt	Protospacer
     ******.***********.****

14. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.75

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
agaaaggcaaatagcgcgatcacatcgt	Protospacer
     ******.***********.****

15. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.75

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
agaaaggcaaatagcgcgatcacatcgt	Protospacer
     ******.***********.****

16. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.75

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
agaaaggcaaatagcgcgatcacatcgt	Protospacer
     ******.***********.****

17. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.75

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
agaaaggcaaatagcgcgatcacatcgt	Protospacer
     ******.***********.****

18. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.75

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
agaaaggcaaatagcgcgatcacatcgt	Protospacer
     ******.***********.****

19. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.75

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
agaaaggcaaatagcgcgatcacatcgt	Protospacer
     ******.***********.****

20. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.75

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
agaaaggcaaatagcgcgatcacatcgt	Protospacer
     ******.***********.****

21. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.75

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
agaaaggcaaatagcgcgatcacatcgt	Protospacer
     ******.***********.****

22. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.75

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
agaaaggcaaatagcgcgatcacatcgt	Protospacer
     ******.***********.****

23. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.75

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
agaaaggcaaatagcgcgatcacatcgt	Protospacer
     ******.***********.****

24. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.75

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
agaaaggcaaatagcgcgatcacatcgt	Protospacer
     ******.***********.****

25. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.75

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
agaaaggcaaatagcgcgatcacatcgt	Protospacer
     ******.***********.****

26. spacer 1.1|997334|28|NZ_CP013399|CRT matches to NZ_CP009804 (Streptomyces sp. FR-008 plasmid pSSFR2, complete sequence) position: , mismatch: 7, identity: 0.75

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
gaggcggcaaacaacgccatcacgtcgg	Protospacer
    *********.*** *********

27. spacer 1.1|997334|28|NZ_CP013399|CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.75

tcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
agaaaggcaaatagcgcgatcacatcgt	Protospacer
     ******.***********.****

28. spacer 1.3|997457|34|NZ_CP013399|CRT matches to NC_020866 (Rhodovulum phage RS1 genomic sequence) position: , mismatch: 10, identity: 0.706

gggttgtcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
gccgcgtcgtcggcaaacagcgcgaccaccaagg	Protospacer
*   .*** ****************.***   *

29. spacer 1.3|997457|34|NZ_CP013399|CRT matches to NC_020839 (Rhodobacter phage RC1 genomic sequence) position: , mismatch: 10, identity: 0.706

gggttgtcttcggcaaacagcgcgatcacgtcgt	CRISPR spacer
gccgcgtcgtcggcaaacagcgcgaccaccaagg	Protospacer
*   .*** ****************.***   *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

28962 : 35227

Escherichia_phage(57.14%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034192083.1\|28962_29967_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	7.4e-78	45.4
WP_059560906.1\|29963_30848_-	dTDP-4-dehydrorhamnose reductase	A0A1D7XFA3	Escherichia_phage	1.0e-30	34.8
WP_049029918.1\|30844_31417_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	4.1e-49	53.4
WP_059560909.1\|31413_32310_-	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	2.9e-97	58.1
WP_059560912.1\|32352_33732_-	MFS transporter	A0A0M3UL24	Mycobacterium_phage	3.0e-29	29.5
WP_059560915.1\|33728_34448_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	3.7e-15	29.2
WP_049033652.1\|34444_35227_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	8.8e-10	28.6

DBSCAN-SWA_2

108979 : 116530

Burkholderia_phage(83.33%)

capsid,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059561022.1\|108979_109525_+	hypothetical protein	R4JDM9	Burkholderia_phage	4.2e-67	72.2
WP_059561025.1\|109581_109932_+	hypothetical protein	NA	NA	NA	NA
WP_156810497.1\|110064_110322_+	hypothetical protein	R4JGF4	Burkholderia_phage	1.5e-38	82.4
WP_156444818.1\|110446_111094_-	hypothetical protein	NA	NA	NA	NA
WP_059561029.1\|111163_112231_-	phage late control D family protein	K4PAY4	Burkholderia_phage	3.5e-142	72.6
WP_082744761.1\|112227_112671_-	hypothetical protein	A4JWS2	Burkholderia_virus	7.4e-06	54.5
WP_082744756.1\|112640_113573_-\|capsid	GPO family capsid scaffolding protein	E5FFI7	Burkholderia_phage	2.4e-70	55.0
WP_059561035.1\|115492_116530_+\|portal	phage portal protein	E5FFI9	Burkholderia_phage	6.8e-135	65.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP013398

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013398_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013398_1

1311659-1311756

Orphan

Consensus_repeat	Method
GAAGGACGCGATGGGCCACGACGCGATGGCCAAGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013398_1

>merge|NZ_CP013398|1|1311659-1311756|CRISPRCasFinder
GAAGGACGCGATGGGCCACGACGCGATGGCCAAGGACGGCGCGATGAAGAAGGACGGCATGAAGAAGGACGGCATGAAGCACGACGCGATGAAGAAGG

>NZ_CP013398|1|1|1311659-1311756|CRISPRCasFinder
GAAGGACGCGATGGGCCACGACGCGATGGCCAAGG	ACGGCGCGATGAAGAAGGACGGCATGAA
GAAGGACGGCATGAAGCACGACGCGATGAAGAAGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013398.1\|WP_059560616.1\|1309124_1311041_-\|phosphomethylpyrimidine-synthase-ThiC	unknown	unknown	gnl\|CDD\|236451
NZ_CP013398.1\|WP_059560618.1\|1302719_1305035_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|236783
NZ_CP013398.1\|WP_059560608.1\|1317338_1318370_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226361
NZ_CP013398.1\|WP_059560624.1\|1295683_1299022_+\|exodeoxyribonuclease-V-subunit-gamma	unknown	unknown	gnl\|CDD\|335690
NZ_CP013398.1\|WP_034186587.1\|1312560_1313349_+\|molybdopterin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|239026
NZ_CP013398.1\|WP_049035319.1\|1307168_1308095_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP013398.1\|WP_021162063.1\|1308679_1308892_-\|glycine-zipper-2TM-domain-containing-protein	unknown	unknown	gnl\|CDD\|182532
NZ_CP013398.1\|WP_049035318.1\|1305463_1306744_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|238923
NZ_CP013398.1\|WP_059560605.1\|1320132_1321161_-\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|270267
NZ_CP013398.1\|WP_059560627.1\|1293211_1295503_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372320
NZ_CP013398.1\|WP_034186592.1\|1319290_1320115_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223629
NZ_CP013398.1\|WP_059560621.1\|1299018_1302723_+\|exodeoxyribonuclease-V-subunit-beta	unknown	unknown	gnl\|CDD\|236784
NZ_CP013398.1\|WP_059560610.1\|1316427_1317252_-\|phosphodiesterase	unknown	unknown	gnl\|CDD\|277347
NZ_CP013398.1\|WP_049033538.1\|1321224_1322250_-\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|380505
NZ_CP013398.1\|WP_034186583.1\|1308236_1308485_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378701
NZ_CP013398.1\|WP_034186580.1\|1305031_1305436_+\|aminoacyl-tRNA-hydrolase	unknown	unknown	gnl\|CDD\|181730
NZ_CP013398.1\|WP_034186586.1\|1311898_1312531_+\|DUF4405-domain-containing-protein	unknown	unknown	gnl\|CDD\|226602
NZ_CP013398.1\|WP_059560749.1\|1313874_1315053_+\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|183067
NZ_CP013398.1\|WP_059560613.1\|1315074_1316274_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
NZ_CP013398.1\|WP_034186591.1\|1318383_1319280_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|224098

Protein	Function_ID	Function_description	E-value
NZ_CP013398.1\|WP_059560616.1\|1309124_1311041_-\|phosphomethylpyrimidine-synthase-ThiC	gnl\|CDD\|236451	PRK09284, PRK09284, thiamine biosynthesis protein ThiC; Provisional.	0
NZ_CP013398.1\|WP_059560618.1\|1302719_1305035_+\|AAA-family-ATPase	gnl\|CDD\|236783	PRK10875, recD, exodeoxyribonuclease V subunit alpha.	1.24258e-74
NZ_CP013398.1\|WP_059560608.1\|1317338_1318370_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	3.0778e-134
NZ_CP013398.1\|WP_059560624.1\|1295683_1299022_+\|exodeoxyribonuclease-V-subunit-gamma	gnl\|CDD\|335690	pfam04257, Exonuc_V_gamma, Exodeoxyribonuclease V, gamma subunit. The Exodeoxyribonuclease V enzyme is a multi-subunit enzyme comprised of the proteins RecB, RecC (this family) and RecD. This enzyme plays an important role in homologous genetic recombination, repair of double strand DNA breaks resistance to UV irradiation and chemical DNA-damage. The enzyme (EC:3.1.11.5) catalyzes ssDNA or dsDNA-dependent ATP hydrolysis, hydrolysis of ssDNA or dsDNA and unwinding of dsDNA. This family consists of two AAA domains.	0
NZ_CP013398.1\|WP_034186587.1\|1312560_1313349_+\|molybdopterin-dependent-oxidoreductase	gnl\|CDD\|239026	cd02108, bact_SO_family_Moco, bacterial subgroup of the sulfite oxidase (SO) family of molybdopterin binding domains. This domain is found in a variety of oxidoreductases. Common features of all known members of this family, like sulfite oxidase and nitrite reductase, are that they contain one single pterin cofactor and part of the coordination of the metal (Mo) is a cysteine ligand of the protein and that they catalyze the transfer of an oxygen to or from a lone pair of electrons on the substrate. The specific function of this subgroup is unknown.	3.63859e-89
NZ_CP013398.1\|WP_049035319.1\|1307168_1308095_-\|DMT-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	4.0758e-14
NZ_CP013398.1\|WP_021162063.1\|1308679_1308892_-\|glycine-zipper-2TM-domain-containing-protein	gnl\|CDD\|182532	PRK10540, PRK10540, osmotically-inducible lipoprotein OsmB.	1.19975e-09
NZ_CP013398.1\|WP_049035318.1\|1305463_1306744_-\|EAL-domain-containing-protein	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	7.95618e-57
NZ_CP013398.1\|WP_059560605.1\|1320132_1321161_-\|extracellular-solute-binding-protein	gnl\|CDD\|270267	cd13549, PBP2_Fbp_like_3, Substrate binding domain of an uncharacterized ferric iron transporter, a member of the type 2 periplasmic binding fold superfamily. The periplasmic iron binding protein plays an essential role in the iron uptake pathway of Gram-negative pathogenic bacteria from the Pasteurellaceae and Neisseriaceae families and is critical for survival of these pathogens within the host. This periplasmic domain (Fbp) has high affinity for ferric iron and serves as the primary receptor for transport. After binding iron with high affinity, Fbp interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The ferric iron-binding proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	3.54776e-163
NZ_CP013398.1\|WP_059560627.1\|1293211_1295503_-\|hypothetical-protein	gnl\|CDD\|372320	pfam12805, FUSC-like, FUSC-like inner membrane protein yccS. This family has similarities to the fusaric acid resistance protein family. The proteins are lodged in the inner membrane.	1.98238e-80
NZ_CP013398.1\|WP_034186592.1\|1319290_1320115_-\|ABC-transporter-permease	gnl\|CDD\|223629	COG0555, CysU, ABC-type sulfate transport system, permease component [Posttranslational modification, protein turnover, chaperones].	3.82505e-44
NZ_CP013398.1\|WP_059560621.1\|1299018_1302723_+\|exodeoxyribonuclease-V-subunit-beta	gnl\|CDD\|236784	PRK10876, recB, exonuclease V subunit beta; Provisional.	0
NZ_CP013398.1\|WP_059560610.1\|1316427_1317252_-\|phosphodiesterase	gnl\|CDD\|277347	cd07402, MPP_GpdQ, Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain. GpdQ (glycerophosphodiesterase Q, also known as Rv0805 in Mycobacterium tuberculosis) is a binuclear metallophosphoesterase from Enterobacter aerogenes that catalyzes the hydrolysis of mono-, di-, and triester substrates, including some organophosphate pesticides and products of the degradation of nerve agents. The GpdQ homolog, Rv0805, has 2',3'-cyclic nucleotide phosphodiesterase activity. GpdQ and Rv0805 belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	6.00098e-89
NZ_CP013398.1\|WP_049033538.1\|1321224_1322250_-\|substrate-binding-domain-containing-protein	gnl\|CDD\|380505	cd06282, PBP1_LacI-like, ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type 1 periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.	8.55429e-128
NZ_CP013398.1\|WP_034186583.1\|1308236_1308485_-\|hypothetical-protein	gnl\|CDD\|378701	pfam11737, DUF3300, Protein of unknown function (DUF3300). This hypothetical bacterial gene product has a long hydrophobic segment and is thus likely to be a membrane protein.	0.000241801
NZ_CP013398.1\|WP_034186580.1\|1305031_1305436_+\|aminoacyl-tRNA-hydrolase	gnl\|CDD\|181730	PRK09256, PRK09256, aminoacyl-tRNA hydrolase.	1.8406e-68
NZ_CP013398.1\|WP_034186586.1\|1311898_1312531_+\|DUF4405-domain-containing-protein	gnl\|CDD\|226602	COG4117, COG4117, Thiosulfate reductase cytochrome B subunit (membrane anchoring protein) [Energy production and conversion].	9.00114e-50
NZ_CP013398.1\|WP_059560749.1\|1313874_1315053_+\|EamA-family-transporter	gnl\|CDD\|183067	PRK11272, PRK11272, putative DMT superfamily transporter inner membrane protein; Provisional.	4.28518e-55
NZ_CP013398.1\|WP_059560613.1\|1315074_1316274_-\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.67776e-62
NZ_CP013398.1\|WP_034186591.1\|1318383_1319280_-\|ABC-transporter-permease-subunit	gnl\|CDD\|224098	COG1177, PotC, ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism].	6.82391e-47

>NZ_CP013398.1|WP_059560616.1|1309124_1311041_-|phosphomethylpyrimidine-synthase-ThiC
MNANPKFLSADAHVDAAAVAPLPNSRKVYVTGSQPDIRVPMREITQADTPTGFGGEKNPPIYVYDTSGPYTDPDAKIDIRAGLPALRQRWIEARGDTDVLSGLSSQYGLERAADPATADLRFPGLHRNPRRAQAGKNVTQMHYARQGIITPEMEYIAIRENQRRAEYIESLKSSGPNGAKLAAMMGRQHPGQAFGANALAEITPEFVRDEVARGRAIIPANINHPESEPMIIGRNFLVKINANIGNSAVTSSIGEEVDKMTWAIRWGGDTVMDLSTGKHIHETREWIIRNSPVPIGTVPIYQALEKVNGKAEDLTWEIFRDTLIEQAEQGVDYFTIHAGVRLQYVPLTANRMTGIVSRGGSIMAKWCLAHHKESFLYEHFEEICEIMKAYDVSFSLGDGLRPGSIYDANDEAQLGELKTLGELTQIAWKHDVQVMIEGPGHVPMQLIKENMDLQLDWCKEAPFYTLGPLTTDIAPGYDHITSGIGAAMIGWFGTAMLCYVTPKEHLGLPNKDDVKEGIITYKLAAHAADLAKGHPGAQVRDNALSKARFEFRWEDQFNIGLDPDKAREFHDETLPKDSAKVAHFCSMCGPHFCSMKITQDVREFAAQQGVSETEALKKGMEVKAVEFVKTGAEIYHRQ
>NZ_CP013398.1|WP_021162063.1|1308679_1308892_-|glycine-zipper-2TM-domain-containing-protein
MNSIRRFGVCALLVATVASLSACDSMSRRQRDTAIGAGVGGVAGAAIGGSALSTLGGAAAGGIIGNQVGK
>NZ_CP013398.1|WP_034186583.1|1308236_1308485_-|hypothetical-protein
MNRTLVAAALACTTLAGCYYPYGYYPGGYYTAAPVQPAPVYVDPGPAYYYPAPAYAPAWGGYWGPALSLNFGFGGRGGWRHH
>NZ_CP013398.1|WP_049035319.1|1307168_1308095_-|DMT-family-transporter
MSPKNAFLLTVLAALWGASFLFIRIGVIDLGVAPLMALRVGIGALFLTGFALTRFKPADLGARLRRHAWPLFVVGALNSGIPFCLFAFAELTLSAGLTSVINATTPLWGALVAYLWLKDKLSLPRALGLVIGFAGVLTLVWNQIANAHGDTGASATALAAAAALGATLLYGIAANYTKRTLGGVDPLVNAAGSMIGSTLLLLPFAIATWPAAPVSAHAWGAVLALGIACTGIAYFIFFYLIAHVGPARAITVTFVIPVFGLLWGALFLGEHVSAVMIEGCAIVLVGTALATGVIKRIPGIRPRGGEAA
>NZ_CP013398.1|WP_049035318.1|1305463_1306744_-|EAL-domain-containing-protein
MKPARDLSLDSLLERLTPTPGGWVATFRTTTLRSVFQPVLSITHKRVVGYEALLRVVDADGTLLSPTALFDKTRADADALLLDRLARCLHTANFVAQGIGDGWLFLNVTPRVLDTGLVQREFVEALCRHFGLPPNRIVLEVVEQPARDEAALARTIDMIQHRDFLIAIDDFGTGFSNFDRVWRARPDIVKLDRSLVERATGSADDRRIMHHLVSMLHQAGAMVLAEGVESDDALQTLMEADIDFVQGFQFGQPDASIAHASAAAPAMLDAAWQRFIARRRPPVIAEQPGFDAIERLVLGGAAAFSASGNLQDAAQRVFTVPAARRVFVTDEIGEQFLPSITARPDDGQAVAARLAPLFPETHSNWSRRPYFQRAIAAPGRVALMGPHFSLTEGRDCYTAAVAIRARSRLVVFCVDFVLDSAGTVMR
>NZ_CP013398.1|WP_034186580.1|1305031_1305436_+|aminoacyl-tRNA-hydrolase
MMIRYTLDPAEVEWTAVRAQGAGGQNVNKVSSAIHLRFDIRASSLPPVIKERLLALSDQRITRDGIVVIKSQEYRTQEKNREAALARLDSLISSVAFTPRARVATRPTRASKERRLEHKSRRSVVKSGRGKVID
>NZ_CP013398.1|WP_059560618.1|1302719_1305035_+|AAA-family-ATPase
MNASDDTLEFTGGLVARLPEPADFGIALAEGFARRIGDLARRAGAPSAAARWAARAAFATSRATAGGHVCVALGALAQRYETPLDEVRAALAASGVVAFGTLARGDERPLIVDRHDHLYLSRYFDYERRLADALVAQAGVAGPDEGLSPDRLRDSLARYFGPANGEVDWQRVAAIVALTGRVTIVSGGPGTGKTTTVVGVLACLLDAHPGLRIALAAPTGKAAQRMQEALHARAGDLPPELAARLPDTSYTLHRLLGGGGAAGFRHHRDNPLPYDLIVVDEASMIDVALAAHLLDALAPGARLVLLGDKDQLAAVEAGAVFAELSARPAFTAAARTRIAQALGIDEATFVAALPVPDEAAIATAAGVPAARPASVSAQALPSASASVSRKPASRQKADPRQASLFDDEPQDDEVSSAEIVSPPPVVPAPADVGGTVTAGETPAWIEVDELAWLDAVELPPFDAGDAALASVTAATSASTGEVDAAAAVARAPAPLADCVVWLERNYRFGLDSPIGRLSVAIRGGDVQAALDALPADDTAAASFHDDAGDTLASSTVERLARRFGAYLDALRAALDAPVPDPLPLFDALNRFRILCATRNGSRGAEHVNALVAAHVRHAARVPLAVGAHWFTGRPIMVTRNDYALGLFNGDIGIALPDAHGVLRVWFRRADGTARAVSPAALPPHETAFALTVHKSQGSEFDEAALVLPASFSRVLTRELVYTAVTRARTRVQVIGPRRVLAQAVATRTQRDSGLAARVDEALARHRTEVSR
>NZ_CP013398.1|WP_059560621.1|1299018_1302723_+|exodeoxyribonuclease-V-subunit-beta
MSAVSQPQQALELDVFACPLDGVNQIEASAGTGKTWNICALYVRLLLEKDLGADEILVVTFTKAATAELHERVRSRLAQLAHALDTGDDGGDPFISRLLETTLGADGVLDSETAAKRIRRALRAFDQAAIHTIHAFCQRALQEAPFAAAMPFAFDMEADDASLRFELAADFWRTRVEPAAARWPGFATWLVESGAGPAALDAQLARRLKKPLAALRWDGVTEPDESAEAAAAECFAEAARLWAAERETIDALLRAAQPALNQRSHKPDAVADALAAWTAHFAQGDATAALPKAALKLTQSALTKATKKGGVTPEHAFFDVADALEAAVAAAEATQRARWLALIADWLDVAPGELAERKRTRRVVSFDDLLANLYHALRAHPWLAETLRARYPAALIDEFQDTDPLQFAIFDRIFAPGGPLFLVGDPKQAIYSFRAADLHTYLAARARASACYTLAVNQRSTPAIVDACNRFFMSNPRAFVLDGLDYYAVRAGTRVRAPFVDETDPGPSGDFRVWALPGGEGTLLKRDAQAQAAQACAAEIARLMRGAREGQVRLGDTPLSPGDIAVLVQTHRQGSLVKRVLATWGIGSVELAQASVFSTGDAEQLERVLAAIDAPGDLRRLRAALASDWFGLDAGALWRMEQGDGDASSGASDSTDAMSWVERFSRYRLVWRERGFAVMWRTFTRELRIAERLMAGADGERRVTDINHLAELTQARASAQPGIAPTLRWLAAQRLDGGGEEAQLRLESDRNLVQIVTVHKSKGLEYAIVFCPFLNDGGLREPPASALPDAREYHDEAGDAVLHYGCDDEAAAHAARQALREQAAERARLVYVALTRAVYRCYVVAGPYLSSRSTREARRSVLNWLVAGAGQSFDAWLDEPPDEAALEAAWRALAGGPVSVAPLPVPARRERLAAGHDASQALAARHATRVLRDAWRMASFSSLTASMAREEAGVAAVPDDELRPDHDALAEVTPDGEWHFSEPAAAEPPDDDILVFPRGAAAGECLHRLFELSRFTEPESWHAAALGALHDRPVEAEPELATRLPAMMAQLVDDVVHTELVPGMRLADLDPAKRLDEMGFLFPAPSLDLAALRRLLVAHGYPDVALEAGTLAGFIKGFIDMIVEHDGRFWIVDWKSNHLGTTPDAYGPRALDVAMADHAYHLQALLYTVALHRYLRGRLPDYDYDTHIAGYLYLFVRGVRPGWRSGGEPSGVHARRPARALVEALDRMMEGRRA
>NZ_CP013398.1|WP_059560624.1|1295683_1299022_+|exodeoxyribonuclease-V-subunit-gamma
MLHLFYSNRHETLADALLEDLAAFPARNGPWAPQQVIVPSAALRRRLELDIAARNGVCANVEFTYLAQWLWAQIGRVMEVPKRSPFAPDRLVWRCYRLLAQAAGGAPWLASPRLAAYLSASDDAMRYELAHRVAAVLDHYLTYRPEWLAAWQAGESVLAGDAAPRGISDAARDDERWQAALWRALLAELSDSGTPPAHRFLVEARHLDAETVARADWPESVSVFALPTMPPLHVALLRELSRWIDVRVYALNPCREFWFDIVTAAHAETLDAAGRLDYQEVGHPLLAEWGRQTQAQLHMLHELTESAASGDASRFVENPAPTWLARVQNAILELRPEAETGDTPAERGIEVHVCHSLARQLEVLHDRLLAWFDADASLQPSDVLVAVADLAAAGPLIDAVFGTAGAGGARVPYRITGLPPSQANPVARVLLDWLTLPERQVGAPELVEWLRVDAVAARYDIDAAALETVQTWLAAAGARRGLSPLVSGDAAVPAPRHTFSDALARLFLGYAMPEGAAPIGAWLPIEAATGSEAELLGRLARFTDDLDGFARRLAESHTPSGWSELFADTLARFFDSGAAYADALAGVRDALDAMLAAMTEGAPDEALPAAVVRAGLAAALDDPARGGVPWGGVTFSSLTSLRGLPYRVVCLLGMDDGVLPSLARADEFDLMAVLPKLGDRQRRDDERNLFLDLLLAARDRLLIAYTGRSIRDNAPLPPAALVDELLDHLAIVTAGPDAAPDAVDAARRAFIVEHPLQPFAAAYFQPGSALVSYDAERATLASLLAAEASRDGPRELPFFAQPLPAEPVEPVAFSEFERFWRHPARALLRGRLGIVLADAQAELLDTEPFSLDFAGSDALAERVLPLLIESDEGTVHDHALRIADASPELPGGATGTVWRDQALGSMTQLASSVRRALADGIERRPFSLTVVPAWPDTEQALFGTDDAMLSADAVSAPLELQGTLNRLTPAGQIIYRYARPSARDYLSAWLAHLVYCAVEPGGPRRTLWFGSGGAFELTPVAAPLERLAPLAALFRAGRRMPLRFFPRSAWARVSDGEAKAASVWINERVVSEADDPAIAIAWRGAHPSLDEPFGTLARLVFEPLIEHLKEVA
>NZ_CP013398.1|WP_059560627.1|1293211_1295503_-|hypothetical-protein
MRYSVEIRKFFYSQYFFGGLRIAVGVSLPAVLCLIVFHNRELGFTISTGALGACVVDMPGPLKYKHNEMLACSVIGFLAALATGLATPNIFALWLTIVPLTFVLSLIVVYGNRWPQISFATLFMMVMTLEEKFTPLQAFINAGWILAGGLWYTYWATLVSRWQARRIEQQALAESLFACADYLLARAQFYDLDADLDECYRNLVARQITAVETQETARDIVLRNLPKLRRGKLDPGRTTMYNLFINSVDLHELFVGAHTDYPLVRNTFGGSDLIIFYRDLIRKAAADLEEIGLAVLENRAPHSRISVKAELRAIEYEIELMRKKNFAATNAEAYAAVLATFRRIWSATRLIDRMRRNLSGHADPQQTELKIDKALTRFLQRRRMSPLLIFSNLNMRSPSFRHALRVTIAVAVGFWIGRLLPLTNAYWIVMTTIIILKPGYSLTKQRNAQRIIGTLIGCAASIALIYTVKEPHLLIAIMFGSMVMSYSLLLFNYAASVVFTSSYVLLMFHLLAPGSMRIIGERAIDTVVGCMIAIAASRLFPYWEYRLMGKQVADMLTATRKYFEAVWRAGRGASSPPVPAADGAAVVPVVAAAVETPATSLDDDYRYRLARKDVHIAFANLGQAFQRMMIEPKAHQRFVPELNDLLVQTHVLGAQITAAAPLIRNACSADGSIEHDDALHRGLAAVLDNLEKAEAGEPPPADQLEASKQITRDLDAMVVSAEKSDAVGAELTHDLKVLAHQCKQMLASSLLIRKDASVIRLPA
>NZ_CP013398.1|WP_034186586.1|1311898_1312531_+|DUF4405-domain-containing-protein
MQTVPVTDRTSTPPPAPTIHPPWVRVSHWLNALAAILMALSGWRIYDASPIYPSFTFAHGITLGGWLGGALQWHFAAMWLLVANGLFYLAMSIATGRFARKLLPVTPASVWRDIRAALGGRLAHDDLSVYNAVQRAAYLTAIVDLVVLVLSGLTIWKSVQFPLLRELFGGYDNARVVHFWAMSLLVAFFVVHVAMALLVPRSLLAMLRGR
>NZ_CP013398.1|WP_034186587.1|1312560_1313349_+|molybdopterin-dependent-oxidoreductase
MSESEKSRDEPRWTLDRKSLELDVRRELEMPSRRLFNRRVLTLGGLAMLTGCTLQDDASVNTFLEKVSRMNDRVQAWLFNPDRLAPTYTEADITRPFPFNAYYGIDEVRHVDASTYRLVLSGRVTGKRVWTLDELRALPHAEQITRHICVEGWSAIGRWGGTPFGAFLARAGADTRAKYVGFKCADDYYESIDMPTALHPQTLLALEYDGRQLPPEYGFPMKLRMPTKLGYKNPKHIMEIFVTDTFPGGYWVDQGYNWFGGS
>NZ_CP013398.1|WP_059560749.1|1313874_1315053_+|EamA-family-transporter
MTPLDRLLDFLARFSFRIRLPQSRGGRVALALVFIYFVWGSTYSGLHFALQSFPPLLLSGLRNLLGGIGLFIFALRRKPEWPTLLEIRNAGIVGTMLVALSSGTIALGISSVSSGSAAVMVATVPLFATVIAAVAGRPVTKGEWAAVALGMVGIVVLNSGGAAARNSALGTICVLAGALFWAGGAHLATRLRLPSDLFLSTSLQIGLGGLISTLVAWLIGERIEQVMVGPVFAFLYLMVFCTMAAYVAYGYLIRHTSPIIASSCMYVNPIVAVALGALLLGEPVTMATVVATVAILGSVALSFVFDPARRPAARAAADGSAAVAAEHAPAAAADAAPEQIAIPEAAPILAPSAVPLAVPAPAAVMDPAAVIDPAPAFAPPPVDEPAVPRADA
>NZ_CP013398.1|WP_059560613.1|1315074_1316274_-|MFS-transporter
MSTASTDRPTDTASPHYSRSLLLLLATIAGVSVANIYYNQPLLDSFRSTFPDGASWIGAVPTATQLGYAAGMFLLAPLGDRFDRRGLILMQIAGLSVALIVAATAPSLAVLAAASLAIGVLATIAQQAVPFAAEIAPPAERGHAVGTVMSGLLLGILLARTAAGFVAEYFGWRAVFAASVAALVVLAAVIVMRLPRSSPTSTLSYGKLLGSMWHLAVELRGLREASLTGAALFAAFSAFWPVLTLLLAGAPFHLGPQAAGLFGIVGAAGALAAPYAGRFADTRGPRAIISLAIALLALSFVIFAVSGSSLAGLVIGVIVLDVGVQAAQISNQSRIYALKPDARSRVNTVYMVCYFIGGALGSSAGVAAWHAFGWTGMCATGLLFAALAGWSHHRGGRHG
>NZ_CP013398.1|WP_059560610.1|1316427_1317252_-|phosphodiesterase
MLLAQISDLHIKRPGQLAYRRVDTAAALARCIAKLNALEPRPDAVLVTGDLTDFGHDEEYGNLRGLLAALEIPYYLMIGNHDDRAGLRRAFAARAELQDGAFVQYALDVGAVRVLALDSQVPGASHGDLCDARLAWLAAQLDAARDRPVIVALHHPPFVAGIGHMDKLRLAPAAAAKLDALLRGHPNVERVLCGHVHRTMFTRFGGTLAAAVPSPAHQVAFDLRADAPSAFRLEPPAFAVHRYAPDTGMTSHHVYVDEGAGPYPFYEPTGELVD
>NZ_CP013398.1|WP_059560608.1|1317338_1318370_-|ABC-transporter-ATP-binding-protein
MKLDSTPITLTRCAKTFRGTRVLEPLDLSIGAGETLVLLGPSGCGKTTTLRLIAGLDTPDAGGTIAFGNDDVTALPIERRQVGMVFQNYALFPNLTVRGNVGYGLKIRKTEPRALRERVDELLAMMRLDAHADKPVDQLSGGQRQRVALARALAVRPRVLLLDEPLTALDAKLRDVLRREMNTLLRELGVTTVYVTHDQAEAMELGDRIVVMGAGRIEQIGTPRDIYYHPANRTVAQFIGTLNRLAGQWRDGALVTTGGAIATPHAADEWFFRPEDAQLADPAHAPLRGAVGACAFLGERTRLTIEHAAPDALVIDVPGRIALARGTAVGLTIAPEGLIALGA
>NZ_CP013398.1|WP_034186591.1|1318383_1319280_-|ABC-transporter-permease-subunit
MQSLSSSSAPSPAPAPAQANGVARRAPHVTGARAIAALQWGVTLLLCAFLIVPVVMSVLAGLTVNYFRGLSSGLTLRWLEQVWQQYHGSVALSLEVAFATLAIVLVAGVPAGYALARSKSRVARAIEEALVLPVALPGLASALALLVVYGGFTAFRMSLWFIVVGHVVFTLPFMVRAVAAVAAGADLRTLEEGAASLGASFVTRFVTIVLPNLRPGIVAGALAVLTLSIGEFNLTWMLHTPDTKTLPVGLADTYASLRLEVGSAYTILFLLMTLPLLVAMQWLGVDPSGTRALKQRPR
>NZ_CP013398.1|WP_034186592.1|1319290_1320115_-|ABC-transporter-permease
MLDLTFPLRWRVALVAPALAVFAAFWLLPMAALVQVSADGAFLSHYAALLGNARYMKSLGETVALSAGVTLATLALSTISGLLLARREFAGKRVLLALLTFPLAFPGVVVGFMVIMLAGRQGLIGMLSAKLTGDKWVFAYSVAGLFVGYLYFSIPRVIVTVIAAASKLDASLEEAARSLGASPWRIFVDIVLPALAPGLIAAGAICFATAMGAFGTAFTLATDLNVLPMTIYTEFTLNANIATAAGLSIVLGIVTWAVLALARRFTGHTAAAAA
>NZ_CP013398.1|WP_059560605.1|1320132_1321161_-|extracellular-solute-binding-protein
MSFRLTSLLRALAAPLALAALVAGAPAAHADETAICYNCPPEWADWAAQIAAIKQKTGIRVPFDNKNSGQSIAQLIAEQKSPVADVVYLGVSSAFQAKDKGVIAPYKPAHWNDIPANLKDPQGYWFAIHSGTLGFFVNKDALDGKPVPRSWADLLKPEYKGMVGYLDPSSAFVGYAGAVAVNQALGGSLDNFKPALDWFRKLKANAPIVPKQTAYARVLSGEIPILLDYDFDAYRAKYKDSANVEFVIPKEGTIAVPYVMSLVKGAPHDANGRKVLDFVLSDEGQKLWANAYLRPVRAQALGADVAAKFLPASEYARAKSVDFGKMAAGQQAFGQQYLQVMQ
>NZ_CP013398.1|WP_049033538.1|1321224_1322250_-|substrate-binding-domain-containing-protein
MTSTIKDVAALAGFSIATVSRAINAPHTVSPATLQTIRTAIDTLQFRPSPLGRQLRGERTRLVGVVVPTLSNPVFADCLQGIDALATAAGFKLIVMTTEYDAARERHAIETLREQRVEGLILTVADADTHPLLDMLDRDGPHYVLMHNDTQRRPSVSVDNRRAAYDGVRLLIARGHRRVLMLAGSLAASDRARQRHLGYAQALQESGMATLPPVEVDFNAPELPEAVLAHLTAHATRPTALFCSNDLLAMVVMRGLRRAGFSIPDDLSVLGFDGIAIGELLAPPLASVATPNRDIGRHAWRRLVECIGGTTLERTSLILPHAVRDGATVAPPSIDLQRRQA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP020900	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence	493964-493991	5	0.821
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	1157548-1157575	5	0.821
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	1121683-1121710	5	0.821
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013589	Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence	1010090-1010117	5	0.821
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	1157257-1157284	5	0.821
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	1145101-1145128	5	0.821
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	1030521-1030548	5	0.821
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013536	Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence	946622-946649	5	0.821
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	1100204-1100231	5	0.821
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	1036457-1036484	5	0.821
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	1121683-1121710	5	0.821
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	1030520-1030547	5	0.821
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	1145101-1145128	5	0.821
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP021127	Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence	613641-613668	5	0.821
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	1053564-1053591	5	0.821
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	45802-45829	5	0.821
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_LR594663	Variovorax sp. RA8 plasmid 2	216186-216213	5	0.821
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP044217	Mesorhizobium sp. NIBRBAC000500504 plasmid unnamed, complete sequence	284484-284511	5	0.821
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP006993	Methylobacterium sp. AMS5 plasmid pAMS5a, complete sequence	8554-8581	5	0.821
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	MW042802	Klebsiella phage 066039, complete genome	12112-12139	5	0.821
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP020900	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence	1031261-1031288	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	545204-545231	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	556678-556705	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013589	Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence	543974-544001	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	584768-584795	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	541152-541179	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	571079-571106	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013536	Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence	360441-360468	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	557878-557905	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	555574-555601	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	556678-556705	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	571079-571106	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	541152-541179	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	543110-543137	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP048281	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence	585994-586021	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP021033	Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence	504123-504150	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP021029	Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence	272169-272196	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	970060-970087	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	423246-423273	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	423246-423273	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	421687-421714	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	425934-425961	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	420053-420080	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013515	Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence	267770-267797	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	423246-423273	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	1898771-1898798	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP013605	Rhizobium sp. N731 plasmid pRspN731d, complete sequence	267764-267791	6	0.786
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP025431	Paracoccus zhejiangensis strain J6 plasmid pPZ01, complete sequence	73110-73137	7	0.75
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP039926	Agrobacterium tumefaciens strain CFBP7129 plasmid pAtCFBP7129c, complete sequence	118833-118860	7	0.75
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP033033	Agrobacterium tumefaciens strain 12D1 plasmid pTi12D1, complete sequence	123208-123235	7	0.75
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	73507-73534	7	0.75
NZ_CP013398_1	1.1\|1311694\|28\|NZ_CP013398\|CRISPRCasFinder	1311694-1311721	28	NZ_MK318973	Agrobacterium rhizogenes strain Colt5.8 plasmid pOC-Colt5.8, complete sequence	135584-135611	7	0.75

1. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP020900 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence) position: , mismatch: 5, identity: 0.821

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
gcatcgcgatgaagaaggacggcacgat	Protospacer
.*. ********************.**

2. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 5, identity: 0.821

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
gcatcgcgatgaagaaggacggcacgat	Protospacer
.*. ********************.**

3. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 5, identity: 0.821

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
gcatcgcgatgaagaaggacggcacgat	Protospacer
.*. ********************.**

4. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013589 (Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence) position: , mismatch: 5, identity: 0.821

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
gcatcgcgatgaagaaggacggcacgat	Protospacer
.*. ********************.**

5. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 5, identity: 0.821

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
gcatcgcgatgaagaaggacggcacgat	Protospacer
.*. ********************.**

6. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 5, identity: 0.821

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
gcatcgcgatgaagaaggacggcacgat	Protospacer
.*. ********************.**

7. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 5, identity: 0.821

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
gcatcgcgatgaagaaggacggcacgat	Protospacer
.*. ********************.**

8. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013536 (Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence) position: , mismatch: 5, identity: 0.821

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
gcatcgcgatgaagaaggacggcacgat	Protospacer
.*. ********************.**

9. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 5, identity: 0.821

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
gcatcgcgatgaagaaggacggcacgat	Protospacer
.*. ********************.**

10. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 5, identity: 0.821

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
gcatcgcgatgaagaaggacggcacgat	Protospacer
.*. ********************.**

11. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 5, identity: 0.821

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
gcatcgcgatgaagaaggacggcacgat	Protospacer
.*. ********************.**

12. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 5, identity: 0.821

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
gcatcgcgatgaagaaggacggcacgat	Protospacer
.*. ********************.**

13. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 5, identity: 0.821

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
gcatcgcgatgaagaaggacggcacgat	Protospacer
.*. ********************.**

14. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP021127 (Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence) position: , mismatch: 5, identity: 0.821

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
gcatcgcgatgaagaaggacggcacgat	Protospacer
.*. ********************.**

15. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 5, identity: 0.821

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
gcatcgcgatgaagaaggacggcacgat	Protospacer
.*. ********************.**

16. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 5, identity: 0.821

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
aggacgcgatgaagaaggccgacatgat	Protospacer
* *.************** **.*****

17. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_LR594663 (Variovorax sp. RA8 plasmid 2) position: , mismatch: 5, identity: 0.821

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
aagagacgatgtagaaggacggcatgaa	Protospacer
* *. .***** ****************

18. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP044217 (Mesorhizobium sp. NIBRBAC000500504 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tcagcgccatgaagaaggacggcacgat	Protospacer
 *.**** ****************.**

19. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP006993 (Methylobacterium sp. AMS5 plasmid pAMS5a, complete sequence) position: , mismatch: 5, identity: 0.821

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
ccggcacgatcaagaaggacggcatcac	Protospacer
 ****.**** ************** *

20. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to MW042802 (Klebsiella phage 066039, complete genome) position: , mismatch: 5, identity: 0.821

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
acggcgcgatgaagcaggaaggcgagag	Protospacer
************** **** ***. **.

21. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP020900 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

22. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

23. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

24. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013589 (Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

25. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

26. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

27. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

28. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013536 (Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

29. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

30. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

31. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

32. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

33. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

34. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

35. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP048281 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

36. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP021033 (Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

37. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP021029 (Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

38. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
agggcgcgatgaagaaggccggccaggc	Protospacer
* **************** ****  *.

39. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

40. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

41. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

42. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

43. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

44. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013515 (Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

45. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

46. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tcgccgagatgaagaaggacggcacgct	Protospacer
 ** ** *****************.*

47. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP013605 (Rhizobium sp. N731 plasmid pRspN731d, complete sequence) position: , mismatch: 6, identity: 0.786

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tccgcgccatgaagaaggccggcatgcc	Protospacer
 * **** ********** *******

48. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP025431 (Paracoccus zhejiangensis strain J6 plasmid pPZ01, complete sequence) position: , mismatch: 7, identity: 0.75

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
cgatcgcgatgaagaaggacggcaccat	Protospacer
  . ********************. *

49. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP039926 (Agrobacterium tumefaciens strain CFBP7129 plasmid pAtCFBP7129c, complete sequence) position: , mismatch: 7, identity: 0.75

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
cgagcgcgatgatgaagaacggcatgct	Protospacer
  .********* ****.********

50. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP033033 (Agrobacterium tumefaciens strain 12D1 plasmid pTi12D1, complete sequence) position: , mismatch: 7, identity: 0.75

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
cgagcgcgatgatgaagaacggcatgct	Protospacer
  .********* ****.********

51. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.75

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
tcggcgcgatgaacaaggacgggggcga	Protospacer
 ************ ******** .  .*

52. spacer 1.1|1311694|28|NZ_CP013398|CRISPRCasFinder matches to NZ_MK318973 (Agrobacterium rhizogenes strain Colt5.8 plasmid pOC-Colt5.8, complete sequence) position: , mismatch: 7, identity: 0.75

acggcgcgatgaagaaggacggcatgaa	CRISPR spacer
cgagcgcgatgatgaagaacggcatgct	Protospacer
  .********* ****.********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

750528 : 759528

Hokovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021162213.1\|750528_752481_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	4.1e-149	49.9
WP_034187169.1\|752746_753883_+	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	4.5e-23	38.8
WP_059557317.1\|753887_755753_+	aminodeoxychorismate synthase component I	S4VNU7	Pandoravirus	2.6e-60	38.8
WP_034187171.1\|755869_756685_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	6.7e-37	33.3
WP_034187172.1\|756728_757415_-	deoxynucleoside kinase	A0A0M3UL55	Enterococcus_phage	7.2e-08	26.4
WP_034187173.1\|757411_757954_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_034187174.1\|757989_759528_-	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	7.2e-24	31.0

DBSCAN-SWA_2

994985 : 1005491

Bacillus_virus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034187345.1\|994985_996104_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	4.0e-24	35.3
WP_006491172.1\|996197_996821_-	trimeric intracellular cation channel family protein	NA	NA	NA	NA
WP_049030588.1\|996807_997587_-	DNA mismatch repair protein MutS	A0A0P0IDT4	Acinetobacter_phage	5.9e-14	32.0
WP_034187347.1\|997722_998685_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	1.6e-61	42.9
WP_034187348.1\|999081_1001391_+	DNA translocase FtsK	G1FGP1	Mycobacterium_phage	6.5e-85	50.0
WP_059557148.1\|1001437_1002127_+	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_034187350.1\|1002310_1003621_+	replication-associated recombination protein A	G3MBE0	Bacillus_virus	2.5e-81	40.5
WP_034187351.1\|1003669_1003939_-	DUF2164 domain-containing protein	NA	NA	NA	NA
WP_034187352.1\|1004189_1005491_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.2e-93	51.1

DBSCAN-SWA_3

1083323 : 1091645

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034187429.1\|1083323_1084724_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.0e-77	38.3
WP_051700958.1\|1084731_1085682_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	3.8e-15	26.8
WP_034187430.1\|1085745_1086738_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	3.7e-29	31.5
WP_034187431.1\|1086812_1087166_+	competence protein ComE	NA	NA	NA	NA
WP_034187432.1\|1087389_1088292_+	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	1.7e-52	40.2
WP_080287788.1\|1088371_1089721_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_034187434.1\|1089764_1090688_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	8.7e-41	34.9
WP_059557121.1\|1090724_1091645_-	alpha/beta hydrolase	Q6TUZ7	Yaba_monkey_tumor_virus	1.0e-17	27.2

DBSCAN-SWA_4

1159400 : 1242028

uncultured_Caudovirales_phage(28.95%)

portal,head,terminase,tail,plate,protease,integrase,capsid,holin

attL 1173956:1173975|attR 1193742:1193761

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034186504.1\|1159400_1160900_+\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	1.9e-21	29.3
WP_034186505.1\|1160907_1161144_+	glutaredoxin family protein	NA	NA	NA	NA
WP_034186506.1\|1161312_1163106_+	elongation factor 4	E4ZFJ7	Streptococcus_phage	2.3e-21	23.7
WP_034186507.1\|1163122_1164016_+	signal peptidase I	NA	NA	NA	NA
WP_059560706.1\|1164169_1165360_+	ribonuclease III	G8DDA3	Micromonas_pusilla_virus	4.1e-19	30.7
WP_034186509.1\|1165420_1166320_+	GTPase Era	NA	NA	NA	NA
WP_034186510.1\|1166306_1167143_+	DNA repair protein RecO	NA	NA	NA	NA
WP_034186511.1\|1167139_1167916_+	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
WP_034186512.1\|1167949_1168384_+	holo-ACP synthase	NA	NA	NA	NA
WP_059560703.1\|1168400_1169429_+	beta-N-acetylhexosaminidase	NA	NA	NA	NA
WP_059560702.1\|1169591_1170977_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_034186515.1\|1171245_1171803_-	elongation factor P	NA	NA	NA	NA
WP_059560699.1\|1171929_1173123_-	elongation factor P maturation arginine rhamnosyltransferase EarP	NA	NA	NA	NA
WP_034186517.1\|1173199_1175245_+	excinuclease ABC subunit UvrC	NA	NA	NA	NA
1173956:1173975	attL	NA	NA	NA	NA
WP_034186518.1\|1175336_1175924_+	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_069245556.1\|1176749_1177949_+\|integrase	tyrosine-type recombinase/integrase	A0A1L7DQ84	Ralstonia_phage	5.1e-17	33.3
WP_156810487.1\|1177970_1178858_+	hypothetical protein	NA	NA	NA	NA
WP_069245558.1\|1178908_1179250_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_069245559.1\|1179246_1179507_-	hypothetical protein	NA	NA	NA	NA
WP_156810488.1\|1179523_1179985_-	hypothetical protein	NA	NA	NA	NA
WP_069245561.1\|1179981_1180353_-	hypothetical protein	NA	NA	NA	NA
WP_069245562.1\|1180454_1182062_-	pyridoxal phosphate biosynthetic protein PdxJ	NA	NA	NA	NA
WP_069245732.1\|1182061_1182424_-	beta-hexosaminidase	NA	NA	NA	NA
WP_069245563.1\|1182474_1182693_-	hypothetical protein	NA	NA	NA	NA
WP_156810489.1\|1182822_1183287_-	hypothetical protein	NA	NA	NA	NA
WP_069245565.1\|1183231_1183741_-	helix-turn-helix transcriptional regulator	G9L6A6	Escherichia_phage	6.1e-12	41.3
WP_059456070.1\|1183857_1184082_+	hypothetical protein	NA	NA	NA	NA
WP_034188740.1\|1184138_1184711_+	hypothetical protein	C7BGG0	Burkholderia_phage	1.1e-28	46.8
WP_069245733.1\|1184697_1185081_+	hypothetical protein	NA	NA	NA	NA
WP_069245566.1\|1185341_1187849_+	virulence protein E	A0A2D1GN57	Marinobacter_phage	2.2e-94	40.2
WP_069245567.1\|1188071_1188845_+	hypothetical protein	NA	NA	NA	NA
WP_059554247.1\|1189092_1189287_+	hypothetical protein	NA	NA	NA	NA
WP_069245568.1\|1189783_1191895_+\|terminase	phage terminase large subunit family protein	A0A2D1GMT1	Marinobacter_phage	4.9e-180	53.8
WP_006497114.1\|1191908_1192115_+	hypothetical protein	NA	NA	NA	NA
WP_069245569.1\|1192111_1193605_+\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	2.0e-135	50.9
WP_069245570.1\|1193601_1194669_+\|protease	Clp protease ClpP	A0A2H4JDI2	uncultured_Caudovirales_phage	3.4e-49	37.5
1193742:1193761	attR	NA	NA	NA	NA
WP_069245571.1\|1194699_1195044_+\|head	head decoration protein	NA	NA	NA	NA
WP_069245572.1\|1195117_1196113_+\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	6.4e-114	60.6
WP_069245573.1\|1196114_1196402_+	hypothetical protein	NA	NA	NA	NA
WP_069245574.1\|1196404_1196935_+\|tail	phage tail protein	A0A2H4JBV1	uncultured_Caudovirales_phage	1.2e-10	30.1
WP_069245575.1\|1196924_1197449_+	hypothetical protein	Q75QM3	Wolbachia_phage	4.2e-24	41.2
WP_069245576.1\|1197452_1198133_+\|plate	phage baseplate assembly protein V	E5FFH5	Burkholderia_phage	5.3e-19	32.6
WP_069245577.1\|1198241_1199057_+	hypothetical protein	NA	NA	NA	NA
WP_069245578.1\|1199122_1199323_+	hypothetical protein	NA	NA	NA	NA
WP_069245579.1\|1199322_1199658_+\|plate	phage baseplate protein	A0A2H4JA09	uncultured_Caudovirales_phage	3.9e-23	48.1
WP_069245580.1\|1199654_1200551_+\|plate	baseplate J protein	A0A2H4JFK9	uncultured_Caudovirales_phage	1.3e-46	42.0
WP_069245734.1\|1200540_1201119_+\|tail	phage tail protein I	Q6QI98	Burkholderia_phage	2.0e-27	42.1
WP_069245581.1\|1201106_1203095_+\|tail	tail fiber protein	E5E3V2	Burkholderia_phage	3.0e-107	54.9
WP_069245582.1\|1203110_1203863_+\|tail	phage tail protein	E5E3Q6	Burkholderia_phage	9.2e-57	57.4
WP_069245583.1\|1203946_1205116_+\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	1.9e-157	72.1
WP_069245584.1\|1205126_1205630_+\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	1.5e-42	52.5
WP_069245585.1\|1205726_1206029_+\|tail	phage tail assembly protein	A0A193GYZ8	Enterobacter_phage	1.0e-06	37.7
WP_069245586.1\|1206109_1208560_+\|tail	phage tail tape measure protein	A0A2H4JG00	uncultured_Caudovirales_phage	1.6e-57	34.6
WP_069245587.1\|1208570_1209449_+\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	8.9e-35	37.5
WP_059463521.1\|1209423_1209630_+\|tail	phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	5.3e-15	59.7
WP_069245588.1\|1209639_1210689_+	late control protein	A0A2H4JBF6	uncultured_Caudovirales_phage	4.7e-83	47.9
WP_069245589.1\|1210764_1211049_+\|holin	holin	C7BGD7	Burkholderia_phage	2.1e-38	91.5
WP_069245590.1\|1211051_1211546_+	glycoside hydrolase family 104 protein	Q6J1Q5	Burkholderia_virus	2.9e-75	85.4
WP_069245591.1\|1211542_1212037_+	DUF2514 family protein	C7BGD9	Burkholderia_phage	2.1e-41	62.0
WP_069245592.1\|1212207_1212996_+	DNA adenine methylase	Q8W6S4	Burkholderia_virus	4.2e-145	90.5
WP_069245593.1\|1213035_1213746_-	LysR family transcriptional regulator	A4PE26	Ralstonia_virus	3.7e-39	40.6
WP_083262737.1\|1213758_1214370_-	hypothetical protein	NA	NA	NA	NA
WP_069245594.1\|1214717_1215221_-	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	3.3e-18	41.7
WP_069245595.1\|1215224_1215638_-	PAAR domain-containing protein	Q8W6S2	Burkholderia_virus	1.0e-17	52.9
WP_107313950.1\|1215728_1216316_-	hypothetical protein	Q8W6R9	Burkholderia_virus	1.4e-36	45.4
WP_069245597.1\|1216437_1217142_+	hypothetical protein	A0A1S5NTJ1	Burkholderia_phage	1.0e-105	76.0
WP_156810490.1\|1217319_1218474_+	hypothetical protein	Q858T2	Yersinia_virus	2.9e-25	27.0
WP_156810491.1\|1218457_1219408_+	hypothetical protein	NA	NA	NA	NA
WP_083262738.1\|1219400_1220756_+	DNA (cytosine-5-)-methyltransferase	M4QPY5	Micromonas_pusilla_virus	2.3e-34	40.6
WP_034186519.1\|1221080_1221629_-	N-acetyltransferase	NA	NA	NA	NA
WP_059560696.1\|1221676_1222300_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_034186521.1\|1222448_1222685_+	ParD-like family protein	NA	NA	NA	NA
WP_034186522.1\|1222684_1223491_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_034186523.1\|1223587_1224091_-	GAF domain-containing protein	NA	NA	NA	NA
WP_059560694.1\|1224170_1225088_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_059560691.1\|1225199_1226072_+	pirin family protein	NA	NA	NA	NA
WP_034186526.1\|1226216_1226702_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_034186527.1\|1226712_1227582_-	cytochrome c oxidase assembly protein	NA	NA	NA	NA
WP_034186528.1\|1227592_1228039_-	copper chaperone PCu(A)C	NA	NA	NA	NA
WP_059560688.1\|1228047_1228683_-	SCO family protein	NA	NA	NA	NA
WP_034186530.1\|1228965_1229718_+	trehalose-phosphatase	NA	NA	NA	NA
WP_034186531.1\|1229714_1231103_+	alpha,alpha-trehalose-phosphate synthase (UDP-forming)	NA	NA	NA	NA
WP_034186532.1\|1231180_1233013_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.9e-39	27.7
WP_034186533.1\|1233578_1234643_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_034186534.1\|1234879_1235689_+	hypothetical protein	NA	NA	NA	NA
WP_059560686.1\|1235745_1237098_-	glucarate dehydratase	NA	NA	NA	NA
WP_059560683.1\|1237459_1238209_+	FadR family transcriptional regulator	NA	NA	NA	NA
WP_034186537.1\|1238346_1239495_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_059560680.1\|1239883_1242028_-\|holin	phospholipase C, phosphocholine-specific	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP013400

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP013399

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP013398

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection