CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP013411	Burkholderia thailandensis strain 2002721643 chromosome 1, complete sequence	1 crisprs	DinG,csa3,DEDDh,cas3,WYL	0	0	12	0
NZ_CP013413	Burkholderia thailandensis strain 2002721643 chromosome 2, complete sequence	2 crisprs	csa3,cas3,DinG	1	0	5	0
NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	1 crisprs	NA	2	2	2	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013411_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013411_1

949901-949992

Orphan

Consensus_repeat	Method
TGTCGCTCGATGCGCTCGAGCGGCTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013411_1

>merge|NZ_CP013411|1|949901-949992|CRISPRCasFinder
TGTCGCTCGATGCGCTCGAGCGGCTCGTCGGTGTGAATCTCGCGCGGCTGCGCGCGGAACGCCAGTTGTCGCTCGATGCGCTCGCGCGGCTC

>NZ_CP013411|1|1|949901-949992|CRISPRCasFinder
TGTCGCTCGATGCGCTCGAGCGGCTC	GTCGGTGTGAATCTCGCGCGGCTGCGCGCGGAACGCCAGT
TGTCGCTCGATGCGCTCGCGCGGCTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013411.1\|WP_009892878.1\|952804_953521_-\|aquaporin-family-protein	unknown	unknown	gnl\|CDD\|223653
NZ_CP013411.1\|WP_045599650.1\|939527_941243_-\|apolipoprotein-N-acyltransferase	unknown	unknown	gnl\|CDD\|234721
NZ_CP013411.1\|WP_045599649.1\|943296_944094_-\|rRNA-maturation-RNase-YbeY	unknown	unknown	gnl\|CDD\|237573
NZ_CP013411.1\|WP_009892876.1\|955242_956775_-\|glycerol-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|237027
NZ_CP013411.1\|WP_085952110.1\|953634_955146_-\|glycerol-kinase-GlpK	unknown	unknown	gnl\|CDD\|234594
NZ_CP013411.1\|WP_009902997.1\|947446_948379_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP013411.1\|WP_009908482.1\|951691_952378_-\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319828
NZ_CP013411.1\|WP_009902979.1\|938224_939232_-\|glycine--tRNA-ligase-subunit-alpha	unknown	unknown	gnl\|CDD\|236473
NZ_CP013411.1\|WP_011401816.1\|957897_958734_-\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NZ_CP013411.1\|WP_045599645.1\|960885_961719_+\|ferritin-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|153097
NZ_CP013411.1\|WP_045600803.1\|956942_957314_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013411.1\|WP_004201765.1\|957380_957590_-\|phage-tail-assembly-chaperone	unknown	unknown	unknown
NZ_CP013411.1\|WP_045599646.1\|958915_960580_+\|gamma-glutamyltransferase-family-protein	unknown	unknown	gnl\|CDD\|223482
NZ_CP013411.1\|WP_009902993.1\|944676_945747_-\|PhoH-family-protein	unknown	unknown	gnl\|CDD\|376820
NZ_CP013411.1\|WP_009892892.1\|941284_942172_-\|HlyC/CorC-family-transporter	unknown	unknown	gnl\|CDD\|226910
NZ_CP013411.1\|WP_045599648.1\|948524_949697_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|225371
NZ_CP013411.1\|WP_045599651.1\|936108_938208_-\|glycine--tRNA-ligase-subunit-beta	unknown	unknown	gnl\|CDD\|234925
NZ_CP013411.1\|WP_009903001.1\|950898_951621_+\|3,4-dihydroxy-2-butanone-4-phosphate-synthase	unknown	unknown	gnl\|CDD\|235119
NZ_CP013411.1\|WP_009892890.1\|942607_943240_-\|gamma-glutamylcyclotransferase	unknown	unknown	gnl\|CDD\|226226
NZ_CP013411.1\|WP_009902995.1\|945770_947144_-\|tRNA-(N6-isopentenyl-adenosine(37)-C2)-methylthiotransferase-MiaB	unknown	unknown	gnl\|CDD\|237673

Protein	Function_ID	Function_description	E-value
NZ_CP013411.1\|WP_009892878.1\|952804_953521_-\|aquaporin-family-protein	gnl\|CDD\|223653	COG0580, GlpF, Glycerol uptake facilitator and related permeases (Major Intrinsic Protein Family) [Carbohydrate transport and metabolism].	1.57915e-71
NZ_CP013411.1\|WP_045599650.1\|939527_941243_-\|apolipoprotein-N-acyltransferase	gnl\|CDD\|234721	PRK00302, lnt, apolipoprotein N-acyltransferase; Reviewed.	0
NZ_CP013411.1\|WP_045599649.1\|943296_944094_-\|rRNA-maturation-RNase-YbeY	gnl\|CDD\|237573	PRK13963, PRK13963, rRNA maturation RNase YbeY.	2.13769e-152
NZ_CP013411.1\|WP_009892876.1\|955242_956775_-\|glycerol-3-phosphate-dehydrogenase	gnl\|CDD\|237027	PRK12266, glpD, glycerol-3-phosphate dehydrogenase; Reviewed.	0
NZ_CP013411.1\|WP_085952110.1\|953634_955146_-\|glycerol-kinase-GlpK	gnl\|CDD\|234594	PRK00047, glpK, glycerol kinase GlpK.	0
NZ_CP013411.1\|WP_009902997.1\|947446_948379_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.58465e-69
NZ_CP013411.1\|WP_009908482.1\|951691_952378_-\|HAD-family-hydrolase	gnl\|CDD\|319828	cd07526, HAD_BPGM_like, subfamily of beta-phosphoglucomutase-like family, similar to Escherichia coli 6-phosphogluconate phosphatase YieH. This subfamily includes Escherichia coli YieH/HAD3 an 6-phosphogluconate phosphatase, which can hydrolyzed purines and pyrimidines as secondary substrates. It belongs to the beta-phosphoglucomutase-like family whose other members include Lactococcus lactis beta-PGM, a mutase which catalyzes the interconversion of beta-D-glucose 1-phosphate (G1P) and D-glucose 6-phosphate (G6P), Saccharomyces cerevisiae phosphatases GPP1 and GPP2 that dephosphorylate DL-glycerol-3-phosphate, and DOG1 and DOG2 that dephosphorylate 2-deoxyglucose-6-phosphate. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	4.97075e-48
NZ_CP013411.1\|WP_009902979.1\|938224_939232_-\|glycine--tRNA-ligase-subunit-alpha	gnl\|CDD\|236473	PRK09348, glyQ, glycyl-tRNA synthetase subunit alpha; Validated.	0
NZ_CP013411.1\|WP_045599645.1\|960885_961719_+\|ferritin-like-domain-containing-protein	gnl\|CDD\|153097	cd00657, Ferritin_like, Ferritin-like superfamily of diiron-containing four-helix-bundle proteins. Ferritin-like, diiron-carboxylate proteins participate in a range of functions including iron regulation, mono-oxygenation, and reactive radical production. These proteins are characterized by the fact that they catalyze dioxygen-dependent oxidation-hydroxylation reactions within diiron centers; one exception is manganese catalase, which catalyzes peroxide-dependent oxidation-reduction within a dimanganese center. Diiron-carboxylate proteins are further characterized by the presence of duplicate metal ligands, glutamates and histidines (ExxH) and two additional glutamates within a four-helix bundle. Outside of these conserved residues there is little obvious homology. Members include bacterioferritin, ferritin, rubrerythrin, aromatic and alkene monooxygenase hydroxylases (AAMH), ribonucleotide reductase R2 (RNRR2), acyl-ACP-desaturases (Acyl_ACP_Desat), manganese (Mn) catalases, demethoxyubiquinone hydroxylases (DMQH), DNA protecting proteins (DPS), and ubiquinol oxidases (AOX), and the aerobic cyclase system, Fe-containing subunit (ACSF).	1.6259e-10
NZ_CP013411.1\|WP_011401816.1\|957897_958734_-\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	1.68255e-99
NZ_CP013411.1\|WP_045599646.1\|958915_960580_+\|gamma-glutamyltransferase-family-protein	gnl\|CDD\|223482	COG0405, Ggt, Gamma-glutamyltransferase [Amino acid transport and metabolism].	0
NZ_CP013411.1\|WP_009902993.1\|944676_945747_-\|PhoH-family-protein	gnl\|CDD\|376820	pfam02562, PhoH, PhoH-like protein. PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation.	3.45214e-140
NZ_CP013411.1\|WP_009892892.1\|941284_942172_-\|HlyC/CorC-family-transporter	gnl\|CDD\|226910	COG4535, CorC, Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism].	9.20756e-141
NZ_CP013411.1\|WP_045599648.1\|948524_949697_+\|MFS-transporter	gnl\|CDD\|225371	COG2814, AraJ, Arabinose efflux permease [Carbohydrate transport and metabolism].	7.50252e-98
NZ_CP013411.1\|WP_045599651.1\|936108_938208_-\|glycine--tRNA-ligase-subunit-beta	gnl\|CDD\|234925	PRK01233, glyS, glycyl-tRNA synthetase subunit beta; Validated.	0
NZ_CP013411.1\|WP_009903001.1\|950898_951621_+\|3,4-dihydroxy-2-butanone-4-phosphate-synthase	gnl\|CDD\|235119	PRK03353, ribB, 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional.	7.72323e-122
NZ_CP013411.1\|WP_009892890.1\|942607_943240_-\|gamma-glutamylcyclotransferase	gnl\|CDD\|226226	COG3703, ChaC, Uncharacterized protein involved in cation transport [Inorganic ion transport and metabolism].	1.09506e-57
NZ_CP013411.1\|WP_009902995.1\|945770_947144_-\|tRNA-(N6-isopentenyl-adenosine(37)-C2)-methylthiotransferase-MiaB	gnl\|CDD\|237673	PRK14325, PRK14325, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional.	0

>NZ_CP013411.1|WP_045599648.1|948524_949697_+|MFS-transporter
MPLPLLALAISAFAIGTTEFVIMGLLPDVARDLAVTLPSAGLLVSGYALGVAAGAPLLAVLTSRMPRKAALQLLMAIFIAGNVLCALAQSYGMLMFARVVTSFAHGSFFGIGAVVAASLVSVDKRAIAIALMFTGLTLANVLGVPFGTFVGQTLGWRATFWIVAALGVASLAGVAALVPKQRDAGRAALGRELRVLKEPQVWLALAMTVLGFGGVFVVFTYIAPILEDVTGFSPHAVSLVLVLFGVGLTIGNAIGGRLADRALMPSLIAILVALIAVMAVFAKTSHLPAAAAVTVFVWGIAAFATVPPLQSRVVEKAAHAPNLASTLNIGAFNVGNAGGAWLGGVALSHGAPLDALPWVAAVVTLAALAVMVLAARLDTRVSPGAAAAAQ
>NZ_CP013411.1|WP_009902997.1|947446_948379_-|LysR-family-transcriptional-regulator
MDRLGDIRLFVEAAELGSLSAAGRKLNLTPAAASARLAKLEAQVSTRLFERSTRRLRLTDEGRLYLNCCRQALQALDDADAMLQEGRNVVSGKVRLSSTADFGRNQLLDWLDEFNARYPDVTFSVTASDSSSNLWQDEIDLAIRFAAPPDGALIARPLAANRRVLCASPAFVDKYGTPKDPLDLARFPCNVITVASGPINVWRFTRGGDTQTYTVPLANAHETNDGGLTREWTIRGHGIALKSIWDIARDVRAGRLKVLLPEWRHQDAPLHAIHHSKRYMAPRVRVLLDFLVERFAQEEKALEDLLNACR
>NZ_CP013411.1|WP_009902995.1|945770_947144_-|tRNA-(N6-isopentenyl-adenosine(37)-C2)-methylthiotransferase-MiaB
MTKKVYVKTFGCQMNEYDSDKMVDVLNAAEGLEKTDTPEDADIILFNTCSVREKAQEKVFSDLGRVRELKEAKPDLLIGVGGCVASQEGASIVARAPYVDLVFGPQTLHRLPQMIDARRESGRAQVDITFPEIEKFDHLPPARVEGPSAFVSIMEGCSKYCSYCVVPYTRGDEVSRPLDDVLTEIAGLADQGVREVTLLGQNVNAYRGALTAGAHEIADFATLIEYVADIPGIERIRYTTSHPKEFTQRLLDVYAKVPKLVDHLHLPVQHGSDRILMAMKRGYTVLEYKSLIRKLRAIRPNLSLSTDIIVGFPGETEADFDKTMALVHEMSYDTSFSFIYSPRPGTPAANLADDTPREVKLERLQHLQATIEENVARISQSMLGKVERILVEGPSRKDPNELAGRTENNRVVNFPAPLAAHARLIGQMIDVKINHAYPHSLRGELVLAHDDASAATH
>NZ_CP013411.1|WP_009902993.1|944676_945747_-|PhoH-family-protein
MKTAQALEFTAPRDDNARLANLCGPLDENLRQIEQALDVTLSRRGHRIAIRGRGARIALAALEDFYNRARDPLSVDDIQLALVEARHPGNPRRNGNGDGSGQPEVDVRFRGDPDHPFDEPVVRIGDEPHADEAAPKLYTRRADLRGRTPAQREYLKQILSHDVTFGVGPAGTGKTYLAVACAVDALERDQVKRIVLTRPAVEAGERLGFLPGDLAQKVDPYLRPLYDALYDLLGFDKTAKMFERQMIEIAPLAYMRGRTLNHAFIILDEAQNTTPEQMKMFLTRIGFGSKAVVTGDTSQVDLPRGHKSGLVEAQQVLGGVRGIALTRFTSADVVRHPLVARIVEAYDEFHAQHKDE
>NZ_CP013411.1|WP_045599649.1|943296_944094_-|rRNA-maturation-RNase-YbeY
MKSSRSSKSARAEAAQPEFPRLSLFDAKGKVKTVEAQALRVDFADGRSLMFDLSGSSGDAAVAIVAQHTDPSLRATIALHPEHYDSVTVEAGADENPDFAHDATDDAGEDAPDREPELDLAVQYGDEIGDAQRRSLPKRKVIAEWLEPAIFSDAQFTVRFVGADEGRTLNHSYRHKDYATNVLTFAYGEEPDGVTVADLVLCCPVVEKEAREQGKTLVAHYAHLLVHGALHAQGYDHERGEEDAAEMEALEIDILAKLGFPNPYR
>NZ_CP013411.1|WP_009892890.1|942607_943240_-|gamma-glutamylcyclotransferase
MSRPAPARCPYPPSLGEARYLSDDELAASLDATLAGWDRTSDLWLFGYGSLIWNPGMPAVEALRGKVHGYHRGLYLWSRVNRGTPEQPGLVLALDRGGSCTGLAFRLAGGTAMPHLEALWRREMAMGSYRPAWLPCALAGGERVSALAFVMRRDVPTYTGKLTDDVVKAVFGCASGRYGTTLDYVSRTVAALRDSGMPDRALEALLARCR
>NZ_CP013411.1|WP_009892892.1|941284_942172_-|HlyC/CorC-family-transporter
MNDSYPSRKSSDKPHEKRSLLERLTDFISPEPDSRAELLEILQDAHERNLIDADSLSMIEGVFQVSDLCARDIMVPRAQMDALNIADKPEDFIPFVLEKAHSRYPVYEDNRDNVIGVLLAKDLLRFYAEEEFDVRGMLRPAVFIPESKRLNVLLHDFRVNRNHLAIVVDEYGGVAGLITIEDVLEQIVGDIEDEYDFDEEAGNIIAAPDGRYRVRALTEIEQFNETFGTDFSDEEVDTIGGLITHHFGRVPHRGEKVRLGDLLFEIQRGDARQIHVLLVRRAPLAGRRSGSAGED
>NZ_CP013411.1|WP_045599650.1|939527_941243_-|apolipoprotein-N-acyltransferase
MAEPISTRSQSSVSPTAAGRALPIWHYPSALLAGAANTLTFAPTPHGGWLQLAVFAWLFAQLTRTTSWKHAAATGGAFGFGNFISGIWWLYISMHVYGEMAAPLAGGALVLFCLFLSIYPAFSAGLWSFCAGHARNGKAADPRPFSPTWHGAFAFASAWAVGEWLRGTVLTGFPWLASGYAQVDGPLAGYASIVGVYGIGWVLALVAALGVQAIARAREGSNGRGGDRNNGGGNGRTDAPAGAVPLALRSPRVAAPALAAAALVALGPLLALVPWTVPANAPLTVRLLQGNVKQDIKFEEAGIQAAIAMYQKMITEKPADLVVTPETAIAVLIQELPEPFARAVRNFSDATDTAVLFGAVGGTVTNDGRIVDYTNSLYGVTPHSRDIYRYDKHHLVPFGEFIPWGFHWFVDLMKMPLGDFARGAPVQQPFIVRNQPVMADVCYEDIFGEEIAATIRDNPVSPGVLVNVTNLAWFGDTIALDQHLQIARMRSLETGRPMLRATNTGMTAAIDAHGRVIGRLKPFTIGSLDVRIEGTAGRTPYVTSGNATVLAMSLLLLAFGFAFGPRLRRRG
>NZ_CP013411.1|WP_009902979.1|938224_939232_-|glycine--tRNA-ligase-subunit-alpha
MLTFQQIILTLQSYWDRQGCALLQPIDMEVGAGTSHVHTFLRAIGPEPWRAAYVQPSRRPKDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLAALGFDLKQNDVRFVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLERLAMYLQKVENVYDLIWTEWEEQGPNGPEIRRLTYGDVYHQNEVEQSTYNFEQANVELLFTFFNSYEAEARRMIEAQLALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALSRLVAQAYYDSREKLGFPMIGNPVPGVPGLTTDAQEAAQPAWAPPLKAERKIDQD
>NZ_CP013411.1|WP_045599651.1|936108_938208_-|glycine--tRNA-ligase-subunit-beta
MTQNHSASLLVELLTEELPPKALARLSDAFAEGIAQRLAARDLIEGELAFERYATPRRLAVVVQNVRAVAPERQVREKVLPVSVALDAQGKPTAPLAKKLAALGHPNLSIADLERAHDGKAEAFFVNYASPGATLAEGLQAALDETLAKLPIPKVMTYQRPDGTDVQFVRPVHRLSALHDDRIVPVCAFGIDAGDTTLGHRFLSDGLVAIQHANAYADTLRDKGRVLAHFAGRKEAIRAQLEANADGDQVVMPEALLDEVTSLVEWPVVYPCRFEDEFLQVPQECLILTMQTNQKYFALTDAAGKLRSRFLIVSNIETKTPDEIVEGNERVVRPRLADAKFFFEQDKKKPLADRVPLLANVVYHNKLGSQLARIERLETLAGEIAPAIGADATVAIRAARLAKADLLTDMVGEFPELQGTMGTYYARHDGEPEDVAIACSEHYQPRFSGDALPTTPVSTAVALADKLETIVGIWGIGLAPTGEKDPFALRRHALGVLRLLLEKQLPLDLVWLLRTTYERFAAVPDVAESTDAIHAFFVERLRGLLRERGYTAGEVDAVLSLNPTRLDDIVARLDAVREFTRLAEAEALAAANKRISNILKKSESGANGAVQPALFVEAAEKALAEQLAEVTPRVQSQLEARAYTGALSALAALRAPVDAFFDGVMVNAEDPALRANRLALLSALHQQMNCVADISKLAA
>NZ_CP013411.1|WP_009903001.1|950898_951621_+|3,4-dihydroxy-2-butanone-4-phosphate-synthase
MSFPLPSKSAPADAFSDLPLLDAEPVPPRIAAALAALREGRAVVLQDDHDRENEADLIVAAERLTDETMALLIRECSGIVCLCLTDEKVRALALPPMAQLNESKNGTAFTVSIEARAGVTTGVSAADRVTTIRAAIADDAQPHDIVRPGHVFPLRAAPGGVLARRGHTEGTVDLAILAGLKPAGVLCELMNPDGTMTRGADVERFAAQHGLPMLTIAELVEFRERLASLRERDACCEGVA
>NZ_CP013411.1|WP_009908482.1|951691_952378_-|HAD-family-hydrolase
MLDHLICDCDGVLVDSEVIADRVLFDTLSAAFPAIDFTADAKAAFGQQTSRFLADLEARHGIAMPEDFLDTIEHNIETGLAQWLAPIAGVRDALTKIALPAAVVSNSRLARVRNSLKRAALTDVFGERVFSAEQVARPKPYPDVYLHAARTLGVEPARCIVVEDSVSGLNAARAAGMKTIAFVGASHIPGGYEDALRKMGITRIMRSMDELPALVSAGMRGEFGDVQS
>NZ_CP013411.1|WP_009892878.1|952804_953521_-|aquaporin-family-protein
MSPYIAEFIGTALLVLLGNGAVANVLLAKTKGKGADLIVIVMGWAMAVFVAVYVTASFSGAHLNPIVTISLALAGKFAWAKVGGYIAAQMLGGMAGALLVWLAYRQHFAKETDPDLKLAVFCTAPAIRSVTHNVLTEAICTFVLILGVLYLASPQVGLGALDALPVGLLVLGIGISLGGPTGYAMSPARDLSPRIMHALLPIPGKRDSDWRYAWVPVLGPLVGGVLAANLYLYLHTAH
>NZ_CP013411.1|WP_085952110.1|953634_955146_-|glycerol-kinase-GlpK
MRQMQDQYILALDQGTTSSRAMLFDRQGNIVSIAQKEFEQIYPRPGWVEHDPQEIWSTQAGVAAEAVTRVGLNGTSIAAIGITNQRETTIVWDRETGHPIYNAIVWQDRRTADFCDQLKAQGLSEKVRAKTGLPIDSYFSATKIRWILDNVEGAREKARQGKLAFGTVDSWLVWNFTKHELHVTDVTNASRTMLFNIHTLDWDDELLDALEIPRSMLPQVRASSEIYGPTKTTVFASKIPLAGIAGDQQAALFGQMCTSSGMVKNTYGTGCFLMMNTGETPIESQNNLVTTIAWQVDGKVNYALEGSIFIAGAVVQWLRDGLGIIKSASEIEALAAGVPHTDGVYLVPAFAGLGAPHWNARARGSLFGVTRGTTSAHLARAALDSIAYQSLDVLKAMEADSGIRIGELRVDGGASANNLLMQFQADLLGVDAVRPRVTETTALGAAYLAGLAIGYWKNVDELHSQWQLERRFAPSMQREQVSSCLSGWQRAVRAAKAWADDTQ
>NZ_CP013411.1|WP_009892876.1|955242_956775_-|glycerol-3-phosphate-dehydrogenase
MTQQNRYDLLVVGGGINGAGIARDAAGRGLSVLLCEQDDLASHTSSSSTKLIHGGLRYLEYKEFGLVRKALQERETLLRAAPHIIWPLRFVMPHMPNLRPAWLIRIGLFLYDHLAKRELLPGSRGIDMRRHPAGAPLVDSIKRGFVYSDGWVDDARLVVLNALDAQERGARILTRTKLVSAERRDGQWHARLQRADGSTLDVCARAVANAAGPWVGDVLHGALGRGAQHSVRLVKGSHIVTRRLFDHDHAYIFQNPDKRIIFAIPYERDFTLIGTTDVEYRDDPSRVAIDRDETRYLCESINRYFKRKISPADVCWTYSGVRPLLEDENADNPSAVTRDYRLELDGGDGAPLLSVFGGKITTFRKLAEEATDMLGGALGASRGAWTAGVPLPGGDIADARFAPFAEAFAKRHPWLPAALARRYARAYGTRAERVIGGAKSLAELGAELAPGLYEAELRYLRDAEWASCADDVLWRRSKLGLHVAPGTLDAVTAALDAWFGAAREAASAAH
>NZ_CP013411.1|WP_045600803.1|956942_957314_+|hypothetical-protein
MRTMIAAGALALLAGCAGAPAMFGGWGGPSFAELQRSCGDVRDYGEDAQAVYSAVFDAWVAKRHGKLTDARFCAFENELAQHRAALGTSTDPAERGRWVSYLNDARARALSWRAAVDPSLRGG
>NZ_CP013411.1|WP_004201765.1|957380_957590_-|phage-tail-assembly-chaperone
MERTMLSPHEFATLLLVKDAPDQADMDRDELDALLERQLVKLEALGSGRKYCVTEIGDAALRSIKLRYS
>NZ_CP013411.1|WP_011401816.1|957897_958734_-|DeoR/GlpR-transcriptional-regulator
MRICRPRFPSHRAESTPANMTRDPRLTLNARQQELLEWVQRDGFVTVDDLAAHFNVTPQTIRRDVNWLADLNLLRRYHGGASLPTSSENVSYTARQRMFHDEKRRIAALAASHIPDQASLFINLGTTTEEVARALNRHRGLRVITNNLNVASMMSGYPECEVLITGGIVRPWDKGIVGELAIDFIRQFRVDYAIIGTSSIESDGTLRDFDTREVRVAEAIIQHARTVYLVTDHSKFGRPALVRQGHLNQIHALFTDKPLPDEMAETIAQAGTQVYVAD
>NZ_CP013411.1|WP_045599646.1|958915_960580_+|gamma-glutamyltransferase-family-protein
MTLHSNISGVPFSWRNPYLTTRVPVFARNVVSTSHPLAAQAGLRMLWKGGNAVDAAIAAAAAITVVEPVSCGLGGDAFALVWDGAKLHGLNASGVAPAAWSVDYFRRRHGDAGNGLARQPTRGWDTVTVPGVIAGWEALHAKFGSLPFADLLEPAIELAERGHAVAAVVAHKWAAAVPELNGQPGFAETFMPRGRAPEVSELVRLPGHAKTLRTIAAEGARAFYEGSIAESIAGFFRDGGGALTADDLRAYRPEWVEPIGKDFRGYTVHEIPPNGQGIAALIALGIVERFGLDDLPLDSAEAQHVQIEAMKLAFADVYRYVADPRAMALTPAQMLDDAYLDARAKLIDVTRATHFSFGMPRAGGTIYLSAADERGMMVSFIQSNYMGFGSGLVVPGTGIALQNRGCGFSMDPTSPNVVEGGKRPFHTIIPAFVTRQAGGARHAVMSFGVMGGDMQPQGHLQTIVRMLGYGQQPQAACDAPRWKVSRSFTLDVEAALGASVVDALAARGHTIQAIDDPYMDFGSGQFIWRLDRDEPDRGYVAASDSRRDGLAAGF
>NZ_CP013411.1|WP_045599645.1|960885_961719_+|ferritin-like-domain-containing-protein
MLADSDTTHEMPWRIEDIDLTRIDRQRAAANEDLLLLLCAASFIESGSDLYTSNLSQFFDDDPEVSAWLNTEWEHEELQHGRALKAYIAHVWPEFDWDLAFASFFDEYSKTCSLEAFEKTRALEMVARCVVETGTATLYRAINECSDEPVLKEITDNIRTDEVRHYKHFFRYFKKYNKVEGNGRLAVLGALMRRVLEIRNEDSEIALRHVFAIRYPDRAGDSAYCRERTARVNALVRRNLSADMCVKMLLKPLDLPAKIQPGVHYPLTKLTQHVFFR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

188267 : 217459

Ralstonia_phage(20.0%)

transposase,integrase

attL 183258:183309|attR 195591:195642

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
183258:183309	attL	NA	NA	NA	NA
WP_045599095.1\|188267_189194_+	AAA family ATPase	Q6UAZ2	Ralstonia_phage	4.2e-27	36.7
WP_045599900.1\|189190_190555_+	type II secretory pathway protein	NA	NA	NA	NA
WP_045599897.1\|190568_190802_-	hypothetical protein	NA	NA	NA	NA
WP_045599896.1\|191326_192106_+	hypothetical protein	A0A1W5LU59	Ralstonia_phage	8.4e-37	42.2
WP_082255745.1\|192186_193041_+\|integrase	site-specific integrase	Q9T1P3	Pseudomonas_phage	6.3e-62	45.5
WP_082255746.1\|193055_193415_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	1.8e-18	51.9
WP_082255747.1\|193407_193740_+	helix-turn-helix transcriptional regulator	A0A088CD40	Shigella_phage	6.5e-15	51.1
WP_045599894.1\|193887_195396_+	hypothetical protein	P79669	Escherichia_phage	1.9e-13	21.0
WP_045599893.1\|196532_196730_-	hypothetical protein	K4NZY3	Burkholderia_phage	7.5e-27	93.8
195591:195642	attR	NA	NA	NA	NA
WP_025405302.1\|197166_198387_-\|transposase	ISL3 family transposase	A9YX10	Burkholderia_phage	4.4e-226	92.6
WP_009902093.1\|198483_198768_-	hypothetical protein	NA	NA	NA	NA
WP_045599891.1\|198764_199247_-	DUF2778 domain-containing protein	NA	NA	NA	NA
WP_102889797.1\|199341_200098_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_071810898.1\|201297_201675_-	ASCH domain-containing protein	Q6SE87	Lactobacillus_prophage	1.0e-27	49.6
WP_082255748.1\|201652_202696_-	GNAT family N-acetyltransferase	Q6SE88	Lactobacillus_prophage	6.5e-69	42.1
WP_102889842.1\|202950_204252_-	DUF2875 domain-containing protein	NA	NA	NA	NA
WP_045598724.1\|206588_207056_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_082255749.1\|206995_207409_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.1e-16	38.5
WP_045598726.1\|207508_209131_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	2.1e-66	33.7
WP_045598729.1\|209140_209401_-	hypothetical protein	NA	NA	NA	NA
WP_102889801.1\|210748_211566_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	8.6e-08	37.6
WP_045599887.1\|211696_211960_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_082255750.1\|211969_213508_-	DUF2875 domain-containing protein	NA	NA	NA	NA
WP_082255751.1\|213646_215839_-	DUF3274 domain-containing protein	A0A077K801	Ralstonia_phage	3.9e-23	28.9
WP_045598699.1\|215893_217459_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	9.8e-69	34.0

DBSCAN-SWA_2

447682 : 479521

Stx2-converting_phage(25.0%)

transposase,protease,integrase

attL 457271:457316|attR 468279:468324

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082255759.1\|447682_448045_+\|transposase	transposase	NA	NA	NA	NA
WP_025404693.1\|448044_448392_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	1.2e-40	71.0
WP_045599822.1\|448421_449984_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	9.3e-144	52.3
WP_045599821.1\|450023_450620_+	plasmid pRiA4b ORF-3 family protein	A0A2H4PDG5	Mycobacterium_phage	8.4e-29	39.7
WP_009888560.1\|450955_452161_-	Do family serine endopeptidase	A0A1B1IRD3	uncultured_Mediterranean_phage	6.5e-12	31.9
WP_009888562.1\|452182_452929_+	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_009906349.1\|453149_453770_+	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
WP_045599820.1\|453770_455153_+	cytochrome bc complex cytochrome b subunit	NA	NA	NA	NA
WP_009888567.1\|455175_455934_+	cytochrome c1	NA	NA	NA	NA
WP_004185176.1\|456026_456638_+	stringent starvation protein A	NA	NA	NA	NA
WP_082255760.1\|456701_457220_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	1.5e-21	52.5
457271:457316	attL	NA	NA	NA	NA
WP_045599819.1\|457413_458466_+\|integrase	tyrosine-type recombinase/integrase	W6MYA3	Pseudomonas_phage	2.4e-50	38.2
WP_052712472.1\|458945_459605_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_045599817.1\|460105_461077_+	type IV secretion system protein	NA	NA	NA	NA
WP_127447033.1\|461110_461383_+	hypothetical protein	NA	NA	NA	NA
WP_045599815.1\|461571_461769_-	hypothetical protein	NA	NA	NA	NA
WP_127447034.1\|463174_463447_+	hypothetical protein	NA	NA	NA	NA
WP_045599813.1\|463449_464607_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_045599812.1\|464606_465074_+	DUF4411 family protein	NA	NA	NA	NA
WP_052712471.1\|465322_465724_+	hypothetical protein	NA	NA	NA	NA
WP_127447035.1\|466250_466808_+	hypothetical protein	NA	NA	NA	NA
WP_127447036.1\|467054_467894_+	hypothetical protein	NA	NA	NA	NA
WP_045599811.1\|468519_469722_+	DUF4102 domain-containing protein	B7SYF8	Stenotrophomonas_phage	1.0e-105	49.5
468279:468324	attR	NA	NA	NA	NA
WP_127447037.1\|469718_470579_+	hypothetical protein	NA	NA	NA	NA
WP_052712487.1\|470562_471072_-	inovirus-type Gp2 protein	NA	NA	NA	NA
WP_082255761.1\|472133_473729_-	DUF3987 domain-containing protein	NA	NA	NA	NA
WP_127447038.1\|473776_474067_-	hypothetical protein	NA	NA	NA	NA
WP_102889787.1\|475027_475838_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_045599808.1\|475805_476225_+	hypothetical protein	NA	NA	NA	NA
WP_045598729.1\|477628_477889_+	hypothetical protein	NA	NA	NA	NA
WP_045598726.1\|477898_479521_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	2.1e-66	33.7

DBSCAN-SWA_3

493933 : 531747

Leptospira_phage(44.44%)

transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045598726.1\|493933_495556_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	2.1e-66	33.7
WP_082255749.1\|495655_496069_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.1e-16	38.5
WP_045598724.1\|496008_496476_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_082255764.1\|496795_497749_-	endonuclease	A6XMH8	Bacillus_virus	7.3e-51	39.2
WP_045599795.1\|497873_498842_-	DUF932 domain-containing protein	A0A0H4INH5	Stenotrophomonas_phage	2.5e-54	39.0
WP_082255765.1\|498938_499424_-	hypothetical protein	NA	NA	NA	NA
WP_045599793.1\|499766_500402_+	hypothetical protein	NA	NA	NA	NA
WP_045599792.1\|500418_501642_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_045599791.1\|501684_504183_+	SAM-dependent DNA methyltransferase	A0A220A2U4	Liberibacter_phage	5.7e-79	36.5
WP_045600833.1\|504187_505450_+	hypothetical protein	NA	NA	NA	NA
WP_045599790.1\|505465_508783_+	HsdR family type I site-specific deoxyribonuclease	A0A220A398	Liberibacter_phage	4.5e-71	27.1
WP_082255766.1\|508787_509540_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_045599789.1\|509545_511918_+	AAA domain-containing protein	K4I1H4	Acidithiobacillus_phage	4.8e-43	38.3
WP_045599788.1\|511934_513347_+	McrC family protein	NA	NA	NA	NA
WP_045599787.1\|513343_514468_+	DNA repair exonuclease	NA	NA	NA	NA
WP_045599786.1\|514470_517113_+	AAA family ATPase	NA	NA	NA	NA
WP_045598892.1\|518941_519415_+\|transposase	transposase	NA	NA	NA	NA
WP_045598698.1\|519390_519741_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.1e-17	39.4
WP_045598699.1\|519772_521338_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	9.8e-69	34.0
WP_127447041.1\|521380_521638_+	hypothetical protein	NA	NA	NA	NA
WP_009888580.1\|521671_522457_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_009906858.1\|522453_523800_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_025404121.1\|523908_524523_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_045599785.1\|524896_525586_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_009888592.1\|525622_526141_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_009888594.1\|526157_527648_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_009906860.1\|527720_528224_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_080511549.1\|528251_528764_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_082255918.1\|528856_530683_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_019255984.1\|530646_531747_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA

DBSCAN-SWA_4

616919 : 623634

Burkholderia_virus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_052712469.1\|616919_617915_-	AAA family ATPase	Q7M293	Enterobacteria_phage	2.8e-29	29.4
WP_045599758.1\|618487_619597_-	DUF3396 domain-containing protein	A4JWV3	Burkholderia_virus	8.9e-125	58.9
WP_045599756.1\|619602_620364_-	nuclease	A4JWV4	Burkholderia_virus	7.1e-57	54.6
WP_010113596.1\|620360_620909_-	hypothetical protein	A4JWV5	Burkholderia_virus	8.4e-76	80.7
WP_045598892.1\|621237_621711_+\|transposase	transposase	NA	NA	NA	NA
WP_045598698.1\|621686_622037_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.1e-17	39.4
WP_045598699.1\|622068_623634_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	9.8e-69	34.0

DBSCAN-SWA_5

1154280 : 1165161

Streptococcus_phage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009903323.1\|1154280_1156395_-	elongation factor G	E4ZFJ7	Streptococcus_phage	2.3e-57	27.0
WP_019256450.1\|1156660_1157170_-	DUF192 domain-containing protein	A0A1B1IUW8	uncultured_Mediterranean_phage	5.0e-14	42.2
WP_080511442.1\|1157365_1157581_-	hypothetical protein	NA	NA	NA	NA
WP_009892615.1\|1157841_1158420_-	pseudouridine synthase	NA	NA	NA	NA
WP_045599535.1\|1158684_1159944_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	6.8e-12	63.0
WP_045599534.1\|1160108_1161704_+	multicopper oxidase family protein	NA	NA	NA	NA
WP_004196460.1\|1161815_1162019_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.8e-23	81.8
WP_009892611.1\|1162549_1162864_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	2.6e-13	44.6
WP_045599533.1\|1162860_1165161_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	3.9e-167	41.8

DBSCAN-SWA_6

1326031 : 1402171

uncultured_Caudovirales_phage(28.57%)

head,capsid,terminase,integrase,transposase,tail,plate,protease,portal

attL 1354147:1354164|attR 1391110:1391127

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_102889801.1\|1326031_1326849_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	8.6e-08	37.6
WP_155722018.1\|1327027_1327225_+	hypothetical protein	NA	NA	NA	NA
WP_009903575.1\|1327637_1328018_-	hypothetical protein	NA	NA	NA	NA
WP_011401901.1\|1328189_1328729_+\|protease	serine protease inhibitor ecotin	NA	NA	NA	NA
WP_025405254.1\|1328828_1329980_-	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_025405253.1\|1330170_1330395_-	hypothetical protein	NA	NA	NA	NA
WP_155772355.1\|1330484_1330880_-	hypothetical protein	NA	NA	NA	NA
WP_025405252.1\|1331982_1332468_+	hypothetical protein	NA	NA	NA	NA
WP_127447053.1\|1333310_1334606_+	hypothetical protein	NA	NA	NA	NA
WP_127447054.1\|1334587_1335691_+	hypothetical protein	NA	NA	NA	NA
WP_082255795.1\|1335727_1335829_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_045599459.1\|1337564_1338665_+	hypothetical protein	NA	NA	NA	NA
WP_045599458.1\|1338633_1339575_+	hypothetical protein	NA	NA	NA	NA
WP_045598729.1\|1341048_1341309_+	hypothetical protein	NA	NA	NA	NA
WP_045598726.1\|1341318_1342941_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	2.1e-66	33.7
WP_082255749.1\|1343040_1343454_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.1e-16	38.5
WP_045598724.1\|1343393_1343861_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_045599457.1\|1343924_1344323_+	hypothetical protein	NA	NA	NA	NA
WP_004525824.1\|1344553_1344724_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_045599456.1\|1344723_1345203_+	hypothetical protein	NA	NA	NA	NA
WP_102889853.1\|1345492_1346628_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.2e-14	29.9
WP_004524590.1\|1346857_1347034_+	hypothetical protein	NA	NA	NA	NA
WP_045600770.1\|1347026_1347284_+	hypothetical protein	NA	NA	NA	NA
WP_045599455.1\|1347280_1347622_+	hypothetical protein	NA	NA	NA	NA
WP_082255797.1\|1347751_1350619_+	DUF927 domain-containing protein	A0A1B0VP75	Pseudomonas_phage	1.0e-71	35.7
WP_045598892.1\|1351377_1351851_+\|transposase	transposase	NA	NA	NA	NA
WP_045598698.1\|1351826_1352177_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.1e-17	39.4
WP_045598699.1\|1352208_1353774_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	9.8e-69	34.0
1354147:1354164	attL	NA	NA	NA	NA
WP_045599452.1\|1354230_1355445_-\|integrase	tyrosine-type recombinase/integrase	Q7M297	Enterobacteria_phage	2.6e-85	40.9
WP_045600769.1\|1355899_1357015_+\|integrase	site-specific integrase	A0A248XD46	Klebsiella_phage	6.0e-44	32.7
WP_045599450.1\|1357109_1358342_+	AAA family ATPase	R4TQL5	Phaeocystis_globosa_virus	2.2e-15	32.7
WP_045599449.1\|1358331_1360521_+	S8 family peptidase	NA	NA	NA	NA
WP_045599447.1\|1360590_1360830_-	hypothetical protein	NA	NA	NA	NA
WP_052712467.1\|1360826_1361300_-	hypothetical protein	NA	NA	NA	NA
WP_045599445.1\|1361312_1361747_-	hypothetical protein	NA	NA	NA	NA
WP_102889801.1\|1361743_1362561_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	8.6e-08	37.6
WP_045599443.1\|1362686_1363058_-	hypothetical protein	NA	NA	NA	NA
WP_045599442.1\|1363159_1364497_-	pyridoxal phosphate biosynthetic protein PdxJ	NA	NA	NA	NA
WP_045599440.1\|1364496_1364946_-	hypothetical protein	NA	NA	NA	NA
WP_045599439.1\|1364942_1365548_-	hypothetical protein	NA	NA	NA	NA
WP_045599438.1\|1365544_1365880_-	hypothetical protein	NA	NA	NA	NA
WP_045600767.1\|1365931_1366150_-	hypothetical protein	NA	NA	NA	NA
WP_082255930.1\|1366701_1367265_-	helix-turn-helix transcriptional regulator	G9L6A6	Escherichia_phage	6.7e-12	41.1
WP_045599434.1\|1367640_1368168_+	hypothetical protein	C7BGG0	Burkholderia_phage	4.4e-29	46.8
WP_082255931.1\|1368181_1368514_+	hypothetical protein	NA	NA	NA	NA
WP_045599432.1\|1369220_1369679_+	hypothetical protein	NA	NA	NA	NA
WP_045600765.1\|1370052_1370523_+	hypothetical protein	NA	NA	NA	NA
WP_045599430.1\|1370643_1373136_+	virulence protein E	A0A2D1GN57	Marinobacter_phage	2.9e-99	42.2
WP_045599429.1\|1373353_1374127_+	hypothetical protein	NA	NA	NA	NA
WP_082255802.1\|1374686_1374953_-	DUF1883 domain-containing protein	NA	NA	NA	NA
WP_009964504.1\|1375158_1375728_+	hypothetical protein	NA	NA	NA	NA
WP_082255803.1\|1375690_1377679_+\|terminase	phage terminase large subunit family protein	A0A2D1GMT1	Marinobacter_phage	8.6e-179	53.1
WP_009964508.1\|1377689_1377896_+	hypothetical protein	NA	NA	NA	NA
WP_045599426.1\|1377892_1379386_+\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	4.1e-133	50.8
WP_045599425.1\|1379382_1380483_+	peptidase S14	A0A2H4JDI2	uncultured_Caudovirales_phage	5.3e-45	34.8
WP_045599423.1\|1380509_1380854_+\|head	head decoration protein	NA	NA	NA	NA
WP_045599422.1\|1380918_1381914_+\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	2.1e-109	59.1
WP_045599421.1\|1381917_1382208_+	hypothetical protein	NA	NA	NA	NA
WP_045599420.1\|1382209_1382740_+\|tail	phage tail protein	A0A2H4JBV1	uncultured_Caudovirales_phage	2.4e-11	29.6
WP_045599419.1\|1382729_1383263_+	hypothetical protein	Q9JML9	Wolbachia_phage	1.6e-23	40.3
WP_045600764.1\|1383265_1383946_+\|plate	phage baseplate assembly protein V	Q9JML8	Wolbachia_phage	6.9e-19	33.8
WP_045599418.1\|1384010_1384217_+	hypothetical protein	NA	NA	NA	NA
WP_045599417.1\|1384213_1384558_+\|plate	phage baseplate protein	A0A2H4JA09	uncultured_Caudovirales_phage	1.9e-25	50.9
WP_045599415.1\|1384554_1385448_+\|plate	baseplate J protein	D5LGZ3	Escherichia_phage	2.2e-49	41.6
WP_045599413.1\|1385437_1386007_+\|tail	phage tail protein I	A4JWL7	Burkholderia_virus	8.0e-37	48.1
WP_045599411.1\|1386003_1387404_+	hypothetical protein	A4JWL8	Burkholderia_virus	1.8e-159	60.2
WP_045599408.1\|1387419_1387854_+\|tail	tail assembly chaperone	A4JWL9	Burkholderia_virus	2.4e-41	74.6
WP_045599406.1\|1387928_1389098_+\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	6.2e-161	74.6
WP_082255932.1\|1389138_1390215_+\|tail	phage tail protein	A0A2H4J869	uncultured_Caudovirales_phage	1.2e-134	69.4
WP_045599404.1\|1390225_1390729_+\|tail	phage major tail tube protein	A0A2H4JBU0	uncultured_Caudovirales_phage	7.3e-42	49.1
WP_045599403.1\|1390800_1391103_+\|tail	phage tail assembly protein	V5YST8	Pseudomonas_phage	1.1e-05	37.2
WP_045599402.1\|1391190_1393605_+\|tail	phage tail tape measure protein	A0A2H4JG00	uncultured_Caudovirales_phage	1.8e-69	34.7
1391110:1391127	attR	NA	NA	NA	NA
WP_045599401.1\|1393613_1394495_+\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	2.4e-32	38.5
WP_004538529.1\|1394469_1394676_+\|tail	phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	5.3e-15	59.7
WP_045599400.1\|1394685_1395738_+	phage late control D protein	A0A2H4JBF6	uncultured_Caudovirales_phage	1.6e-78	44.8
WP_004533694.1\|1395813_1396008_+	hypothetical protein	NA	NA	NA	NA
WP_045599399.1\|1396000_1396498_+	lysozyme	A4JX20	Burkholderia_virus	3.1e-69	81.2
WP_045599398.1\|1396497_1397043_+	lysozyme	Q8W6S5	Burkholderia_virus	7.6e-77	91.7
WP_045599396.1\|1397186_1397975_+	DNA adenine methylase	Q8W6S4	Burkholderia_virus	9.4e-153	96.9
WP_045599395.1\|1398010_1398733_-	LysR family transcriptional regulator	A4PE26	Ralstonia_virus	4.1e-30	39.5
WP_082255804.1\|1398739_1399342_-	hypothetical protein	NA	NA	NA	NA
WP_082255805.1\|1399683_1400193_-	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	8.8e-19	37.3
WP_045599392.1\|1400189_1400615_-	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	1.7e-15	50.6
WP_045599391.1\|1400674_1400956_-	hypothetical protein	NA	NA	NA	NA
WP_045600761.1\|1400955_1401420_-	hypothetical protein	C7BGE3	Burkholderia_phage	3.3e-49	61.7
WP_045599388.1\|1401499_1402171_+	DUF159 family protein	Q8W6R8	Burkholderia_virus	6.6e-115	83.8

DBSCAN-SWA_7

1762320 : 1806032

uncultured_Caudovirales_phage(100.0%)

transposase,plate,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_102889787.1\|1762320_1763131_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_025405125.1\|1763292_1764771_-	PHB depolymerase family esterase	NA	NA	NA	NA
WP_127447005.1\|1765614_1766301_+	hypothetical protein	NA	NA	NA	NA
WP_009910381.1\|1766375_1766594_-	hypothetical protein	NA	NA	NA	NA
WP_009905942.1\|1768085_1769936_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_045598735.1\|1769964_1771392_-	hypothetical protein	NA	NA	NA	NA
WP_009891791.1\|1771415_1771682_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_045598738.1\|1772207_1775006_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	2.0e-27	24.1
WP_009905935.1\|1775008_1775842_+	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_045598989.1\|1775978_1776536_+	DUF3304 domain-containing protein	NA	NA	NA	NA
WP_082255817.1\|1776532_1777132_+	DUF3304 domain-containing protein	NA	NA	NA	NA
WP_045598740.1\|1777128_1779531_+	DUF2235 domain-containing protein	NA	NA	NA	NA
WP_025405119.1\|1779639_1782975_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_082255818.1\|1782952_1783447_+	hypothetical protein	NA	NA	NA	NA
WP_038708366.1\|1784205_1784697_+	hypothetical protein	NA	NA	NA	NA
WP_080511661.1\|1784811_1785024_+	hypothetical protein	NA	NA	NA	NA
WP_045599247.1\|1785157_1785490_+	hypothetical protein	NA	NA	NA	NA
WP_009909765.1\|1785507_1785813_+	hypothetical protein	NA	NA	NA	NA
WP_045598742.1\|1785825_1788648_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	1.2e-29	24.6
WP_045598745.1\|1788651_1789668_+	hypothetical protein	NA	NA	NA	NA
WP_045598747.1\|1789670_1792694_+	hypothetical protein	NA	NA	NA	NA
WP_082255944.1\|1792723_1793416_+	hypothetical protein	NA	NA	NA	NA
WP_011851471.1\|1794253_1794565_+	hypothetical protein	NA	NA	NA	NA
WP_009891740.1\|1794827_1795109_-	H-NS histone family protein	NA	NA	NA	NA
WP_009891738.1\|1795066_1795303_-	hypothetical protein	NA	NA	NA	NA
WP_025405114.1\|1795594_1796521_-	amidohydrolase family protein	NA	NA	NA	NA
WP_045598748.1\|1796565_1797855_-	MFS transporter	NA	NA	NA	NA
WP_009891734.1\|1798270_1799164_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_045598752.1\|1799972_1800518_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_009905900.1\|1800570_1801131_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_038708375.1\|1801213_1801738_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_009905896.1\|1801755_1802595_+	molecular chaperone	NA	NA	NA	NA
WP_082255945.1\|1802702_1805051_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_045598760.1\|1805066_1806032_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA

DBSCAN-SWA_8

2183789 : 2194469

Burkholderia_virus(58.33%)

transposase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_102889801.1\|2183789_2184606_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	8.6e-08	37.6
WP_045599092.1\|2184615_2184915_-	hypothetical protein	W6CMZ9	Ralstonia_phage	4.2e-13	40.4
WP_045599091.1\|2185446_2185842_+	helix-turn-helix transcriptional regulator	S6B268	Ralstonia_phage	1.5e-26	55.1
WP_045599090.1\|2185892_2186870_+\|portal	phage portal protein	K4NZV0	Burkholderia_phage	2.7e-189	98.8
WP_004202809.1\|2186913_2187270_-	putative addiction module antidote protein	A4JWV1	Burkholderia_virus	3.9e-42	100.0
WP_011204767.1\|2187272_2187596_-	type II toxin-antitoxin system RelE/ParE family toxin	A4JWV2	Burkholderia_virus	1.1e-54	98.1
WP_082255833.1\|2188159_2189281_-	DUF3396 domain-containing protein	A4JWV3	Burkholderia_virus	6.3e-219	99.5
WP_045599088.1\|2189289_2190027_-	VRR-NUC domain-containing protein	A4JWV4	Burkholderia_virus	4.2e-131	98.4
WP_009897076.1\|2190023_2190557_-	bacteriophage gp29 protein	A4JWV5	Burkholderia_virus	2.4e-96	99.4
WP_009897078.1\|2190659_2190782_-	CopG family transcriptional regulator	A4JWV6	Burkholderia_virus	5.9e-14	100.0
WP_102889828.1\|2191031_2191789_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_045599085.1\|2191906_2192998_-	DUF3396 domain-containing protein	Q8W6S0	Burkholderia_virus	1.2e-209	97.5
WP_102860124.1\|2193269_2194469_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	9.2e-43	42.7

DBSCAN-SWA_9

2649850 : 2730085

uncultured_Caudovirales_phage(26.19%)

head,capsid,terminase,integrase,transposase,tail,tRNA,plate,protease,portal

attL 2643436:2643455|attR 2733710:2733729

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2643436:2643455	attL	NA	NA	NA	NA
WP_082255759.1\|2649850_2650213_+\|transposase	transposase	NA	NA	NA	NA
WP_045600558.1\|2650212_2650569_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	6.5e-37	70.3
WP_102889803.1\|2650602_2651737_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.2e-14	29.9
WP_127447014.1\|2654479_2656219_-	AAA family ATPase	NA	NA	NA	NA
WP_009890299.1\|2656917_2658168_-	aspartate kinase	NA	NA	NA	NA
WP_045600551.1\|2658508_2659981_-\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_009904725.1\|2660024_2660996_-	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_045600549.1\|2661098_2662037_-	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_009890291.1\|2662084_2663482_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	2.4e-42	33.8
WP_080554742.1\|2663769_2664435_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_009890287.1\|2664490_2665066_+	peptidyl-prolyl cis-trans isomerase	A0A1V0SCU1	Indivirus	2.4e-12	40.0
WP_009890286.1\|2665146_2665638_+	peptidyl-prolyl cis-trans isomerase	A0A2H4UTF4	Bodo_saltans_virus	8.2e-06	29.8
WP_009890284.1\|2665661_2666462_+	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_009890280.1\|2666835_2667618_-	serine O-acetyltransferase	NA	NA	NA	NA
WP_009904715.1\|2667819_2668740_-	RNA methyltransferase	NA	NA	NA	NA
WP_009890278.1\|2669042_2669846_+	inositol monophosphatase	NA	NA	NA	NA
WP_019254661.1\|2670110_2670383_-	hypothetical protein	NA	NA	NA	NA
WP_080403979.1\|2672019_2673042_+	ParA family protein	H2BD62	Pseudomonas_phage	1.8e-50	35.5
WP_102860126.1\|2673717_2674917_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	9.2e-43	42.7
WP_052712484.1\|2675552_2677145_-	DUF2235 domain-containing protein	NA	NA	NA	NA
WP_082255857.1\|2677170_2677656_-	DUF3304 domain-containing protein	NA	NA	NA	NA
WP_045600545.1\|2677775_2678447_-	DUF159 family protein	Q8W6R8	Burkholderia_virus	4.9e-110	81.9
WP_009904707.1\|2678526_2678991_+	hypothetical protein	C7BGE3	Burkholderia_phage	8.8e-50	61.0
WP_025405797.1\|2678990_2679272_+	hypothetical protein	NA	NA	NA	NA
WP_025404957.1\|2679333_2679759_+	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	2.4e-14	48.3
WP_082255858.1\|2679755_2680265_+	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	4.4e-18	39.4
WP_045600544.1\|2680257_2680731_+	hypothetical protein	NA	NA	NA	NA
WP_045600908.1\|2680702_2681218_+	hypothetical protein	NA	NA	NA	NA
WP_024430649.1\|2681229_2681940_+	hypothetical protein	A4PE26	Ralstonia_virus	2.6e-37	41.0
WP_045600543.1\|2681980_2682769_-	DNA adenine methylase	Q8W6S4	Burkholderia_virus	1.6e-152	97.3
WP_045600542.1\|2682912_2683458_-	lysozyme	Q8W6S5	Burkholderia_virus	9.2e-83	95.6
WP_045600540.1\|2683457_2683955_-	lysozyme	A4JX20	Burkholderia_virus	3.6e-65	75.4
WP_004533694.1\|2683947_2684142_-	hypothetical protein	NA	NA	NA	NA
WP_045600538.1\|2684217_2685270_-	phage late control D protein	A0A2H4JBF6	uncultured_Caudovirales_phage	2.7e-78	44.5
WP_045600906.1\|2685279_2685486_-\|tail	phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	1.2e-14	59.7
WP_045600537.1\|2685460_2686342_-\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	1.9e-32	38.5
WP_045600536.1\|2686350_2688765_-\|tail	phage tail tape measure protein	A0A2H4JG00	uncultured_Caudovirales_phage	4.7e-70	33.2
WP_045600534.1\|2688852_2689155_-\|tail	phage tail assembly protein	V5YST8	Pseudomonas_phage	1.1e-05	37.2
WP_045599404.1\|2689226_2689730_-\|tail	phage major tail tube protein	A0A2H4JBU0	uncultured_Caudovirales_phage	7.3e-42	49.1
WP_045600533.1\|2689740_2690910_-\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	1.1e-160	74.3
WP_069255315.1\|2690998_2691418_-\|tail	tail assembly chaperone	A4JWL9	Burkholderia_virus	1.1e-40	77.1
WP_045600530.1\|2691433_2692834_-	hypothetical protein	A4JWL8	Burkholderia_virus	2.8e-160	61.0
WP_045600528.1\|2692830_2693400_-\|tail	phage tail protein I	A4JWL7	Burkholderia_virus	1.8e-36	47.6
WP_045600526.1\|2693389_2694283_-\|plate	baseplate J protein	D5LGZ3	Escherichia_phage	2.4e-51	41.9
WP_045600525.1\|2694279_2694624_-\|plate	phage baseplate protein	A0A2H4JA09	uncultured_Caudovirales_phage	3.2e-25	50.9
WP_025405225.1\|2694620_2694827_-	hypothetical protein	NA	NA	NA	NA
WP_025405226.1\|2694890_2695571_-\|plate	phage baseplate assembly protein V	A0A1B2LRU5	Wolbachia_phage	1.5e-18	34.4
WP_045600523.1\|2695573_2696107_-	hypothetical protein	Q9JML9	Wolbachia_phage	1.8e-22	38.8
WP_045599420.1\|2696096_2696627_-\|tail	phage tail protein	A0A2H4JBV1	uncultured_Caudovirales_phage	2.4e-11	29.6
WP_045599421.1\|2696628_2696919_-	hypothetical protein	NA	NA	NA	NA
WP_082255859.1\|2696922_2697948_-\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	1.7e-109	59.1
WP_004539732.1\|2697982_2698327_-\|head	head decoration protein	NA	NA	NA	NA
WP_045600520.1\|2698353_2699421_-\|protease	Clp protease ClpP	A0A2H4JDI2	uncultured_Caudovirales_phage	1.1e-50	37.8
WP_045600519.1\|2699417_2700911_-\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	1.2e-135	51.4
WP_004533700.1\|2700907_2701114_-	hypothetical protein	NA	NA	NA	NA
WP_082255860.1\|2701124_2703113_-\|terminase	phage terminase large subunit family protein	A0A2D1GMT1	Marinobacter_phage	6.0e-180	53.4
WP_082255861.1\|2703075_2703645_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_009944039.1\|2703843_2704110_+	DUF1883 domain-containing protein	NA	NA	NA	NA
WP_017844234.1\|2704672_2705446_-	hypothetical protein	NA	NA	NA	NA
WP_045600517.1\|2705663_2708156_-	virulence protein E	A0A2D1GN57	Marinobacter_phage	2.5e-98	41.5
WP_045600903.1\|2708277_2708748_-	hypothetical protein	NA	NA	NA	NA
WP_045600516.1\|2709121_2709580_-	hypothetical protein	NA	NA	NA	NA
WP_155772356.1\|2709743_2710259_+	hypothetical protein	NA	NA	NA	NA
WP_082255966.1\|2710286_2710619_-	hypothetical protein	NA	NA	NA	NA
WP_045599434.1\|2710632_2711160_-	hypothetical protein	C7BGG0	Burkholderia_phage	4.4e-29	46.8
WP_076853252.1\|2711248_2711476_-	hypothetical protein	NA	NA	NA	NA
WP_009909040.1\|2711624_2712110_+	helix-turn-helix transcriptional regulator	A0A193GYL7	Enterobacter_phage	4.4e-12	41.2
WP_123850154.1\|2712057_2712513_+	hypothetical protein	NA	NA	NA	NA
WP_004550209.1\|2712641_2712860_+	hypothetical protein	NA	NA	NA	NA
WP_045600515.1\|2712911_2713247_+	hypothetical protein	NA	NA	NA	NA
WP_004534172.1\|2713243_2713849_+	hypothetical protein	NA	NA	NA	NA
WP_045600513.1\|2713845_2714295_+	hypothetical protein	NA	NA	NA	NA
WP_009964483.1\|2714294_2715611_+	hypothetical protein	NA	NA	NA	NA
WP_025405240.1\|2715724_2716054_+	hypothetical protein	NA	NA	NA	NA
WP_045600901.1\|2716062_2716536_+	hypothetical protein	B5TA88	Burkholderia_phage	2.3e-05	71.4
WP_009890227.1\|2716544_2716787_+	AlpA family phage regulatory protein	C7BGF0	Burkholderia_phage	9.3e-19	59.2
WP_004547867.1\|2716737_2718039_-\|integrase	integrase family protein	C7BGE7	Burkholderia_phage	2.3e-148	58.9
WP_102889863.1\|2718210_2720880_+	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	2.2e-28	24.0
WP_045600510.1\|2720866_2722165_+	hypothetical protein	NA	NA	NA	NA
WP_045600509.1\|2722144_2722690_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_080554743.1\|2722782_2723946_+	cupin domain-containing protein	NA	NA	NA	NA
WP_080511493.1\|2724177_2724432_+	hypothetical protein	NA	NA	NA	NA
WP_009904699.1\|2724611_2725388_-	MBL fold metallo-hydrolase	U5PVD0	Bacillus_phage	4.3e-09	27.1
WP_025404919.1\|2725394_2726537_-	outer membrane protein assembly factor BamC	NA	NA	NA	NA
WP_045600508.1\|2726647_2727550_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_045600506.1\|2727594_2728212_-	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_009890211.1\|2728208_2729411_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_009890209.1\|2729419_2730085_-\|protease	site-2 protease family protein	NA	NA	NA	NA
2733710:2733729	attR	NA	NA	NA	NA

DBSCAN-SWA_10

3038355 : 3046996

Tanapox_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025987375.1\|3038355_3039198_+	alpha/beta hydrolase	A7XCB7	Tanapox_virus	8.5e-19	26.8
WP_009889864.1\|3039526_3040450_-	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	3.2e-43	36.2
WP_082255878.1\|3040577_3041870_+	lytic murein transglycosylase B	NA	NA	NA	NA
WP_009904404.1\|3041964_3042867_-	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	4.3e-53	39.9
WP_009889858.1\|3043201_3043519_-	competence protein ComE	NA	NA	NA	NA
WP_009904403.1\|3043590_3044583_-	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	9.1e-28	30.9
WP_052712481.1\|3044640_3045627_-	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.4e-15	27.4
WP_009904402.1\|3045595_3046996_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.4e-79	38.7

DBSCAN-SWA_11

3412737 : 3421968

unidentified_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009904055.1\|3412737_3414282_+	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	2.5e-24	31.2
WP_045600187.1\|3414317_3414845_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_045600868.1\|3414841_3415525_+	deoxynucleoside kinase	A0A249XZR7	Enterococcus_phage	2.6e-05	26.0
WP_009904054.1\|3415589_3416405_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	3.3e-36	32.9
WP_025404755.1\|3416580_3418590_-	bifunctional anthranilate synthase component I family protein/class IV aminotransferase	S4VT78	Pandoravirus	8.2e-52	34.7
WP_009889258.1\|3418621_3419752_-	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	1.8e-24	38.0
WP_009904051.1\|3420015_3421968_-	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	6.6e-147	50.3

DBSCAN-SWA_12

3597152 : 3655046

Stx2-converting_phage(22.22%)

transposase,integrase,tRNA

attL 3605571:3605589|attR 3661573:3661591

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009888930.1\|3597152_3598889_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_009903906.1\|3599107_3599758_+	RNA pyrophosphohydrolase	NA	NA	NA	NA
WP_045600094.1\|3599790_3600402_+	hypothetical protein	NA	NA	NA	NA
WP_009888926.1\|3600609_3601728_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	4.0e-64	43.5
WP_025404729.1\|3601812_3602931_-	GTPase ObgE	NA	NA	NA	NA
WP_004194025.1\|3603115_3603379_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_004194344.1\|3603407_3603719_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_009888814.1\|3603940_3604933_+	octaprenyl diphosphate synthase	NA	NA	NA	NA
WP_045600092.1\|3605193_3606489_+	HlyC/CorC family transporter	NA	NA	NA	NA
3605571:3605589	attL	NA	NA	NA	NA
WP_025404712.1\|3606595_3607867_+	type II secretion system protein E	NA	NA	NA	NA
WP_009903902.1\|3607863_3609081_+	type II secretion system F family protein	NA	NA	NA	NA
WP_045600089.1\|3609125_3610040_+	prepilin peptidase	NA	NA	NA	NA
WP_009903899.1\|3610043_3610655_+	dephospho-CoA kinase	NA	NA	NA	NA
WP_009903898.1\|3610804_3611560_+	cell division protein ZapD	NA	NA	NA	NA
WP_009903897.1\|3611591_3611795_+	DNA gyrase inhibitor YacG	NA	NA	NA	NA
WP_009888797.1\|3611921_3612371_-	NUDIX domain-containing protein	A0A0B5CYJ3	Rhizoctonia_fumigata_mycovirus	1.7e-05	38.8
WP_004194150.1\|3612367_3613237_-	ATP-binding protein	NA	NA	NA	NA
WP_045600862.1\|3613256_3614498_-	bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ	NA	NA	NA	NA
WP_009903894.1\|3614653_3617446_-	preprotein translocase subunit SecA	NA	NA	NA	NA
WP_009888792.1\|3618033_3618513_+	DUF721 domain-containing protein	NA	NA	NA	NA
WP_045600741.1\|3618817_3620146_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_009888790.1\|3620288_3621206_-	UDP-3-O-acyl-N-acetylglucosamine deacetylase	NA	NA	NA	NA
WP_009903892.1\|3621447_3621954_-	peroxiredoxin	M1I839	Pelagibacter_phage	1.1e-26	43.5
WP_004194380.1\|3622143_3623340_-	cell division protein FtsZ	NA	NA	NA	NA
WP_009903891.1\|3623339_3623453_+	hypothetical protein	NA	NA	NA	NA
WP_004194020.1\|3623449_3624682_-	cell division protein FtsA	NA	NA	NA	NA
WP_045600086.1\|3624708_3625461_-	cell division protein FtsQ/DivIB	NA	NA	NA	NA
WP_009888783.1\|3625481_3626420_-	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_045600083.1\|3626421_3627819_-	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
WP_009888781.1\|3627815_3628919_-	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_039337038.1\|3628915_3630208_-	putative lipid II flippase FtsW	NA	NA	NA	NA
WP_025404708.1\|3630204_3631719_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_004194370.1\|3631744_3632914_-	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
WP_009903887.1\|3632928_3634335_-	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase	NA	NA	NA	NA
WP_009903886.1\|3634331_3635876_-	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_009888762.1\|3635872_3637717_-	penicillin-binding protein 2	NA	NA	NA	NA
WP_009888760.1\|3637713_3638043_-	cell division protein FtsL	NA	NA	NA	NA
WP_009888758.1\|3638039_3638981_-	16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH	NA	NA	NA	NA
WP_019255554.1\|3639004_3639433_-	division/cell wall cluster transcriptional repressor MraZ	NA	NA	NA	NA
WP_009903884.1\|3639819_3640446_-	2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinone monooxygenase	NA	NA	NA	NA
WP_009888738.1\|3640726_3641887_+	porin	NA	NA	NA	NA
WP_045600741.1\|3641941_3643270_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_082255759.1\|3643468_3643831_+\|transposase	transposase	NA	NA	NA	NA
WP_025404693.1\|3643830_3644178_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	1.2e-40	71.0
WP_045599822.1\|3644207_3645770_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	9.3e-144	52.3
WP_045599821.1\|3645809_3646406_+	plasmid pRiA4b ORF-3 family protein	A0A2H4PDG5	Mycobacterium_phage	8.4e-29	39.7
WP_009888736.1\|3646630_3648304_-	long-chain fatty acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	9.9e-35	26.6
WP_045600080.1\|3648443_3650519_-	molybdopterin oxidoreductase family protein	A0A077SK27	Escherichia_phage	8.2e-55	26.7
WP_102889803.1\|3650663_3651798_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.2e-14	29.9
WP_082255902.1\|3651741_3652464_-	hypothetical protein	NA	NA	NA	NA
WP_004545945.1\|3652485_3652680_-	hypothetical protein	NA	NA	NA	NA
WP_025404559.1\|3652881_3653700_-	hypothetical protein	NA	NA	NA	NA
WP_082255903.1\|3653696_3655046_-\|integrase	integrase family protein	NA	NA	NA	NA
3661573:3661591	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP013412

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013412_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013412_1

12408-12627

Orphan

Consensus_repeat	Method
TGCCGTTGCGCCATTACCAATCGCACTAGCATTCAATCCGGATGCCGTCGCG	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP013412_1

>merge|NZ_CP013412|1|12408-12627|PILER-CR
TGCCGTTGCGCCATTACCAATCGCACTAGCATTCAATCCGGATGCCGTCGCGCCAGAACCCAGAGCGCTTGAATTCGCTCCGCTCGCCACTGCTTGATTGCCAATCGCACTAGCATTCGTGTTGTTAGCGACCGCACCAGTACCCAGCGCATTTGAAGTCGCACCGCTTGCCGTTGCGCCATTACCAATCGCACTAGCATTCAATCCGGATGCCGTCGCG

>NZ_CP013412|1|1|12408-12627|PILER-CR
TGCCGTTGCGCCATTACCAATCGCACTAGCATTCAATCCGGATGCCGTCGCG	CCAGAACCCAGAGCGCTTGAATTCGCTCCGCTCGCCACTGCTTG
ATTGCCAATCGCACTAGCATTCGTGTTGTTAGCGACCGCACCAGTACCCAGC	GCATTTGAAGTCGCACCGCTTGCCGTTGCGCCATTACCAATCGCACTAG
CATTCAATCCGGATGCCGTCGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013412.1\|WP_045598867.1\|17586_18609_-\|UDP-glucose-4-epimerase-GalE	unknown	unknown	gnl\|CDD\|187558
NZ_CP013412.1\|WP_082255990.1\|8593_9361_-\|DUF937-domain-containing-protein	unknown	unknown	gnl\|CDD\|368733
NZ_CP013412.1\|WP_102889859.1\|10318_10990_-\|OmpA-family-protein	unknown	unknown	gnl\|CDD\|143586
NZ_CP013412.1\|WP_045598873.1\|23558_25202_-\|DUF3492-domain-containing-protein	unknown	unknown	gnl\|CDD\|340841
NZ_CP013412.1\|WP_045598850.1\|8235_8421_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013412.1\|WP_045598851.1\|9642_9966_-\|H-NS-histone-family-protein	unknown	unknown	gnl\|CDD\|376390
NZ_CP013412.1\|WP_082255992.1\|14060_15137_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|376350
NZ_CP013412.1\|WP_082255994.1\|16747_17047_-\|transposase	unknown	unknown	gnl\|CDD\|372671
NZ_CP013412.1\|WP_045598844.1\|2401_3601_-\|DUF3443-domain-containing-protein	unknown	unknown	gnl\|CDD\|314750
NZ_CP013412.1\|WP_025405302.1\|4190_5411_-\|ISL3-family-transposase	unknown	unknown	gnl\|CDD\|225995
NZ_CP013412.1\|WP_082256009.1\|21212_22070_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226386
NZ_CP013412.1\|WP_045598871.1\|22182_23559_-\|exopolysaccharide-Pel-transporter-PelG	unknown	unknown	gnl\|CDD\|379904
NZ_CP013412.1\|WP_082255993.1\|16332_16725_+\|MAPEG-family-protein	unknown	unknown	gnl\|CDD\|376462
NZ_CP013412.1\|WP_009905744.1\|5725_6931_+\|outer-membrane-protein-assembly-factor-BamC	unknown	unknown	gnl\|CDD\|225854
NZ_CP013412.1\|WP_045598866.1\|17114_17417_-\|transposase	unknown	unknown	gnl\|CDD\|366690
NZ_CP013412.1\|WP_045598869.1\|18788_20621_-\|glutamine--fructose-6-phosphate-transaminase-(isomerizing)	unknown	unknown	gnl\|CDD\|234729
NZ_CP013412.1\|WP_082256008.1\|15677_16256_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_CP013412.1\|WP_045598846.1\|3611_4100_-\|DUF2844-domain-containing-protein	unknown	unknown	gnl\|CDD\|314047

Protein	Function_ID	Function_description	E-value
NZ_CP013412.1\|WP_045598867.1\|17586_18609_-\|UDP-glucose-4-epimerase-GalE	gnl\|CDD\|187558	cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, subgroup 1, extended (e) SDRs. UDP-glucose 4 epimerase (aka UDP-galactose-4-epimerase), is a homodimeric extended SDR. It catalyzes the NAD-dependent conversion of UDP-galactose to UDP-glucose, the final step in Leloir galactose synthesis. This subgroup has the characteristic active site tetrad and NAD-binding motif of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	0
NZ_CP013412.1\|WP_082255990.1\|8593_9361_-\|DUF937-domain-containing-protein	gnl\|CDD\|368733	pfam06078, DUF937, Bacterial protein of unknown function (DUF937). This family consists of several hypothetical bacterial proteins of unknown function.	2.89218e-07
NZ_CP013412.1\|WP_102889859.1\|10318_10990_-\|OmpA-family-protein	gnl\|CDD\|143586	cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA. OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. Well-studied members of this family include the Escherichia coli outer membrane protein OmpA, the Escherichia coli lipoprotein PAL, Neisseria meningitdis RmpM, which interact with the outer membrane, as well as the Escherichia coli motor protein MotB, and the Vibrio flagellar motor proteins PomB and MotY, which interact with the inner membrane.	2.57905e-40
NZ_CP013412.1\|WP_045598873.1\|23558_25202_-\|DUF3492-domain-containing-protein	gnl\|CDD\|340841	cd03813, GT4-like, glycosyltransferase family 4 proteins. This family is most closely related to the GT4 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in bacteria, while some of them are also found in Archaea and eukaryotes.	0
NZ_CP013412.1\|WP_045598851.1\|9642_9966_-\|H-NS-histone-family-protein	gnl\|CDD\|376390	pfam00816, Histone_HNS, H-NS histone family.	8.67934e-14
NZ_CP013412.1\|WP_082255992.1\|14060_15137_-\|EAL-domain-containing-protein	gnl\|CDD\|376350	pfam00563, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues. The EAL domain is a good candidate for a diguanylate phosphodiesterase function. The domain contains many conserved acidic residues that could participate in metal binding and might form the phosphodiesterase active site.	7.62759e-20
NZ_CP013412.1\|WP_082255994.1\|16747_17047_-\|transposase	gnl\|CDD\|372671	pfam13683, rve_3, Integrase core domain.	6.74264e-32
NZ_CP013412.1\|WP_045598844.1\|2401_3601_-\|DUF3443-domain-containing-protein	gnl\|CDD\|314750	pfam11925, DUF3443, Protein of unknown function (DUF3443). This family of proteins are functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 400 to 434 amino acids in length. This protein has two conserved sequence motifs: NPV and DNNG.	1.25488e-154
NZ_CP013412.1\|WP_025405302.1\|4190_5411_-\|ISL3-family-transposase	gnl\|CDD\|225995	COG3464, COG3464, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	3.79594e-91
NZ_CP013412.1\|WP_082256009.1\|21212_22070_-\|hypothetical-protein	gnl\|CDD\|226386	COG3868, COG3868, Uncharacterized conserved protein [Function unknown].	2.28083e-51
NZ_CP013412.1\|WP_045598871.1\|22182_23559_-\|exopolysaccharide-Pel-transporter-PelG	gnl\|CDD\|379904	pfam16933, PelG, Putative exopolysaccharide Exporter (EPS-E). PelG is a family of putative exopolysaccharide transporters like PelG. Most members carry twelve transmembrane regions. The family also contains fusion proteins with glycosyl transferase group 1, which are putative flippase transporters.	2.59584e-156
NZ_CP013412.1\|WP_082255993.1\|16332_16725_+\|MAPEG-family-protein	gnl\|CDD\|376462	pfam01124, MAPEG, MAPEG family. This family is has been called MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism). It includes proteins such as Prostaglandin E synthase. This enzyme catalyzes the synthesis of PGE2 from PGH2 (produced by cyclooxygenase from arachidonic acid). Because of structural similarities in the active sites of FLAP, LTC4 synthase and PGE synthase, substrates for each enzyme can compete with one another and modulate synthetic activity.	1.05147e-06
NZ_CP013412.1\|WP_045598846.1\|3611_4100_-\|DUF2844-domain-containing-protein	gnl\|CDD\|314047	pfam11005, DUF2844, Protein of unknown function (DUF2844). This bacterial family of proteins has no known function.	1.45144e-41
NZ_CP013412.1\|WP_045598866.1\|17114_17417_-\|transposase	gnl\|CDD\|366690	pfam01527, HTH_Tnp_1, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family consists of various E. coli insertion elements and other bacterial transposases some of which are members of the IS3 family.	1.57148e-07
NZ_CP013412.1\|WP_045598869.1\|18788_20621_-\|glutamine--fructose-6-phosphate-transaminase-(isomerizing)	gnl\|CDD\|234729	PRK00331, PRK00331, isomerizing glutamine--fructose-6-phosphate transaminase.	0
NZ_CP013412.1\|WP_009905744.1\|5725_6931_+\|outer-membrane-protein-assembly-factor-BamC	gnl\|CDD\|225854	COG3317, NlpB, Uncharacterized lipoprotein [Cell envelope biogenesis, outer membrane].	9.98738e-46
NZ_CP013412.1\|WP_082256008.1\|15677_16256_+\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	8.13569e-56

>NZ_CP013412.1|WP_102889859.1|10318_10990_-|OmpA-family-protein
MKNIYLPLILSAVSLVGCSATSGPTFSARELQARDGVRTYQVDCHGLFSSSKMCMRVATRVCGDQPVHVIDSAQPLRNAPDPDSLTFQCRAKDVAQSTPVPAPVVMPIPQHITLSTDANFDFDQATLTPTAHDRLNKLIADATGLKFGTVEVNGYTDGVGPNAYNLHLSELRAQAVAGYLQSHGLEATGFDVKGYGKDNPVATNSTAEGRAKNRRVEITLPQQ
>NZ_CP013412.1|WP_045598851.1|9642_9966_-|H-NS-histone-family-protein
MSRYQMLFDQYEKLKQQIDRERKEEMDSFVCAIANRIREILDEYGLDIEVVPRGIGPEKTRKKIEPKYWNKKTGQTWSGRGRTPLWLVGQDREKFRIPIENEDQDLK
>NZ_CP013412.1|WP_082255990.1|8593_9361_-|DUF937-domain-containing-protein
MKIGQIPVCDSVNILESLHFLTTDPICLQISVLLDESRIGVKAAIQLLLANLLGVIVCRGSTKKGGGSLLGVLSSSEMFPGLLSTDLNELFSGNKSTQDLMMRGETLLMRLLGRKAGDLCDAIACLSGLRDESVMSLLAMMTPIILTMVKRVANANCAFHHAGIWPLMIAQKEYLFDRVSGRVLMAVGMEEFSVFSDSSENYGIGAVDGIGNFQVGAMKFNKIVSTYGFSSKILRSSWILVMIIALVILVYKKIP
>NZ_CP013412.1|WP_045598850.1|8235_8421_-|hypothetical-protein
MKSKRTSGGRKLDHATLQATRQQAVKAVREGQGVASVAAAYGVNERSAYPSHLKPDSAGHT
>NZ_CP013412.1|WP_009905744.1|5725_6931_+|outer-membrane-protein-assembly-factor-BamC
MTDLRLTKRFAALLATGAFVAGCSSPSPTKIDYKSDSKSKEVSLAVPPNMLDETPDQRSLPPQGGATSLSSLQQVQQAAPPTDSVAPAVPGMRIQRDGTESWLVIDDKSPAQIWPQVRRFWQEQGFLLVVEQRDKGVMETDWNETHPQINDGLIRGVISKAMGNSYVTAERNKYRTRLDAAPNGGTYVFISQKGMREALTGANNDSSKWEPKPNDPGLETEYLKRLMAVIAQNDARVKAGGVPITDDAAPSRAKASTSKSKDAAAAIAAKNVASASTSSAPSGAAVPDVPPEVTLAEPYDRSWLHVGLALDRANFTVDDRDRTKGLYYVRYVDPKDLSVEEQGFWSQLFHGKKEKKAKQYLVNVKAVTEGETRVAVVDDKGNVDASAPARQIMSLLVNQLR
>NZ_CP013412.1|WP_025405302.1|4190_5411_-|ISL3-family-transposase
MLDRKALQALGCWTGYRLERVEWPEGEGRTLSLHVKPVSKVMYCEQCGARCHQIHETTVRRVRDLPLFEYRVVLHVPRRRVWCERCGGPRLEKLAWLGRYQRVTERFAKACEKLLQAASVQAVAAFYDLGWHTVKSIDKMRLQARVAEPDWSTIRYLAMDEFALHKGHRYATVVVDPIGRQVLWIGSGRSRETARAFFEQLPEGVAERIEAVAIDMTTAYELEIKAQCPQAEVVYDLFHVVAKYGREVIDRVRVDQANQLRHDRPARKVLKSSRWLLLRNRHNLKPEQSVHLKELLAANQPLLCVYVLRDELKRLWFYRKPAWAEKAWEHWIEQARQSGIAALQLFAQRLQGYWHGILARCRHPLNTSVVEGINNTIKVIKRRAYGYRDEEYFFLKIRAAFPGNPR
>NZ_CP013412.1|WP_045598846.1|3611_4100_-|DUF2844-domain-containing-protein
MNNKNSFPPVRRRPACALLVAAALTFVPVSAQSQLGGTVTDSSARAFAQTSTPLLGGAVTMRSHVDAGGTTIREYATRAGLVFAYTWDGPTSPNLRQLLGERISTYQSHAVSTDARARVSLHAGRVAQSDFVVEAGGRMRTYVGRAWLPGAVPSGVSIDDLP
>NZ_CP013412.1|WP_045598844.1|2401_3601_-|DUF3443-domain-containing-protein
MTLKITWRAAALTVTLAACGGGGGGGSTTPNSSGSGVTPSNAANVQPVTVSEGITGAANMLMTTVTVCAPNTNQCQTIDNVQVDTGSDGLRILAAALPSSVALPVVPAANAPITGACAIFGTGFTWGAVRRADVRVAGEVAANIPIQVIADPSTPNAPADCTQSAGPMQTQGALRANGILGIGLFVTDCGTACANSAPPGWYYGCTASGACASTSQPIAQQIANPVGAFSSDNNGSVIVLPAIPATGSATVNGSLIFGIGTQANNGLGAATPLATTASGAYVTSVLNGNTNARTFFDSGSNGIFFADTSLPQCGSWFCPASTQTFDITLSSGNGASKATTFQVASSQVLFSTFNFAFNDLAGPIGNVVDLGLPLFYGRNIYTAIEGRATPAGPGPYYAY
>NZ_CP013412.1|WP_082255992.1|14060_15137_-|EAL-domain-containing-protein
MRTRSVLLIEVTNRSVLIDNFGRALVEEIDIELSERARHLCGPSVGVRAIRGGRLVISGSVAEVPHDGRRVACVGTEEWLLKLSGKSAPHSRVGWLAELRARWICGNAETLIDAGRSKAPLGAATRADFAIASAVLRAIDTDAISLEVSPVHNPSDHCDVLYFDCSMLIGSLGGFQCSLDAYSSCFARMGLVPYIECHMFSLVLDLLEHSTNLYVGVNFSGQTIADEFWSEEVINRLCGSPDLAKRLIVEVAENIDFDSENARKFLKQLKALGCRIAIDEYGLAYGCDVNTTIPEPDIVKIAPAFVAEACRDSAALGKFRRLLKLGASIAREVVVMGVKGDDEMSVVRVVSANWVQRF
>NZ_CP013412.1|WP_082256008.1|15677_16256_+|recombinase-family-protein
MNIGYARVSTDEQNIELQIDALERAGCDIILSDRGVSGAEFHRPGLDAALEKAMKGDTFVVWRLDRLGRSLGKLIDLINFLARRGVDFVSLNESINTASSGGRLVFHMMGALAEFERSLISERTRAGLAAARARGKQIGRRRQLTPDQCERARILLETHPMTEVAMRFNVHPRTIKRALGSNVNTYPSDNLK
>NZ_CP013412.1|WP_082255993.1|16332_16725_+|MAPEG-family-protein
MNFVAAFCTFALGCLVFGLGFWVSLMRKSARIAHGATADPGDFLYRLIRAHGNTTEYAPFLALLILYLGAHHPANWAIGTMIVSVLCRYILVVGFLMYPTLAKPNGLRFLGAAGTYVTGFMLCLAMVLPT
>NZ_CP013412.1|WP_082255994.1|16747_17047_-|transposase
MGDAWAHEHGVKLQFIRPGKPVENAYIESFNGRLREECLNQHAFVNLDDARKRIETWRTDYNSVRPHSALGQLAPDQFRQLHQSKTGKPANLRMVYSAG
>NZ_CP013412.1|WP_045598866.1|17114_17417_-|transposase
MNRIPRAVYTKELRDEAVKLALAEGVGISEASRRLSIPIETLANWVRAAKAGKLKDVGRPQKPLTEVEAELAQVKCELAEVKMERDLLKMFATYFAKESR
>NZ_CP013412.1|WP_045598867.1|17586_18609_-|UDP-glucose-4-epimerase-GalE
MSTKGTILVTGGAGYIGSHTAVELLEHGYDVVIADNLVNSKREAIARIEQITGKTPAFHEADVSDERALARIFDAHPITAAIHFAALKAVGESVAKPVEYYRNNLDSLLSLLRVMRERDVKRIVFSSSATVYGVPERSPIDETFPLSATNPYGQTKLMAEQILRDVEAADPSWRVATLRYFNPVGAHESGLIGEDPAGIPNNLMPYVAQVAVGKLEKLRVFGSDYATPDGTGVRDYIHVVDLARGHIAALDALERRDASLTVNLGTGRGYSVLEVVRAFEKASGRPVPYELVARRPGDVAECYANPAAAAEVIGWKAERDLERMCADHWRWQENNPRGFA
>NZ_CP013412.1|WP_045598869.1|18788_20621_-|glutamine--fructose-6-phosphate-transaminase-(isomerizing)
MCGIVGAVAQRNIVPVLIEGLRRLEYRGYDSCGVAVLGAGAPAPGAPRRARSVARVADLDAQVRESHLGGVTGIAHTRWATHGAPVTHNAHPIFSSNALALVHNGIIENFEPLREGLRAKGYAFVSQTDTEVIAHLIHSLYRGNLFAAVQEAVKQLHGAYAIAVIHEDEPHTVVGARQGSPLVVGFGEQENFLASDALALAGSTDRFTFLEEGDVCELTLAGVTIVDRDGARAVREVRVVAAYGGAVELGPYRHFMQKEIFEQPRAIADTIAQADAFDPSLFGERAGSVFAGIDSLLILACGTSYYSGLTAKYWLESIAKIPTQVEIASEYRYRESVPNPRALVVVISQSGETADTLAALKHAQALGHAHTLAICNVATSAMVRQTELQFLTHAGTEIGVASTKAFTTQLVALFVLAATLGKLRGHVDAAREADYLKQLRHLPAALNSVLALEPQIIAWSEEFAHMENTLFLGRGLHYPISLEGALKLKEISYIHAEAYPAGELKHGPLALVTEAMPVVTVAPNDTLLEKLKSNMQEVRARGGELYVFADADTHIVNDEGLHVIRMPEHYGPLSPILHVVPLQLLAYHTACARGTDVDKPRNLAKSVTVE
>NZ_CP013412.1|WP_082256009.1|21212_22070_-|hypothetical-protein
MGEWLMRMCATGVIASVAYAQDVVGRTPVPAPTIALFYGESVPVGQLNGFDVVVVEPDATFDPRAYPDKKPAWFAYASVGEVNGERRYAVRMPRKWLIGANQAWAAAVIDQAAPGWPDFFVDHVIAPLWERGYRGFFLDTLDSYQLVAKTGAARVGQEAGIVRVIRKLKARYPSARLILNRGFEVLPQVHGLVDMVAFESLYRGWDPVKQQYTEVSPPDRDWLLAQARSIRTQYGLPVLAIDYCPERDEQCRKDTASRIVAAGLTPYVTDGGLMTVGYGKAVRLK
>NZ_CP013412.1|WP_045598871.1|22182_23559_-|exopolysaccharide-Pel-transporter-PelG
MAGIGFELRNILRRDSLNSVARAYVYAGLIGSGPQILSIFGILIIGQLSLASVIPANAVVQFQMSVTYLIAVSLVLTGPFQLTLTRFVSDRLFEANDNLVLWNYNGVVLVVTALAGVFATAAVLAGFGGTSAIYRGLMIAGFVVLSQIWIAVIFLSGVKQYRQILVVFFVGYGCSIGFALCLTRFGLVGLLSGFVAGQIVLLAGLTAFVYCDYHSERLVSYEVFNRRYTYPSLAMVGLLFNVGVWLDKFMFWYAPGTGSRVIGPLYASVIYDIPVFLAYVCVMPGMAAFLVRIEADFVEYYDAFYEGVRNGATLHHINGMRDMMVRCVRTGLYEIVKVQAVVLLLIAAFGERLLNVFGISPLYYPLLVIHVMSASLQVLLLGILNVFFYLDRRRNVLRLTCEFALLNGVLTAVTLKLGPDYYGYGFAIALLIVVVAAMSRLDRTFQSLEYETYMLRRG
>NZ_CP013412.1|WP_045598873.1|23558_25202_-|DUF3492-domain-containing-protein
MNAIPNRRADNADVCLLLEGTFPFVRGGVSSWVNDMIRSFPALRFAIVFIGSRAQDYTGHAYPLPDNVVDLEVHYLYGDEPADLPPQRAIDGDTHAFARSRLLHETLRKRDGKNEMRMLLAKIVPMLGADGALSEQAFLSSRQAWETIVDEYRQRCSDPSFTDYFWTVRTMHKPLWLLARIAEQAPKARVYHTVSTGYAGFLGALMHYRTGRPLLLSEHGIYTKERKIDLLQSQWIRDNRGMFERDISRVSYFQELWVRFFEALGRVAYEAAEDIIGLYEANRARQVADGAPEARTQCIPNGIDIEHFSHALAQRKPGEGHRVVALIGRVVPIKDIKTFIRMIFIALRTMPDIEGWIVGPEEEDPGYAEECRALVESLGLAENVRFLGFRRVNETLPQVDLVALTSVSEGLPLVLLEGFAAGVPAVTTDVGSCRQLIEGGDDEDRALGAAGAVVPIANPAAFAQAAVSLLTDHARWQAAQRAGLARVRSYYTKARMIERYRALYDKLAALPDQTRYGDATHCPFSHGGMRWHGRVDATRRDVTEGAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP013412_1	1.1\|12460\|44\|NZ_CP013412\|PILER-CR	12460-12503	44	NZ_CP013412.1	12628-12671	0	1.0
NZ_CP013412_1	1.2\|12556\|49\|NZ_CP013412\|PILER-CR	12556-12604	49	NZ_CP013412.1	12359-12407	1	0.98
NZ_CP013412_1	1.2\|12556\|49\|NZ_CP013412\|PILER-CR	12556-12604	49	NZ_CP013412.1	12695-12743	1	0.98
NZ_CP013412_1	1.2\|12556\|49\|NZ_CP013412\|PILER-CR	12556-12604	49	NZ_CP013412.1	12863-12911	2	0.959

1. spacer 1.1|12460|44|NZ_CP013412|PILER-CR matches to position: 12628-12671, mismatch: 0, identity: 1.0

ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	CRISPR spacer
ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	Protospacer
********************************************

2. spacer 1.2|12556|49|NZ_CP013412|PILER-CR matches to position: 12359-12407, mismatch: 1, identity: 0.98

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagaacccagcgcatttgaagtcgcaccgct	Protospacer
********************* ***************************

3. spacer 1.2|12556|49|NZ_CP013412|PILER-CR matches to position: 12695-12743, mismatch: 1, identity: 0.98

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagaacccagcgcatttgaagtcgcaccgct	Protospacer
********************* ***************************

4. spacer 1.2|12556|49|NZ_CP013412|PILER-CR matches to position: 12863-12911, mismatch: 2, identity: 0.959

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagtacccagcgcatttgaattcgctccgct	Protospacer
************************************** **** *****

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP013412_1	1.1\|12460\|44\|NZ_CP013412\|PILER-CR	12460-12503	44	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	12460-12503	0	1.0
NZ_CP013412_1	1.1\|12460\|44\|NZ_CP013412\|PILER-CR	12460-12503	44	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	12628-12671	0	1.0
NZ_CP013412_1	1.1\|12460\|44\|NZ_CP013412\|PILER-CR	12460-12503	44	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	229970-230013	0	1.0
NZ_CP013412_1	1.1\|12460\|44\|NZ_CP013412\|PILER-CR	12460-12503	44	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	230138-230181	0	1.0
NZ_CP013412_1	1.2\|12556\|49\|NZ_CP013412\|PILER-CR	12556-12604	49	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	12527-12575	0	1.0
NZ_CP013412_1	1.2\|12556\|49\|NZ_CP013412\|PILER-CR	12556-12604	49	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	230037-230085	0	1.0
NZ_CP013412_1	1.1\|12460\|44\|NZ_CP013412\|PILER-CR	12460-12503	44	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	12796-12839	1	0.977
NZ_CP013412_1	1.1\|12460\|44\|NZ_CP013412\|PILER-CR	12460-12503	44	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	230306-230349	1	0.977
NZ_CP013412_1	1.2\|12556\|49\|NZ_CP013412\|PILER-CR	12556-12604	49	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	12359-12407	1	0.98
NZ_CP013412_1	1.2\|12556\|49\|NZ_CP013412\|PILER-CR	12556-12604	49	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	12695-12743	1	0.98
NZ_CP013412_1	1.2\|12556\|49\|NZ_CP013412\|PILER-CR	12556-12604	49	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	229869-229917	1	0.98
NZ_CP013412_1	1.2\|12556\|49\|NZ_CP013412\|PILER-CR	12556-12604	49	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	230205-230253	1	0.98
NZ_CP013412_1	1.2\|12556\|49\|NZ_CP013412\|PILER-CR	12556-12604	49	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	12863-12911	2	0.959
NZ_CP013412_1	1.2\|12556\|49\|NZ_CP013412\|PILER-CR	12556-12604	49	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	230373-230421	2	0.959
NZ_CP013412_1	1.1\|12460\|44\|NZ_CP013412\|PILER-CR	12460-12503	44	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	119717-119760	10	0.773
NZ_CP013412_1	1.1\|12460\|44\|NZ_CP013412\|PILER-CR	12460-12503	44	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	10839-10882	10	0.773

1. spacer 1.1|12460|44|NZ_CP013412|PILER-CR matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 0, identity: 1.0

ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	CRISPR spacer
ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	Protospacer
********************************************

2. spacer 1.1|12460|44|NZ_CP013412|PILER-CR matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 0, identity: 1.0

ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	CRISPR spacer
ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	Protospacer
********************************************

3. spacer 1.1|12460|44|NZ_CP013412|PILER-CR matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	CRISPR spacer
ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	Protospacer
********************************************

4. spacer 1.1|12460|44|NZ_CP013412|PILER-CR matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	CRISPR spacer
ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	Protospacer
********************************************

5. spacer 1.2|12556|49|NZ_CP013412|PILER-CR matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 0, identity: 1.0

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	Protospacer
*************************************************

6. spacer 1.2|12556|49|NZ_CP013412|PILER-CR matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	Protospacer
*************************************************

7. spacer 1.1|12460|44|NZ_CP013412|PILER-CR matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 1, identity: 0.977

ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	CRISPR spacer
ctagaacccagagcgcttgaattcgctccgctcgccactgcttg	Protospacer
*.******************************************

8. spacer 1.1|12460|44|NZ_CP013412|PILER-CR matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.977

ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	CRISPR spacer
ctagaacccagagcgcttgaattcgctccgctcgccactgcttg	Protospacer
*.******************************************

9. spacer 1.2|12556|49|NZ_CP013412|PILER-CR matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 1, identity: 0.98

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagaacccagcgcatttgaagtcgcaccgct	Protospacer
********************* ***************************

10. spacer 1.2|12556|49|NZ_CP013412|PILER-CR matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 1, identity: 0.98

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagaacccagcgcatttgaagtcgcaccgct	Protospacer
********************* ***************************

11. spacer 1.2|12556|49|NZ_CP013412|PILER-CR matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.98

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagaacccagcgcatttgaagtcgcaccgct	Protospacer
********************* ***************************

12. spacer 1.2|12556|49|NZ_CP013412|PILER-CR matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.98

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagaacccagcgcatttgaagtcgcaccgct	Protospacer
********************* ***************************

13. spacer 1.2|12556|49|NZ_CP013412|PILER-CR matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 2, identity: 0.959

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagtacccagcgcatttgaattcgctccgct	Protospacer
************************************** **** *****

14. spacer 1.2|12556|49|NZ_CP013412|PILER-CR matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.959

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagtacccagcgcatttgaattcgctccgct	Protospacer
************************************** **** *****

15. spacer 1.1|12460|44|NZ_CP013412|PILER-CR matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 10, identity: 0.773

ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	CRISPR spacer
cgaaaacccagcgcgcttgaactcgctccgctcgccaacgaggc	Protospacer
* *.******* *********.*************** .*

16. spacer 1.1|12460|44|NZ_CP013412|PILER-CR matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.773

ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	CRISPR spacer
cgaaaacccagcgcgcttgaactcgctccgctcgccaacgaggc	Protospacer
* *.******* *********.*************** .*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4190 : 66587

Leptospira_phage(26.67%)

integrase,transposase

attL 7244:7303|attR 70366:71197

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025405302.1\|4190_5411_-\|transposase	ISL3 family transposase	A9YX10	Burkholderia_phage	4.4e-226	92.6
WP_009905744.1\|5725_6931_+	outer membrane protein assembly factor BamC	NA	NA	NA	NA
7244:7303	attL	NA	NA	NA	NA
WP_045598850.1\|8235_8421_-	hypothetical protein	NA	NA	NA	NA
WP_082255990.1\|8593_9361_-	DUF937 domain-containing protein	NA	NA	NA	NA
WP_045598851.1\|9642_9966_-	H-NS histone family protein	NA	NA	NA	NA
WP_102889859.1\|10318_10990_-	OmpA family protein	NA	NA	NA	NA
WP_082255991.1\|11156_13562_-	hypothetical protein	NA	NA	NA	NA
WP_082255992.1\|14060_15137_-	EAL domain-containing protein	NA	NA	NA	NA
WP_082256008.1\|15677_16256_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	1.6e-40	53.4
WP_082255993.1\|16332_16725_+	MAPEG family protein	NA	NA	NA	NA
WP_082255994.1\|16747_17047_-\|transposase	transposase	S5WIU1	Leptospira_phage	3.0e-19	52.7
WP_045598866.1\|17114_17417_-\|transposase	transposase	NA	NA	NA	NA
WP_045598867.1\|17586_18609_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	1.9e-84	47.5
WP_045598869.1\|18788_20621_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	1.3e-141	47.2
WP_082256009.1\|21212_22070_-	hypothetical protein	NA	NA	NA	NA
WP_045598871.1\|22182_23559_-	exopolysaccharide Pel transporter PelG	NA	NA	NA	NA
WP_045598873.1\|23558_25202_-	DUF3492 domain-containing protein	NA	NA	NA	NA
WP_045598875.1\|25198_26212_-	hypothetical protein	NA	NA	NA	NA
WP_045598877.1\|26204_27605_-	membrane protein	NA	NA	NA	NA
WP_052712455.1\|27640_28192_-	hypothetical protein	NA	NA	NA	NA
WP_082256010.1\|28229_32096_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_127447000.1\|32166_34914_-	sugar ABC transporter	NA	NA	NA	NA
WP_082255995.1\|35674_35842_-	hypothetical protein	NA	NA	NA	NA
WP_045598690.1\|36535_37762_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_082256011.1\|37949_39503_+	S8 family serine peptidase	A0A2K9L199	Tupanvirus	2.8e-15	34.2
WP_045598690.1\|39576_40803_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_127447001.1\|41292_41547_+	hypothetical protein	NA	NA	NA	NA
WP_045598883.1\|41618_41945_-	HigA family addiction module antidote protein	I6ZVM3	Aeromonas_phage	9.0e-09	39.4
WP_045598886.1\|41954_42233_-	hypothetical protein	A0A2L1IV28	Escherichia_phage	1.9e-20	47.8
WP_060970101.1\|42304_42550_-	hypothetical protein	NA	NA	NA	NA
WP_082255996.1\|42793_43009_-	hypothetical protein	NA	NA	NA	NA
WP_045598888.1\|43005_43779_-	AAA family ATPase	U5N3V8	Enterobacteria_phage	1.4e-36	37.7
WP_045598890.1\|43765_45265_-\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	6.0e-31	32.8
WP_102889826.1\|45826_46258_+\|transposase	transposase	NA	NA	NA	NA
WP_052712457.1\|47401_48628_+	replication initiation protein	NA	NA	NA	NA
WP_045598892.1\|49783_50257_+\|transposase	transposase	NA	NA	NA	NA
WP_045598698.1\|50232_50583_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.1e-17	39.4
WP_045598699.1\|50614_52180_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	9.8e-69	34.0
WP_082255997.1\|52272_52545_+	hypothetical protein	NA	NA	NA	NA
WP_102889787.1\|52944_53755_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_045598894.1\|53803_54835_-	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_045598899.1\|54831_55491_-	AAA family ATPase	A2I303	Vibrio_virus	4.8e-17	32.9
WP_127447002.1\|56358_56586_-	hypothetical protein	NA	NA	NA	NA
WP_045598732.1\|56582_56891_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_102889860.1\|56978_57783_+\|transposase	IS5 family transposase	A0A0M5M147	Mycobacterium_phage	1.3e-21	32.4
WP_052712458.1\|57861_59376_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_045598690.1\|60719_61946_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_082255998.1\|61951_62167_-\|transposase	transposase	NA	NA	NA	NA
WP_045599009.1\|62607_63081_+\|transposase	transposase	NA	NA	NA	NA
WP_045598698.1\|63056_63407_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.1e-17	39.4
WP_155722043.1\|63438_63609_+	hypothetical protein	NA	NA	NA	NA
WP_060970100.1\|63679_63928_-	hypothetical protein	NA	NA	NA	NA
WP_045598909.1\|64262_64766_-	peptidoglycan-associated lipoprotein Pal	NA	NA	NA	NA
WP_045598911.1\|64889_66587_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
70366:71197	attR	NA	NA	NA	NA

DBSCAN-SWA_2

72192 : 133420

Leptospira_phage(30.0%)

integrase,transposase

attL 70365:70424|attR 121260:122093

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
70365:70424	attL	NA	NA	NA	NA
WP_102889797.1\|72192_72949_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_045598928.1\|72927_73722_-	DUF2063 domain-containing protein	NA	NA	NA	NA
WP_045598929.1\|73705_74599_-	DUF692 domain-containing protein	NA	NA	NA	NA
WP_045598930.1\|74614_74935_-	DUF2282 domain-containing protein	NA	NA	NA	NA
WP_052712460.1\|75047_75704_-	DUF1109 domain-containing protein	NA	NA	NA	NA
WP_045598931.1\|75705_76275_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_045599015.1\|76664_77120_+	hypothetical protein	NA	NA	NA	NA
WP_045598932.1\|77223_77940_+	TVP38/TMEM64 family protein	NA	NA	NA	NA
WP_045598933.1\|78037_78700_+	hypothetical protein	NA	NA	NA	NA
WP_045598935.1\|78761_79343_-	alkylhydroperoxidase	NA	NA	NA	NA
WP_082256013.1\|79433_80006_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_045599019.1\|80103_80796_-	haloacid dehalogenase type II	NA	NA	NA	NA
WP_045598936.1\|81063_81315_+	DUF2282 domain-containing protein	NA	NA	NA	NA
WP_045598937.1\|81322_82225_+	DUF692 domain-containing protein	NA	NA	NA	NA
WP_045598939.1\|82208_82985_+	hypothetical protein	NA	NA	NA	NA
WP_045598941.1\|83010_83478_+	DoxX family protein	NA	NA	NA	NA
WP_082256000.1\|83479_85693_+	pyridine nucleotide-disulfide oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	2.2e-37	26.9
WP_045598942.1\|85740_85971_+	zf-HC2 domain-containing protein	NA	NA	NA	NA
WP_127447003.1\|86046_86406_+	hypothetical protein	NA	NA	NA	NA
WP_045598944.1\|86406_87498_-	hypothetical protein	NA	NA	NA	NA
WP_045598945.1\|87494_88151_-	glycosyltransferase	NA	NA	NA	NA
WP_082256001.1\|88159_88951_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_045598946.1\|88968_89850_-	S-methyl-5'-thioadenosine phosphorylase	NA	NA	NA	NA
WP_082256002.1\|89846_90557_-	hypothetical protein	NA	NA	NA	NA
WP_102889801.1\|91073_91890_+\|transposase	IS5 family transposase	A0A0M5M147	Mycobacterium_phage	2.3e-21	32.4
WP_045598949.1\|91968_93342_-	MFS transporter	NA	NA	NA	NA
WP_045598951.1\|93403_93613_-	zf-HC2 domain-containing protein	NA	NA	NA	NA
WP_082256004.1\|93606_94233_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_045598953.1\|94278_95025_-	cytochrome c biogenesis protein CcdA	NA	NA	NA	NA
WP_045598954.1\|95006_95393_-	thioredoxin family protein	A0A1S5XY47	Kurlavirus	5.8e-07	38.5
WP_052712463.1\|95546_96503_-	hypothetical protein	NA	NA	NA	NA
WP_045598956.1\|96715_97699_+	radical SAM/Cys-rich domain protein	NA	NA	NA	NA
WP_082256014.1\|97710_98730_+	hypothetical protein	NA	NA	NA	NA
WP_052712464.1\|99767_101228_+	radical SAM protein	NA	NA	NA	NA
WP_045598957.1\|101257_102034_+	DUF547 domain-containing protein	NA	NA	NA	NA
WP_045598958.1\|102092_102383_-	DUF427 domain-containing protein	NA	NA	NA	NA
WP_045598960.1\|102655_105637_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	6.0e-83	27.0
WP_045598962.1\|105983_106448_+	hypothetical protein	NA	NA	NA	NA
WP_045598964.1\|107023_107296_+	hypothetical protein	NA	NA	NA	NA
WP_045598966.1\|107322_107751_-	hypothetical protein	NA	NA	NA	NA
WP_045598968.1\|107920_108217_+	H-NS histone family protein	NA	NA	NA	NA
WP_052712465.1\|108829_110065_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_045598684.1\|110984_112133_-	DUF2827 domain-containing protein	NA	NA	NA	NA
WP_080554816.1\|112153_113311_-	DUF2827 domain-containing protein	NA	NA	NA	NA
WP_102889861.1\|113304_120318_-	hemagglutinin	NA	NA	NA	NA
WP_045598688.1\|120453_120783_-	hypothetical protein	NA	NA	NA	NA
WP_045598978.1\|123090_123669_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	1.6e-40	53.4
121260:122093	attR	NA	NA	NA	NA
WP_045598689.1\|124089_125196_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_082256005.1\|125637_126531_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	1.3e-38	56.3
WP_045598690.1\|126765_127992_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_045598692.1\|128331_128685_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	8.2e-16	40.4
WP_082256006.1\|129092_129866_-	FkbM family methyltransferase	A0A218MM68	uncultured_virus	3.1e-15	30.3
WP_127447004.1\|130484_130826_-	hypothetical protein	NA	NA	NA	NA
WP_045598892.1\|131023_131497_+\|transposase	transposase	NA	NA	NA	NA
WP_045598698.1\|131472_131823_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.1e-17	39.4
WP_045598699.1\|131854_133420_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	9.8e-69	34.0

Anti-CRISPR protein detection

Acr_ID: NZ_CP013412.1|WP_127447001.1|41292_41547_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_CP013412.1|WP_082255995.1|35674_35842_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP013412.1|WP_127447001.1|41292_41547_+|hypothetical-protein

41292_41547_+

84 aa aa

4190-66587

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP013412_1	Orphan	1.1\|12460\|44\|NZ_CP013412\|PILER-CR	12460-12503	44	12628-12671	0
NZ_CP013412_1	Orphan	1.2\|12556\|49\|NZ_CP013412\|PILER-CR	12556-12604	49	12359-12407	1
NZ_CP013412_1	Orphan	1.2\|12556\|49\|NZ_CP013412\|PILER-CR	12556-12604	49	12695-12743	1
NZ_CP013412_1	Orphan	1.2\|12556\|49\|NZ_CP013412\|PILER-CR	12556-12604	49	12863-12911	2

1. spacer 1.1|12460|44|NZ_CP013412|PILER-CR matches to NZ_CP013412 position: 12628-12671, mismatch: 0

ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	CRISPR spacer
ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	Protospacer
********************************************

2. spacer 1.2|12556|49|NZ_CP013412|PILER-CR matches to NZ_CP013412 position: 12359-12407, mismatch: 1

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagaacccagcgcatttgaagtcgcaccgct	Protospacer
********************* ***************************

3. spacer 1.2|12556|49|NZ_CP013412|PILER-CR matches to NZ_CP013412 position: 12695-12743, mismatch: 1

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagaacccagcgcatttgaagtcgcaccgct	Protospacer
********************* ***************************

4. spacer 1.2|12556|49|NZ_CP013412|PILER-CR matches to NZ_CP013412 position: 12863-12911, mismatch: 2

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagtacccagcgcatttgaattcgctccgct	Protospacer
************************************** **** *****

NZ_CP013412.1|WP_082255995.1|35674_35842_-|hypothetical-protein

35674_35842_-

55 aa aa

4190-66587

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP013412_1	Orphan	1.1\|12460\|44\|NZ_CP013412\|PILER-CR	12460-12503	44	12628-12671	0
NZ_CP013412_1	Orphan	1.2\|12556\|49\|NZ_CP013412\|PILER-CR	12556-12604	49	12359-12407	1
NZ_CP013412_1	Orphan	1.2\|12556\|49\|NZ_CP013412\|PILER-CR	12556-12604	49	12695-12743	1
NZ_CP013412_1	Orphan	1.2\|12556\|49\|NZ_CP013412\|PILER-CR	12556-12604	49	12863-12911	2

1. spacer 1.1|12460|44|NZ_CP013412|PILER-CR matches to NZ_CP013412 position: 12628-12671, mismatch: 0

ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	CRISPR spacer
ccagaacccagagcgcttgaattcgctccgctcgccactgcttg	Protospacer
********************************************

2. spacer 1.2|12556|49|NZ_CP013412|PILER-CR matches to NZ_CP013412 position: 12359-12407, mismatch: 1

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagaacccagcgcatttgaagtcgcaccgct	Protospacer
********************* ***************************

3. spacer 1.2|12556|49|NZ_CP013412|PILER-CR matches to NZ_CP013412 position: 12695-12743, mismatch: 1

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagaacccagcgcatttgaagtcgcaccgct	Protospacer
********************* ***************************

4. spacer 1.2|12556|49|NZ_CP013412|PILER-CR matches to NZ_CP013412 position: 12863-12911, mismatch: 2

tgttgttagcgaccgcaccagtacccagcgcatttgaagtcgcaccgct	CRISPR spacer
tgttgttagcgaccgcaccagtacccagcgcatttgaattcgctccgct	Protospacer
************************************** **** *****

3. NZ_CP013413

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013413_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013413_1

1620033-1620124

Orphan

Consensus_repeat	Method
GCGACGCGCGCAAGGCCGAAGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013413_1

>merge|NZ_CP013413|1|1620033-1620124|CRISPRCasFinder
GCGACGCGCGCAAGGCCGAAGCGGGCGCGAAGCGCACGGCCGACGACGACAGGCACCGCAAGCACGACGGCGACGCGCGCAAGGCGGAAGCG

>NZ_CP013413|1|1|1620033-1620124|CRISPRCasFinder
GCGACGCGCGCAAGGCCGAAGCG	GGCGCGAAGCGCACGGCCGACGACGACAGGCACCGCAAGCACGACG
GCGACGCGCGCAAGGCGGAAGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013413.1\|WP_009899924.1\|1623855_1624581_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
NZ_CP013413.1\|WP_045602540.1\|1616460_1616814_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013413.1\|WP_045602528.1\|1627099_1628578_+\|serine/threonine-protein-phosphatase	unknown	unknown	gnl\|CDD\|277318
NZ_CP013413.1\|WP_009896602.1\|1613387_1613729_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013413.1\|WP_009896595.1\|1618676_1619186_+\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|183009
NZ_CP013413.1\|WP_102889811.1\|1628910_1630260_+\|cytochrome-c-methylamine-utilization-protein	unknown	unknown	gnl\|CDD\|224771
NZ_CP013413.1\|WP_045602529.1\|1625989_1626880_+\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|226145
NZ_CP013413.1\|WP_045602542.1\|1612022_1613213_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NZ_CP013413.1\|WP_011401139.1\|1632202_1632415_+\|DUF3079-domain-containing-protein	unknown	unknown	gnl\|CDD\|337966
NZ_CP013413.1\|WP_009899936.1\|1615734_1616376_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013413.1\|WP_045602525.1\|1630422_1631283_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|377216
NZ_CP013413.1\|WP_045602530.1\|1624630_1625938_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929
NZ_CP013413.1\|WP_082256091.1\|1614108_1615557_+\|alkaline-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|293737
NZ_CP013413.1\|WP_127446982.1\|1613753_1614050_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013413.1\|WP_009899933.1\|1617467_1618484_-\|1-aminocyclopropane-1-carboxylate-deaminase	unknown	unknown	gnl\|CDD\|183494
NZ_CP013413.1\|WP_045602520.1\|1631614_1631887_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013413.1\|WP_045602544.1\|1609735_1611766_+\|BCCT-family-transporter	unknown	unknown	gnl\|CDD\|376718
NZ_CP013413.1\|WP_045602536.1\|1621417_1622038_-\|HAD-hydrolase-like-protein	unknown	unknown	gnl\|CDD\|319799
NZ_CP013413.1\|WP_082256093.1\|1622392_1623748_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340877
NZ_CP013413.1\|WP_045602546.1\|1608451_1609396_-\|MurR/RpiR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224651

Protein	Function_ID	Function_description	E-value
NZ_CP013413.1\|WP_009899924.1\|1623855_1624581_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	3.20406e-58
NZ_CP013413.1\|WP_045602525.1\|1630422_1631283_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|377216	pfam04072, LCM, Leucine carboxyl methyltransferase. Family of leucine carboxyl methyltransferases EC:2.1.1.-. This family may need divides a the full alignment contains a significantly shorter mouse sequence.	3.14694e-51
NZ_CP013413.1\|WP_045602528.1\|1627099_1628578_+\|serine/threonine-protein-phosphatase	gnl\|CDD\|277318	cd00839, MPP_PAPs, purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain. Purple acid phosphatases (PAPs) belong to a diverse family of binuclear metallohydrolases that have been identified and characterized in plants, animals, and fungi. PAPs contain a binuclear metal center and their characteristic pink or purple color derives from a charge-transfer transition between a tyrosine residue and a chromophoric ferric ion within the binuclear center. PAPs catalyze the hydrolysis of a wide range of activated phosphoric acid mono- and di-esters and anhydrides. PAPs are distinguished from the other phosphatases by their insensitivity to L-(+) tartrate inhibition and are therefore also known as tartrate resistant acid phosphatases (TRAPs). While only a few copies of PAP-like genes are present in mammalian and fungal genomes, multiple copies are present in plant genomes. PAPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	1.67697e-08
NZ_CP013413.1\|WP_011401139.1\|1632202_1632415_+\|DUF3079-domain-containing-protein	gnl\|CDD\|337966	pfam11278, DUF3079, Protein of unknown function (DUF3079). This family of proteins with unknown function appears to be restricted to Proteobacteria.	1.88329e-34
NZ_CP013413.1\|WP_009896595.1\|1618676_1619186_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|183009	PRK11169, PRK11169, leucine-responsive transcriptional regulator Lrp.	6.18054e-47
NZ_CP013413.1\|WP_045602529.1\|1625989_1626880_+\|amidohydrolase-family-protein	gnl\|CDD\|226145	COG3618, COG3618, Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only].	3.36497e-69
NZ_CP013413.1\|WP_045602542.1\|1612022_1613213_-\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	7.72702e-56
NZ_CP013413.1\|WP_102889811.1\|1628910_1630260_+\|cytochrome-c-methylamine-utilization-protein	gnl\|CDD\|224771	COG1858, MauG, Cytochrome c peroxidase [Inorganic ion transport and metabolism].	3.41672e-84
NZ_CP013413.1\|WP_045602530.1\|1624630_1625938_+\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.64572e-133
NZ_CP013413.1\|WP_082256091.1\|1614108_1615557_+\|alkaline-phosphatase-family-protein	gnl\|CDD\|293737	cd16013, AcpA, acid phosphatase A. Acid phosphatase A catalyzes the hydrolysis reaction via a phosphoseryl intermediate to produce inorganic phosphate and the corresponding alcohol, optimally at low pH. AcpA hydrolyzes a variety of substrates, including p-nitrophenylphosphate (pNPP), p-nitrophenylphosphorylcholine (pNPPC), peptides containing phosphotyrosine, inositol phosphates, AMP, ATP, fructose 1,6-bisphosphate, glucose and fructose 6-phosphates, NADP, and ribose 5-phosphate. AcpA is distinct from histidine ACPs and purple ACPs, as well as class A, B, and C bacterial nonspecific ACPs.	2.81113e-100
NZ_CP013413.1\|WP_009899933.1\|1617467_1618484_-\|1-aminocyclopropane-1-carboxylate-deaminase	gnl\|CDD\|183494	PRK12390, PRK12390, 1-aminocyclopropane-1-carboxylate deaminase; Provisional.	0
NZ_CP013413.1\|WP_045602544.1\|1609735_1611766_+\|BCCT-family-transporter	gnl\|CDD\|376718	pfam02028, BCCT, BCCT, betaine/carnitine/choline family transporter.	0
NZ_CP013413.1\|WP_045602536.1\|1621417_1622038_-\|HAD-hydrolase-like-protein	gnl\|CDD\|319799	cd04303, HAD_PGPase, phosphoglycolate phosphatase, similar to Synechococcus elongates phosphoglycolate phosphatase PGP/CbbZ. Phosphoglycolate phosphatase catalyzes the dephosphorylation of phosphoglycolate; its activity requires divalent cations, especially Mg++. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	2.63936e-66
NZ_CP013413.1\|WP_082256093.1\|1622392_1623748_-\|MFS-transporter	gnl\|CDD\|340877	cd17319, MFS_ExuT_GudP_like, Hexuronate transporter, Glucarate transporter, and similar transporters of the Major Facilitator Superfamily. This family is composed of predominantly bacterial transporters for hexuronate (ExuT), glucarate (GudP), galactarate (GarP), and galactonate (DgoT). They mediate the uptake of these compounds into the cell. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.2761e-76
NZ_CP013413.1\|WP_045602546.1\|1608451_1609396_-\|MurR/RpiR-family-transcriptional-regulator	gnl\|CDD\|224651	COG1737, RpiR, Transcriptional regulators [Transcription].	5.08593e-56

>NZ_CP013413.1|WP_009896595.1|1618676_1619186_+|winged-helix-turn-helix-transcriptional-regulator
MCATKKSAPKAAAQPAGADIDRVDRAILRMLQRDASISNVALAAKVNLSAPACLRRVERLKEMGLIRGIVALLEPKALNAGMLVMIGVVLDRSTPDSFGAFEQAAQKVSGCMECHVVTGEFDYIMLIRTRDSDTFNRLHAEQLLYLPGVRQIRTFVVLKEILSTTSFPI
>NZ_CP013413.1|WP_009899933.1|1617467_1618484_-|1-aminocyclopropane-1-carboxylate-deaminase
MNLQKFPRYPLTFGPTPIQPLKRLSAHLGGKVELYAKRDDCNSGLAFGGNKTRKLEYLIPDALAQGCDTLVSIGGIQSNQTRQVAAVAAHLGMKCVLVQENWVNYHDAVYDRVGNIQMSRMMGADVRLVPDGFDIGFRKSWEDALADVRARGGKPYAIPAGCSDHPLGGLGFVGFAEEVRVQEAELGFKFDYVVVCSVTGSTQAGMVVGFAADGRADRVIGIDASAKPAQTREQILRIARNTADRVELGRDIASGDVVLDERFGGPEYGLPNEGTLEAIRLCAKLEGVLTDPVYEGKSMHGMIEKVRLGEFPAGSKVLYAHLGGVPALNAYSFLFRDG
>NZ_CP013413.1|WP_045602540.1|1616460_1616814_-|hypothetical-protein
MGFVGGERRRARIAESNEIDGATLITEVASEPLAALGGARSEATPPLTLYGAYRQGFADYLAGRPNPYRIGSRLAGVWHEGHAEAASNDALDFTARARTCGGARTAANPVAFFRRRR
>NZ_CP013413.1|WP_009899936.1|1615734_1616376_+|hypothetical-protein
MKIRSGLVAELTVNLLLPWAAYRAAVPHWGETGGLIASAVPPLAWSVIELARFRRIDALSAVVLFGIVLSIAAALAGGSPRMLLMRESLASGAIGVAFLGSLALRKPLVFHLARATIAREAHDGAARIDALWAERPAFVSAMRLMTLVWGSGLVAENLLRAWMVWNWPVERVLVVAPFVGYGIYGALMLWTLWYRKVMRAHALAGLPRGGALG
>NZ_CP013413.1|WP_082256091.1|1614108_1615557_+|alkaline-phosphatase-family-protein
MRRRARRPATPPAHKKEKIVAKILENVEHIVVVMFENRSFDTMLGWLYPPGTQPAHVLPARGSPQFDGLKPDMSNPSRAGKTIAVTREATNNVIPDPQETFVNVTSQILGPGGAGNPWPPMQGFVVNYETTQTTDPGHVMQCHSVAQLPTLTALARAYAVSDAWFASVPSQTWPNRAFAHAGTSNGHVNNGAIPDPLEWDVPTIFDVLSSIGASWAVYRDTAVTPSLTHTMFPSLWNDKYADNFKRFPDFVAACKNDALPRYAFVEPSFLFEPNDQHPPHDVLAGDKFLHDIWTAISTSPGWPRTLLVVTYDEHGGCFDHVLPPANATPPDAASNPGDETFEFDRFGVRVPAVVVSPYIEAGTVFRSPTNVPYDHTSILATLRDWLAIAPDKMLKSARIANAPTLAQLFTRSVPRGDLPAIAAPSADFVQPPPSAPLNDLQKSLVTGTSRRDGNDPAASVAPIATRQHALDFFTRRATAKPT
>NZ_CP013413.1|WP_127446982.1|1613753_1614050_+|hypothetical-protein
MTTEPAHASGGARSFTHRADRAAIRRHDGRRHRQRHLRHQRGYRRNESVFMGRGANSAPGDKFAAMIETAPARAPPPARRVAGTPAAPPCFSRNIGYT
>NZ_CP013413.1|WP_009896602.1|1613387_1613729_+|hypothetical-protein
MIAPATPAALAAGATTFAEWAALGTLALLYLFGLGWSLRGALARSRGRAYWLACAALIAGGTACALLAKPSAPNSGEMPPGFGLGVLVVMLGIAGTTAGCAWQAIARLRHGQR
>NZ_CP013413.1|WP_045602542.1|1612022_1613213_-|serine-hydrolase
MNPESVTPATAAAAATDHAALAGRLDRVFATALAERRVVGAVALVARGGELVYRRAHGFAERETQRPMREDTLFRLSSITKPIVTVAVLRLVAAGRMALDAPITRWLPEFAPALPDGRAPALTVHQLLTHTAGLSYWLLEAPGSAYHTLGISDGIDLVDFDLAENLRRIAAAPLAFEPGSAWRYSLALDVLGAAIERETGLALPDAVAQLVTTPLGLRDTGFVAADPARFAAAYANAAPQPVRITDNLDVPLPEGHGVAVRFAPSRVFDARAFASGGAGMYGSADDVLRVLETIRTGGDGFLPAALAAAMRTDHTGPAAETRGPGWGFGYGGAVLSDPARAQSPQSAGTLQWGGVYGHSWFVDAARGLTVLLMTNTAYEGMSGPLTVEVRDAVYAV
>NZ_CP013413.1|WP_045602544.1|1609735_1611766_+|BCCT-family-transporter
MPSSRSAPRTTLKPQVVVPSLAVIGALLAVCALLPNEAGALFGAGQQWIVERFDWFYVLAITTFLIFIVLIAASRFGNIKLGPDDAEPEFSFVSWTAMLFAAGMGIGLMYFGVGEPIQHYLKPPTALGGTPAAAREAMLMSFFHWGLHAWATYGVMGLVLAYFGFRYNLPLTLRSGLYPVLREGVNGWIGHTVDAFALVGTVAGIAVTLGYGVLQLSAGLHTIAGWQTDSDAFRIGLVAVVVALAGLSAASGLDKGVRRLSELNLMLAFALLAFVVVAGPTSFLLRAFGDNVGEYLSKLVSLSFRTYAYEAPNDKGWFGGWTLLYWAWWVSWSPFVGMFIARISRGRTIREFVIGVLLVPTAFNLVWMTAFGNSAIWLDTHAAAGALAQTATNVDALLFRFFDYLPLTQLLSVAAIVLIAVFFVTSADSGAFVIDAIATRGAPHSPVWQRLFWAAVLGVTASVLLVAGGLKALQALTLVAALPVALVMLALCYGLWRGLKADHAHYSQEMAPATSFWTGQHWRQRLSQILRHTTGADARRFIAQTVEPALRKVADELKAGGVDAHVARDDDDAVRLTVPAPAQRDFVYGARVSRKSAPAFRIREAAEPEPQREHVCEVLTFFADGRLGYDIEYLRGDEIIADVLRQYERYVSLAADTRTHLLNRAPEHAGPDGLTQ
>NZ_CP013413.1|WP_045602546.1|1608451_1609396_-|MurR/RpiR-family-transcriptional-regulator
MSDSPDSPPDAEPSIAARIAAALPSLTPIHRRMGEYVLANPFRAATMRIDELANAVDASIATANRFARALGFDGYPALRAALVRGFEATLAPVERLRSAQEHEAGARGGELIDASFEQALANLERTRARLDRANVEAAVDSLLAARRIFIVGMGASAFLAGLMEHGLSVYRDNVQSLALLGGPTDAARRLFSARGDDLVVAIAFPRYVHDTIELTRRAAERGAPVLAITDGPDSPVAPFAARALFVHAERRLAATSEAAVLALVEALIDALAHRSQRSARAAAEVTEFMLPWLEARGACAAPPRPPRRSRKTDR
>NZ_CP013413.1|WP_045602536.1|1621417_1622038_-|HAD-hydrolase-like-protein
MAYKLIAFDFDGTLADSLACFLLALSESARQHGFRAIDGALLPQVCGMSAHEIVKLLGVPPWKVPLIAADMRRRMHARASDVRLFAGIDATLRALAQRGTRVAIATSNSEAVVRAIAGPATCAHIRHFSCGISLFGKARRLRALAHASGFACADVLYVGDEVRDAQAADRAGIAFRGVAWGYTAPDALRAHCLMPLIERPEELLAL
>NZ_CP013413.1|WP_082256093.1|1622392_1623748_-|MFS-transporter
MSHAANQLIIYMNFSTRRRQVDESSIRERAVMTKIARRLMPLLVIMFLIAFIDRQNVGFAKLQMVHALGMTETSYGLGASLFFIGYLLFEVPSTLALHRFGARLWLARIMMTWGVITVLLGFTHSTSVFYVFRFLLGVAEAGFYPGVIYYLTLWFPQSHRTRVLGLFTLGSALANMLGSLAGGLLLSLDGRLGLAGWQWVFVATGLPAVAVAFVALRYLPESVERATFLADDEKRVVLAALKREASPEAVSESPWRALVDPRVLMFALAYMLMSTSLYGVTYWLPTLLKSSGVPASLNGLLNMIPWAIAALLLLWLPARLKRERLVLKAMAIVAGVGVAGFALSLALPGLPLRFAALVLGGACIPLLYPCFWSLPPRFSSGARAAASIAAINSIGNLGGFFAQNLMPYVGKAAGSTSAPMLVPVVCLAALGVGMLAAASVAGRRRAAGMAA
>NZ_CP013413.1|WP_009899924.1|1623855_1624581_+|GntR-family-transcriptional-regulator
MHATDDRLPRYQRLRDELAALIAARHWRPGEAIPTEQALAKRYDVAIGTVRKAVDLLVADGMLERFQGRGTFVRRASFDSSLFRFFRFQSKHGERRIPESRILRREVVEATSAVAAALQIPARAPVIEMTRVRLIDGAPMLAEEIWLPYDRFAAFSRLELDSIGDLLYPVYEAHCNQIVASATETLTVEAIGPVHARLLRIEPGTPAVVIERLAYGYDRRPLEWRRSRGPASEFIYQAEIR
>NZ_CP013413.1|WP_045602530.1|1624630_1625938_+|MFS-transporter
MFEWFATVSLRERRTFWACFGGWALDALDMQMFSLVIPAIVAEWSLSRTQAGFVGGATLVASAIGGWVAGMLSDRFGRVRTLQWTIACFAVGTFACAFATSYPQFVVLKALQGAGFGGEWAAGAVLMAETIRAEHRGKAMGAVQSAWALGWAAAVLLYALAFSLMPAALAWRAMFAIGLLPALLIVYVRRGIVEPSVSPSSPSNTPAAARASVPLVGIFSRDTRRMTLIGALLGVGAHGGYYALMTWLPTYLKVERHLSVLGTGGYLAVIIVAFFCGCIASAQLLDRIGRRGTILAFAACCIATVIAYLFLPLGNAAMLVLGFPFGFFAAGIPASMGALFNELYPRGTRGTGVGFCYNFGRVASAGFPVLVGHMSADMPLGTAIGIDAAIAYSIVVVAVLLLPETRARALDDLAGAHATADARADRIGAPDARHR
>NZ_CP013413.1|WP_045602529.1|1625989_1626880_+|amidohydrolase-family-protein
MSEQEWSTCAHAAEMRCAAGGITAIDAHAHVFETGLPLAGRRRYAPDYDAPLDAYLAQLDAHRVSHGVLVQPSFLGSDCRYLLRALAQQPRRLRGVAVIDAGCEPHVLDTLDRAGVVGIRLNLIGMPDPALDGPAWRATLERIAALRWHVELHAQAQRLGRLIAPLLAHRVNVVVDHFGRPNPACGIADAGFRDLLRTAATRRVWVKVSGVYRNWPLAPGEANARAQEAFDALAAEFGAERLVWGSDWPHTQFERTETFGRAFALARQWMRDDAMRRAIFVETPARLFRFGEIHGA
>NZ_CP013413.1|WP_045602528.1|1627099_1628578_+|serine/threonine-protein-phosphatase
MPRPILRRAAALLPTLASAALLQACTSSIDNQPDAASASANIQAAWVEIGDANQAIARVITSYAPPAAAPGEAAPAVCPQLNADGKIARMTLRAAAGTAAQRPTASDPADSKPSGFPVSVCEATVPANAKDVTVAGRALPLPKAEPQRVAIIADTGCRMKKADNAFQACSDATVWPFATIAASVAKLNPDLVLHVGDYHYRENACPPDIAGCKNSPWGYGWDAWRADLFEPAAPLLAKAPWVVVRGNHEECARAGQGWFRFLDPRPYSDARSCNDPANDGNANYSEPYAVPLGTGSQVIVFDTAKVGRAALKTTDVQFQIYQKQFQTVAALASKPGMSTTIFTNHHPILAFAPIPGSTPAPGNLALQSVMSSLYAQAYYPPGVQVALHGHVHDFQAINFASGHPATIVSGNGGDNLDVALPDPFPANLTPAPGVVIDKLSHNNSFGFLIMERRAAPARGWTFKAYTAAGKLLASCDQAGTTLTCDKTGFVAP
>NZ_CP013413.1|WP_102889811.1|1628910_1630260_+|cytochrome-c-methylamine-utilization-protein
MNPTSTPGASGPALAKAALDAARAKAAPPSSPTTVLLPGAPPERVVDTIGRGTPQVASKVDPTAAVFRPDPTLAALGKRVFFDPALSEPRGTSCASCHDPGRAFAPTLSPAALAGPRVPQGSRPGHFSRRNAPSLLYVRYVPRRHFYQDDDALAPAPFGGLFSDGRADTLAEQLRGPLFDPDEMNNASAAALMRKIGRTGLGAALAGRFGPSVRRDPERMVRALGEAMQAYLQSDEMAPFSSRYDAYVTKRAPLTPQEMRGLALFRNPDKGNCMSCHTLSDTASRPERSLFTDFGYDAIAVPRNRALPANRDPRHFDNGLCDTAAKLRWPEPTQWCAYLRTPGLRNVAIKESFMHNGVFDTLRDAVAFYNTRSTDPARWYHGRDTFDDVPRAYRGNVNVNSTPMNRRPGTPPAMTDADVDDLVAFLRTLTDARYVGLMPAAPDGKAARP
>NZ_CP013413.1|WP_045602525.1|1630422_1631283_+|class-I-SAM-dependent-methyltransferase
MSNQSIAAPDSTAVRVALWRALHVEIDAPPHVLDDGIGLELAAPDDDWRSRPDMAPQATRGYRASIVGRARFVEDLIGEQAERGVAQYVVLGAGLDTFAQRRAKLAAHLRVFEIDQPGTQAWKRQRLIALGYGVPEWLRLVPVDFEASGAWRAQLSAAGFDDSRPAVVSSTGVSMYLTRDAIAGTLRQIATLAPGSTLAMTFLLPLELIDDPVERAQHAAVYERARAAGTPFVSFFSPAEMLALAREAGFREVRHVSTDDLVRRYFEGRPDGLRPSSGEAFLVAST
>NZ_CP013413.1|WP_045602520.1|1631614_1631887_+|hypothetical-protein
MEHLVRIVNDTDRQILAWLRNQVGDERVERAAQHMGRVRKPYLSAICRYLGVWPPISLRYQTRRAEVDHAVGDRYLTLIRQHLATHATSR
>NZ_CP013413.1|WP_011401139.1|1632202_1632415_+|DUF3079-domain-containing-protein
MAKKFPLHPKHPERNCWGCDRYCSVDALSCGNGSDRTQHPVELLGDDWYEWEQENEAAQKQMQQTQAAAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013413_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013413_2

2737091-2737875

Orphan

Consensus_repeat	Method
GCAGCCGAAGCGCTCGCCGCGCAAGC	CRISPRCasFinder

13 spacers

The CRISPR arrays of NZ_CP013413_2

>merge|NZ_CP013413|2|2737091-2737875|CRISPRCasFinder
GAAGCCGCCGCGAAACACGCGCAAGCCGCTCAAATGTCCGTCGAGCAAGCAACGCTCGAAGCACTCGCCGCTCAAGCGGCCGCCGACAAGGAAGCCGCCGACGCGCTCGCCAAGCAGGCCGTCGCCGTCCAGGCGGCGGCCGAAGCAGTCGCCGCGCAGGCGGTCACCGACAAGACCGCGGCCGAAGCGCTCGCCGCGCAAGCGGCGGCGGAGCGCGCAGCGGCGGAGCAGGCTGCCGCGCACGCCGCGGCGGACAAGTCGGCCGCCGAAGCACTAGCCGCTCGAGCCGCAACCGATCGCGAGGCAGCGGAACGTGCATCGACCGAGCGCAGCGCGGCCGATGCCGCAGCGGCGCAAGCAGCCAGCGACAAATCGGCAGCCGAAGCGCTCGCCGCGCAAGCAGCGGCCGATCGCGCCGCCGCCGAGCAGGCCGCTGCCCAGGCCGCAACCGACAAGGCCGCAGCCGAAGCGCTCGCCGCGCAAGCGGCGAACGAACGGGCGGAGGCCGATACGCGCGCCGGCGCACAGGCGGCGGCCGACCGCGCCGCCGCCGAACAAGCTGCCGCGCAAGCGGCCGACGACAAGGCGAAAGCCGAAGCGCTTGCCGCTCAGGCCGCGGCCGACCGCGCGGCAGCGGAGCTGCTCGCCGCGCAAGCCAGTGCCGAGCGCGCGGCCGCCGAAGCGCGCGCGACCGAACAGGCGGCCGAGGAGCGCAGCGCGGCCGACGCCGCAGCGGCCCAGGCGGCCAAAGACAAGGCCGCGGCCGAAGCGCTCGCCGCGCAAGC

>NZ_CP013413|2|2|2737091-2737875|CRISPRCasFinder
GAAGCCGCCGCGAAACACGCGCAAGC	CGCTCAAATGTCCGTCGAGCAAGCA
ACGCTCGAAGCACTCGCCGCTCAAGC	GGCCGCCGACAAGGAA
GCCGCCGACGCGCTCGCCAAGCAGGC	CGTCGCCGTCCAGGCG
GCGGCCGAAGCAGTCGCCGCGCAGGC	GGTCACCGACAAGACC
GCGGCCGAAGCGCTCGCCGCGCAAGC	GGCGGCGGAGCGCGCAGCGGCGGAGCAGGCTGCCGCGCACGCCGCGGCGGACAAGTCG
GCCGCCGAAGCACTAGCCGCTCGAGC	CGCAACCGATCGCGAGGCAGCGGAACGTGCATCGACCGAGCGCAGC
GCGGCCGATGCCGCAGCGGCGCAAGC	AGCCAGCGACAAATCG
GCAGCCGAAGCGCTCGCCGCGCAAGC	AGCGGCCGATCGCGCCGCCGCCGAGCAGGCCGCTGCCCAGGCCGCAACCGACAAGGCC
GCAGCCGAAGCGCTCGCCGCGCAAGC	GGCGAACGAACGGGCGGAGGCCGATACGCGCGCCGGCGCACAGGCGGCGGCCGACCGCGCC
GCCGCCGAACAAGCTGCCGCGCAAGC	GGCCGACGACAAGGCG
AAAGCCGAAGCGCTTGCCGCTCAGGC	CGCGGCCGACCGCGCG
GCAGCGGAGCTGCTCGCCGCGCAAGC	CAGTGCCGAGCGCGCG
GCCGCCGAAGCGCGCGCGACCGAACA	GGCGGCCGAGGAGCGCAGCGCGGCCGACGCCGCAGCGGCCCAGGCGGCCAAAGACAAGGCC
GCGGCCGAAGCGCTCGCCGCGCAAGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013413.1\|WP_009894248.1\|2741142_2742303_+\|adenosyl-hopene-transferase-HpnH	unknown	unknown	gnl\|CDD\|274595
NZ_CP013413.1\|WP_019255816.1\|2730160_2731240_+\|porin	unknown	unknown	gnl\|CDD\|238208
NZ_CP013413.1\|WP_045601735.1\|2746598_2747957_+\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|235917
NZ_CP013413.1\|WP_019255813.1\|2734382_2735276_-\|EamA-family-transporter-RarD	unknown	unknown	gnl\|CDD\|225510
NZ_CP013413.1\|WP_045601737.1\|2745870_2746317_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013413.1\|WP_009894225.1\|2726628_2727906_-\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110
NZ_CP013413.1\|WP_009894247.1\|2740188_2741130_+\|4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase	unknown	unknown	gnl\|CDD\|234893
NZ_CP013413.1\|WP_127446965.1\|2729973_2730168_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013413.1\|WP_082256135.1\|2725283_2725580_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013413.1\|WP_009901500.1\|2742880_2743234_+\|DOPA-4,5-dioxygenase-family-protein	unknown	unknown	gnl\|CDD\|378079
NZ_CP013413.1\|WP_009901505.1\|2744554_2745478_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176149
NZ_CP013413.1\|WP_045601734.1\|2749100_2751179_-\|carbon-starvation-protein-A	unknown	unknown	gnl\|CDD\|184976
NZ_CP013413.1\|WP_080555041.1\|2748245_2748713_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|237361
NZ_CP013413.1\|WP_045601747.1\|2731283_2732747_+\|MmgE/PrpD-family-protein	unknown	unknown	gnl\|CDD\|377179
NZ_CP013413.1\|WP_009894263.1\|2748881_2749088_-\|YbdD/YjiX-family-protein	unknown	unknown	gnl\|CDD\|377308
NZ_CP013413.1\|WP_009901488.1\|2732814_2733930_-\|OpgC-domain-containing-protein	unknown	unknown	gnl\|CDD\|378405
NZ_CP013413.1\|WP_045601750.1\|2727979_2728729_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP013413.1\|WP_009894237.1\|2735272_2735569_-\|acylphosphatase	unknown	unknown	gnl\|CDD\|184674
NZ_CP013413.1\|WP_045601742.1\|2735729_2736737_+\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|163279
NZ_CP013413.1\|WP_025405913.1\|2738613_2739804_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|213815

Protein	Function_ID	Function_description	E-value
NZ_CP013413.1\|WP_019255816.1\|2730160_2731240_+\|porin	gnl\|CDD\|238208	cd00342, gram_neg_porins, Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane. Individual 16-strand anti-parallel beta-barrels form a central pore, and trimerizes thru mainly hydrophobic interactions at the interface. Trimers are stabilized by hytrophillic clamping of Loop L2. Loop 3 bends into the pore, creating an elliptical constriction of about 7 x 11A, large enough to allow passage of a glucose molecule without steric hindrance. Removal of the C-terminal residue (usuallly F) destabilizes the trimer and removal of the 16th beta-sheet abolishes trimerization. Unlike typical membrane proteins, porins lack long hydrophobic stretches. Short turns are found at the smooth, periplasmic end, longer irregular loops are found at the rough, extracellular end. C-terminal residue forms salt bridge with N-terminus.	3.2726e-65
NZ_CP013413.1\|WP_045601735.1\|2746598_2747957_+\|aspartate-aminotransferase-family-protein	gnl\|CDD\|235917	PRK07046, PRK07046, aminotransferase; Validated.	0
NZ_CP013413.1\|WP_019255813.1\|2734382_2735276_-\|EamA-family-transporter-RarD	gnl\|CDD\|225510	COG2962, RarD, Predicted permeases [General function prediction only].	1.62193e-70
NZ_CP013413.1\|WP_009894248.1\|2741142_2742303_+\|adenosyl-hopene-transferase-HpnH	gnl\|CDD\|274595	TIGR03470, HpnH, hopanoid biosynthesis associated radical SAM protein HpnH. The sequences represented by this model are members of the radical SAM superfamily of enzymes (pfam04055). These enzymes utilize an iron-sulfur redox cluster and S-adenosylmethionine to carry out diverse radical mediated reactions. The members of this clade are frequently found in the same locus as squalene-hopene cyclase (SHC, TIGR01507) and other genes associated with the biosynthesis of hopanoid natural products. The linkage between SHC and this radical SAM enzyme is strong; one is nearly always observed in the same genome where the other is found. A hopanoid biosynthesis locus was described in Zymomonas mobilis consisting of the genes HpnA-E and SHC (HpnF). Continuing past SHC are found a phosphorylase enzyme (ZMO0873, i.e. HpnG, TIGR03468) and this radical SAM enzyme (ZMO0874) which we name here HpnH. Granted, in Z. mobilis, HpnH is in a convergent orientation with respect to HpnA-G, but one gene beyond HpnH and running in the same convergent direction is IspH (ZM0875, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase), an essential enzyme of IPP biosynthesis and therefore essential for the biosynthesis of hopanoids. One of the well-described hopanoid intermediates is bacteriohopanetetrol. In the conversion from hopene several reactions must occur in the side chain for which a radical mechanism might be reasonable. These include the four (presumably anaerobic) hydroxylations and a methyl shift.	0
NZ_CP013413.1\|WP_009894247.1\|2740188_2741130_+\|4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase	gnl\|CDD\|234893	PRK01045, ispH, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase; Reviewed.	1.26694e-176
NZ_CP013413.1\|WP_009894225.1\|2726628_2727906_-\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	4.46896e-127
NZ_CP013413.1\|WP_009901500.1\|2742880_2743234_+\|DOPA-4,5-dioxygenase-family-protein	gnl\|CDD\|378079	pfam08883, DOPA_dioxygen, Dopa 4,5-dioxygenase family. This family of proteins are related to a DOPA 4,5-dioxygenase that is involved in synthesis of betalain. DOPA-dioxygenase is the key enzyme involved in betalain biosynthesis. It converts 3,4-dihydroxyphenylalanine to betalamic acid, a yellow chromophore.	3.79813e-47
NZ_CP013413.1\|WP_009901505.1\|2744554_2745478_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176149	cd08460, PBP2_DntR_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	9.04348e-93
NZ_CP013413.1\|WP_045601734.1\|2749100_2751179_-\|carbon-starvation-protein-A	gnl\|CDD\|184976	PRK15015, PRK15015, carbon starvation protein CstA.	0
NZ_CP013413.1\|WP_080555041.1\|2748245_2748713_+\|transcriptional-regulator	gnl\|CDD\|237361	PRK13355, PRK13355, bifunctional HTH-domain containing protein/aminotransferase; Provisional.	5.11049e-06
NZ_CP013413.1\|WP_045601747.1\|2731283_2732747_+\|MmgE/PrpD-family-protein	gnl\|CDD\|377179	pfam03972, MmgE_PrpD, MmgE/PrpD family. This family includes 2-methylcitrate dehydratase EC:4.2.1.79 (PrpD) that is required for propionate catabolism. It catalyzes the third step of the 2-methylcitric acid cycle.	1.02242e-135
NZ_CP013413.1\|WP_009894263.1\|2748881_2749088_-\|YbdD/YjiX-family-protein	gnl\|CDD\|377308	pfam04328, Sel_put, Selenoprotein, putative. This entry includes a group of putative selenoproteins from Proteobacteria, Actinobacteria and Firmicutes. The invariant cysteine at the C-terminus is encoded by a TGA Sec codon in some Epsilonproteobacteria, suggesting a redox activity for the protein.	1.11346e-29
NZ_CP013413.1\|WP_009901488.1\|2732814_2733930_-\|OpgC-domain-containing-protein	gnl\|CDD\|378405	pfam10129, OpgC_C, OpgC protein. This domain, found in various hypothetical and OpgC prokaryotic proteins. It is likely to act as an acyltransferase enzyme.	4.20944e-103
NZ_CP013413.1\|WP_045601750.1\|2727979_2728729_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	2.89217e-51
NZ_CP013413.1\|WP_009894237.1\|2735272_2735569_-\|acylphosphatase	gnl\|CDD\|184674	PRK14424, PRK14424, acylphosphatase; Provisional.	3.12995e-58
NZ_CP013413.1\|WP_045601742.1\|2735729_2736737_+\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|163279	TIGR03466, HpnA, hopanoid-associated sugar epimerase. The sequences in this family are members of the pfam01370 superfamily of NAD-dependent epimerases and dehydratases typically acting on nucleotide-sugar substrates. The genes of the family modeled here are generally in the same locus with genes involved in the biosynthesis and elaboration of hopene, the cyclization product of the polyisoprenoid squalene. This gene and its association with hopene biosynthesis in Zymomonas mobilis has been noted in the literature where the gene symbol hpnA was assigned. Hopanoids are known to be components of the plasma membrane and to have polar sugar head groups in Z. mobilis and other species.	0
NZ_CP013413.1\|WP_025405913.1\|2738613_2739804_-\|glycosyltransferase	gnl\|CDD\|213815	TIGR03469, HpnB, hopene-associated glycosyltransferase HpnB. This family of genes include a glycosyl transferase, group 2 domain (pfam00535) which are responsible, generally for the transfer of nucleotide-diphosphate sugars to substrates such as polysaccharides and lipids. The genes of this family are often found in the same genetic locus with squalene-hopene cyclase genes, and are never associated with genes for the metabolism of phytoene. Indeed, the members of this family appear to never be found in a genome lacking squalene-hopene cyclase (SHC), although not all genomes encoding SHC have this glycosyl transferase. In the organism Zymomonas mobilis the linkage of this gene to hopanoid biosynthesis has been noted and the gene named HpnB. Hopanoids are known to feature polar glycosyl head groups in many organisms.	0

>NZ_CP013413.1|WP_045601742.1|2735729_2736737_+|NAD-dependent-epimerase/dehydratase-family-protein
MTDIQRDLVLVTGASGFVGSAVARAARQQGHRVRVLVRPTSPRTNVADLDAEIATGDMRDEASMRAALRGVRYLLHVAADYRLWAPDPLEIERANLEGAVATMRAALAEGVERIVYTSSVATLKVTPSGASADESSPLTAEQAIGVYKRSKVLAERAVERMIADDRLPAVIVNPSTPIGPRDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVALGHLLALEHGRIGERYILGGENLPLQSMLADIAQLTGRKPPTIALPRWPLYPIALGAEAVAKLTKREPFVTVDGLKMSKNKMYFTSAKAERELGYRARPYREGIRDALDWFRQARYLR
>NZ_CP013413.1|WP_009894237.1|2735272_2735569_-|acylphosphatase
MSGDDLDERIETYYVRVRGVVQGVGFRHATVREAHALKLRGWVANLDDGSVEAMLQGPAPQIDRMLAWLRHGPSTAHVTEVTFEERPTDKRFERFQQH
>NZ_CP013413.1|WP_019255813.1|2734382_2735276_-|EamA-family-transporter-RarD
MSAAADYPRAGRGIALSVAASALFALLSAYAKLLAPLTGLDIFAWRIVWTAPGAIAIVVLRGRWPALRELLSRAFASARFALSLAASAGLLGLQLWLFLWAPLHGRMLEVSLGYFLLPLTMVLVGRFHYHERLSGLQWLALACAATGVAHELWATRAFAWPTLVVALGYPPYFVLRRRVNADSLALFAVEMLALLPVAAATLAAGGTSVADRPLLWALLLPGLGAISTLALASYLKASRMLPMALFGILGYVEPVLLVAVAVLVLDEALSWQQLATYAPIWAAVALTAWHGFLMARR
>NZ_CP013413.1|WP_009901488.1|2732814_2733930_-|OpgC-domain-containing-protein
MSGSAMSSPAPAARSIEVDFFRGLVLLTIVVDHIGASVLSRVTLHAFALCDAAEVFVFLGGFATASAFLAVSARHGPGAARRRFVRRAAQIYRAFLATSTLMLVVSAVLDHYGIDAPNMALDDISVLLASPLTGLVELLTFKRQPYLASVLPMYVLFALATPAIVPLARAKPWWLLFGSVLMWGCAPWLAAELLDTDSFRWSFNPFAWQLMFVLGALMRCWPLHRDVATRPGGAAITAIAFAIVLACAYYKLCAGLPLPEGELKRHLAWPRVMNFVAFAWLMAELVRHGWIARVARAAQPVVAVGQRGMPCFVAGAAISLTLDSVLHGVRGNARLPQLGMGLAADACALALMLTVAHSGPLFRRKRRSVAA
>NZ_CP013413.1|WP_045601747.1|2731283_2732747_+|MmgE/PrpD-family-protein
MNRRHFLAAAGGLPLAATLAPLDACARPNAAPTPPMLARQLAEYAAGLRYEDLDAATIDTVKSHLIDALGCTLAALDEPPVRIARDAARRIGGGPSTVIGTAERTSPDLATFATGTALRYFDFNDAYAGREIGHPSDNIAACVAVAEAQHASGRDLILSIALAYEIACRLMDAAAISPRGWDHTCYSLPAAALAAGKLMRMPVASLTQAVNLSLNSHLALNQTRVQELSNWKALADADAARNAVFSTLLARAGLTGPSPIFEGEAGFFRQVSGPFELDTHRFGGRGEPFGIARCFVKYYPAQGFTQTAIPAALDVASQAGDPSRIRRIDVHTTHVGYVTAGSEPEKWNPSTRETADHSLPYVVARAMLDGDIRTTSFSDAALHDPALRALIAKIRVEEDLALTAGYPARAANRVTAYCRDGAVYAKQVDDLPGSPTRPMRREDFEAKFVKNGGARLSARRMRAALDQIWRLDALSDVATLPPLFVAG
>NZ_CP013413.1|WP_019255816.1|2730160_2731240_+|porin
MDKRLSALCGLGLVSAGACAQTSVTLYGVADAYIEYATNQTSANGEPAALARMGSGGKSGSRWGIKGTEALGDGWRATFRLESGTNLNNGAGTGAGGFDRSAWIALEHPRWGALRFGRQYTTLFDIMEHYSPTGAYSTLYEPDGAIVGINFRENNVVKYLATAGPLTFEAHYAFSNAPGAFQASAAHGAGIEYTGGALSFAFAYDDVHTPQAGSFAHFRRYAAAAMLTVEATQLIAGVAHGQGGVATPSVVTRYTFWWIGVREAITPVVQLVGALYAQRVLAQNPASAPTARHASGTPQQATLQLNYFVSKTTTLYAAAGYARHAALDFDDYNYGFLHYSLAGGRCGSAGVAVGVRKLF
>NZ_CP013413.1|WP_127446965.1|2729973_2730168_-|hypothetical-protein
MSIVVSTYVPLFLRNRSSSCLLSLLLLLLLLSLLLLPLFRFAAHVVFALAAFGVAAAIDRVPHV
>NZ_CP013413.1|WP_045601750.1|2727979_2728729_-|IclR-family-transcriptional-regulator
MTNQTDGGVAAVNRALAALVAFGEAPGGLTLAQVSEASGVNMSTLLRMFESLERFRFIKRLNDGRYVLGPAVFQLGMMYRESFRLREHVVPVLDALGAETGETTAFYVREGDQRVCLFRVHPQRAVRTYLREGDRYPLDVGAAGRVLLAFSGARGGGFDKTAAQGYAVSRGERDPDSAAIACPVFGVGRALIGALSLGVPRFRFNKKVQADYLPRVQAAADALTHVLGGDLPPAAGVAQVVDLFGAAHE
>NZ_CP013413.1|WP_009894225.1|2726628_2727906_-|CoA-transferase
MDVRQTQVEERASPRRRANTGPIHAKRFDADARGPLAGVRVVDLSRLMAGNMLSLQLADFGADVVKVENERGDTLRAVGAGGVSTNWKVYGRNKRSVCVDLRSADGIDIVKRLVRDADVFVESFKPGVLEQMGLGPDVLLALRPSLVIARISGWGQTGPYRHKPGFGTLAEGYAGFASINGFADREPVLPPMFLGDMTAGLSGAIAVLVALHACRDGATGQVIDVSLFEPLFSILGPAAANYVLTGRVKERTGSRSSNTAPRNAYRTRDDKWLCLSSSTQGMAERLFRAIGRADLIDDPRYATNVQRVQHAGELDAIVGAFVAERDLADNLAFFEKSGVTVGPILDIAQIVQDRYVIEREALVELPDDDVGSLPMHGVVPRLSGTPGGFRRAAPRLGEHNREILLPLLGAHEYARLARNGVIRPE
>NZ_CP013413.1|WP_082256135.1|2725283_2725580_+|hypothetical-protein
MIAPFLFRNWPPNHRPSEFSEYKSKLNLVIRRKGIAQLFKYLTAIRIRARFPPRIGMDRYFCKHSVFGRGGARKKTRGGRSRRARPLGLSRIRRSRPD
>NZ_CP013413.1|WP_025405913.1|2738613_2739804_-|glycosyltransferase
MTLIVVFLLSCLSLVIWLVLLFGRGGFWRARPARRLPPDARGAAAAAGWPAVAAVVPARNEADVIGEAVQSLVGQAYEGAFHLIVVDDHSTDGTADAARAAAAAVGRADRLTVLAAQPLPAGWSGKVWAQSQGIAAVRSLGLPADYLLLTDADIGHPPDAVAQLVTRAQAEQRDLVSLMVRLRCDSFWEKALIPAFVFFFAKLYPFSWVNDPRNRTAGAAGGCMLVRRDALEEAGGIESIRGALIDDCSLAAQIKHRGAGRHPIRLDLADRSVSLRPYDSWRDIWNMIARTAFTQLRYSPALLLGTLVGMTIIYLVPPVAALAYGARAWPAWLAWASMCTAYAPMLSYYRRSPWWAPALPLVALFYVGATVASAVRYWRGKGGQWKARVQAPVQDR
>NZ_CP013413.1|WP_009894247.1|2740188_2741130_+|4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase
MRVILAQPRGFCAGVVRAIEIVERALQQNGAPVYVRHEIVHNRHVVENLRNKGARFVEELDEVPHGAVAIFSAHGVAQTVEKDADARGLDVLDATCPLVTKVHVQGRQYVAAGRRLILIGHAGHPEVEGTIGQIPAEVILVQSEAEVDTLTLPADTPVAYVTQTTLSVDDTRGIIEALQRRFTDIVGPDTRDICYATQNRQAAVRELSEQVDVLLVVGATNSSNSNRLREIGTESGVPSYLVADGSEIRAEWFASARTVGLTAGASAPEEMVEDVIAALRALGPVEVATMSGREEKVEFKLPAKLTQAVAREV
>NZ_CP013413.1|WP_009894248.1|2741142_2742303_+|adenosyl-hopene-transferase-HpnH
MSIPLLQQVRVGAYIVRQHLSGNKRYPLALMLEPLFRCNLACNGCGKIDYPDPILNQRLSVEECLQAVDECGAPVVSIAGGEPLLHKEMPEIVRGIMKRKKFVYLCTNALLMEKKMDDYEPSPYFVWSVHLDGDKDMHDHSVSQDGVYDKAVAAIKEAKRRGFRVNINCTLFNDAIPERVAKFFDTLGPIGVDGITVSPGYAYERAPDQQHFLNRDKTKNLFREIFKRGEGGKRWSFSQSSLFLDFLAGNQTYKCTPWGNPARTVFGWQKPCYLVGEGYVKTFKELMESTDWDNYGVGNYEKCADCMVHCGFEATAVMDTIAHPLKALKVSMSGIRTDGAFAPDIPIDNQRPAEYVFSRHVEIKLEEIQRAGKGKLQKSPKPAATA
>NZ_CP013413.1|WP_009901500.1|2742880_2743234_+|DOPA-4,5-dioxygenase-family-protein
MTSSDVAAITGWHAHIYFDASSRDAAWAFRETVERRFGASVQLGRFHERLVGPHPAWSYQIAFEPAQFAEVVPWLILHHGALDVFLHPNTGDELRDHRDAAVWIGRSHALDLAALKP
>NZ_CP013413.1|WP_009901505.1|2744554_2745478_+|LysR-family-transcriptional-regulator
MAPDLNLLIALDALLEEGSVVGAARRMNLSPPAMSRTLARIRETVGDPIFVQAGRKMVPTPRALALRGAVRETVERASQLLAPSAEVDLRTLDKQFNVRANDIFVGTHGGRLLEEMERGMPRAMLRFTPEENDVDDDALRSGRIDLFISASRRLGPEIRVQPLFTTAFVGLARSDHPIFDDHITPERFARWPHIGVSRRGKSSGPIDAALGERGLKRRVALVVPTPYAAVFALQASDLILPLPEHLALGAMQAGLGVRTFELPVPLETVLITQAWHPRFQSDPAHQWLRRVVRGLCTGMAALQPAHA
>NZ_CP013413.1|WP_045601737.1|2745870_2746317_+|hypothetical-protein
MALDPQDFIVHDISRFPMCVFRERAATHGYAPQWEQEIDALMRRGAPFVVVYVSLDADEHHDDRRHRAMWLKRNKAALAAVCKALISVEPDAERRAAAVEQGRTAVSAFGIPHAAVASLGEAAALAARLAGADDQNGASGGGAAAPRT
>NZ_CP013413.1|WP_045601735.1|2746598_2747957_+|aspartate-aminotransferase-family-protein
MEIRHGVNLARARALAARERDAFARAMPKSRALSAEAAQHLLFGVPLHWMRDWSTPFSLYVDHARGAHFTDVDGHRYADFCLGDTGAMFGHAPEPVARALADQAARGYTTMLPSADAAWVGAELARRFRLPYWQFALSASDANRFVLRWARAATGRKHIVVFNGCYHGTVDDVFVDLVDGRPVQRDSLLGQAHDLLAYTRVVEFNDLGALEAALKDGDVACVLAEPALTNIGMVLPDPGFWREARALIRRYGTLLAIDETHTISSGPGGYAVAHGLEPDLLVVGKPIGGGVPCAVYGFSAPFAERAQRAKASAPPGHSGIGTTLTANMLAMRAIRATLADVMTDAAYAHMFDLAARLAAGLEQAIARRGLPWCVTRIGARTEFQFAPTPPRNGTIAGMQLDGELEHIVHLYLLNRGVLITPFHNMMLVCPETTAEDVDRLTAAFEACIGEMA
>NZ_CP013413.1|WP_080555041.1|2748245_2748713_+|transcriptional-regulator
MVVRAVDVQPHNAAMPTLEEKAAFAERLKFALQRSPEKISGATALALRFNLRHRGEHPISPQTAHKWLTGRTIPTPDKLRTLADWLRVDLHWLHYGPPPGAPGGKTPAPPRHDEKYAPTQETIELASKIEALSPHHRYLMQELIEHFYGDPSKRR
>NZ_CP013413.1|WP_009894263.1|2748881_2749088_-|YbdD/YjiX-family-protein
MFSDLGGELRTAGRYLGQALRLMVGLPDYDGYVAHMRATHPDRPVMTYEAFFRERQNARYGSGAGKCC
>NZ_CP013413.1|WP_045601734.1|2749100_2751179_-|carbon-starvation-protein-A
MNRASGYLIWIAVALLGAFAFGTIALAHGERVSALWIVIAAVCVYLIAYRFYSRFIASKVVQLDGLRMTPAVKYNDGLDYVPTNKYVLFGHHFAAIAGAGPLVGPVLAAQMGYTPGMLWILAGVVFAGAVQDFIVLFISTRRDGRSLGDLVKMELGTVPGVIALFGAFLIMVIILAVLALIVVKALTNSPWGTFTVAATIPIALFMGIYTRYIRPGRIGEVSIIGFVLLMASIAYGQHVHDSPALAAWFTFSGTQLTWILIGYGFVASVLPVWLLLAPRDYLSTFLKIGTIVGLAIGILIVAPELKMPALTKFVDGTGPVWSGNLFPFLFITIACGAVSGFHSLISSGTTPKLLDNETNARFIGYGAMLMESFVAIMALVAACVIEPGVYFAMNAPAAVLGTTPEAVAHTVTQWGFMLTPDMLTQTAKAVGETTIIARAGGAPTLAVGMAQILHQVIGGEAMMAFWYHFAILFEALFILTAVDAGTRAGRFMLQDLLGTFHPAFKRTESLPANLTATALCVAAWGYFLYQGVVDPLGGINTLWPLFGISNQMLAAIALVLGTVVLFKMKRERYAWVTIVPTAWLLICTLTAGWQKVFDSNPKVSFLAHAAKLQAAAADGKVLAPAKSIAQMQRIIFNDYVDAALSALFILVVVSIAVYGVIAVARARRAAQPTSRETPYEQMPAAQALGSGR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP013413_2	2.11\|2737705\|16\|NZ_CP013413\|CRISPRCasFinder	2737705-2737720	16	NZ_CP013413.1	1000329-1000344	0	1.0
NZ_CP013413_2	2.11\|2737705\|16\|NZ_CP013413\|CRISPRCasFinder	2737705-2737720	16	NZ_CP013411.1	909595-909610	0	1.0

1. spacer 2.11|2737705|16|NZ_CP013413|CRISPRCasFinder matches to position: 1000329-1000344, mismatch: 0, identity: 1.0

cgcggccgaccgcgcg	CRISPR spacer
cgcggccgaccgcgcg	Protospacer
****************

2. spacer 2.11|2737705|16|NZ_CP013413|CRISPRCasFinder matches to position: 909595-909610, mismatch: 0, identity: 1.0

cgcggccgaccgcgcg	CRISPR spacer
cgcggccgaccgcgcg	Protospacer
****************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

99631 : 176470

Ralstonia_phage(50.0%)

holin,transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045601576.1\|99631_101827_+\|holin	phospholipase C, phosphocholine-specific	NA	NA	NA	NA
WP_102889796.1\|102932_103743_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_045601570.1\|103768_104785_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_009894657.1\|104803_105256_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_045601568.1\|105719_106637_+	ABC transporter permease	NA	NA	NA	NA
WP_045601567.1\|106623_107478_+	ABC transporter permease	NA	NA	NA	NA
WP_045601565.1\|107474_108506_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_045601564.1\|109148_109454_+	H-NS histone family protein	NA	NA	NA	NA
WP_082256144.1\|109783_112555_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	6.1e-90	34.3
WP_060970114.1\|112568_114809_+	DUF3274 domain-containing protein	A0A077K801	Ralstonia_phage	1.8e-23	28.7
WP_082256145.1\|114947_116486_+	DUF2875 domain-containing protein	NA	NA	NA	NA
WP_009894667.1\|116495_116759_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_082256020.1\|117594_119085_+	DUF3274 domain-containing protein	A0A077K801	Ralstonia_phage	1.0e-06	28.4
WP_102889795.1\|119223_120762_+	DUF2875 domain-containing protein	NA	NA	NA	NA
WP_045601559.1\|120771_121035_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_004523721.1\|121449_121869_-	YjbQ family protein	NA	NA	NA	NA
WP_004523720.1\|121888_122215_-	thioredoxin family protein	NA	NA	NA	NA
WP_019255408.1\|122687_123380_+	hypothetical protein	NA	NA	NA	NA
WP_082256021.1\|124202_124559_-	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_045601557.1\|125035_126178_-	porin	NA	NA	NA	NA
WP_082256023.1\|126849_127773_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_045601554.1\|128390_128693_-	hypothetical protein	NA	NA	NA	NA
WP_009898271.1\|129087_129318_-	hypothetical protein	NA	NA	NA	NA
WP_155275044.1\|129339_129573_+	hypothetical protein	NA	NA	NA	NA
WP_069255329.1\|129686_130886_-	transcriptional regulator CynR	NA	NA	NA	NA
WP_045601552.1\|130885_132310_-	TolC family protein	NA	NA	NA	NA
WP_009898285.1\|132303_133203_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_009894707.1\|133204_133429_-	DUF1656 domain-containing protein	NA	NA	NA	NA
WP_038708432.1\|133425_135492_-	FUSC family protein	NA	NA	NA	NA
WP_045601551.1\|136504_138046_-	membrane protein	NA	NA	NA	NA
WP_155275045.1\|138393_138750_-	hypothetical protein	NA	NA	NA	NA
WP_045601550.1\|139594_141742_+	hypothetical protein	K4F7R4	Cronobacter_phage	7.8e-08	46.1
WP_082256025.1\|141817_143305_-	PhoPQ-regulated protein	NA	NA	NA	NA
WP_080558013.1\|143340_143547_+	hypothetical protein	NA	NA	NA	NA
WP_082256026.1\|143519_144113_-	hypothetical protein	NA	NA	NA	NA
WP_009898306.1\|144698_145253_+	type 1 fimbrial protein	NA	NA	NA	NA
WP_082256027.1\|145319_146060_+	fimbria/pilus periplasmic chaperone	NA	NA	NA	NA
WP_082256147.1\|146282_148916_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_082256028.1\|148908_149481_+	type 1 fimbrial protein	NA	NA	NA	NA
WP_080511336.1\|149544_150201_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_045601545.1\|150203_151880_+	OmpA family protein	NA	NA	NA	NA
WP_045601543.1\|152223_152763_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_009894729.1\|152796_154296_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_009894730.1\|154496_154979_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_019255186.1\|155106_155649_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_045603054.1\|155654_157004_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_045601541.1\|157000_158302_+	type VI secretion system protein TssL	NA	NA	NA	NA
WP_045601540.1\|158316_162225_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_045601539.1\|162415_162985_+	hypothetical protein	NA	NA	NA	NA
WP_082256029.1\|163052_165758_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.9e-35	26.0
WP_004523693.1\|165832_166102_+	PAAR motif protein	NA	NA	NA	NA
WP_045601537.1\|166114_169567_+	RHS repeat protein	NA	NA	NA	NA
WP_045601536.1\|169459_170818_-	hypothetical protein	A0A292GJ55	Xanthomonas_phage	3.4e-110	49.5
WP_045601534.1\|170850_171879_-	fimbrial protein	NA	NA	NA	NA
WP_009898344.1\|171934_173005_-	type VI secretion protein ImpA	NA	NA	NA	NA
WP_009898345.1\|173023_174073_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_009894755.1\|174069_175950_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_009894757.1\|175951_176470_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA

DBSCAN-SWA_2

715268 : 765005

Burkholderia_phage(40.0%)

plate,integrase,tRNA,tail,transposase

attL 734683:734702|attR 766592:766611

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045600741.1\|715268_716597_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_009899213.1\|716699_717806_-	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_045601257.1\|718075_718369_+	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_045601256.1\|718365_719250_+	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_009899218.1\|719334_721239_+	1-deoxy-D-xylulose-5-phosphate synthase	NA	NA	NA	NA
WP_009895738.1\|721389_722199_+	GTP cyclohydrolase I FolE2	NA	NA	NA	NA
WP_025405402.1\|722613_723654_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.7e-93	54.0
WP_045601255.1\|723784_725008_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_009895742.1\|725087_725300_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_045601253.1\|725466_725913_+	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	5.1e-23	49.3
WP_045601252.1\|726009_727887_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	2.5e-66	35.8
WP_009895748.1\|727933_728272_-	hypothetical protein	NA	NA	NA	NA
WP_009899229.1\|728330_730373_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	4.2e-35	32.0
WP_045601251.1\|730741_730927_-	hypothetical protein	NA	NA	NA	NA
WP_019256110.1\|731020_731311_-	hypothetical protein	NA	NA	NA	NA
WP_127446954.1\|731291_731690_+	hypothetical protein	NA	NA	NA	NA
WP_045601250.1\|731781_732282_-	hypothetical protein	A0A2H4N7D9	Pectobacterium_phage	1.8e-32	55.0
WP_009899233.1\|732615_732972_-	DNA-binding protein	Q6QIE8	Burkholderia_phage	1.1e-44	76.8
WP_009899234.1\|733062_733677_-	DUF3164 family protein	A4JWM8	Burkholderia_virus	2.2e-93	83.4
WP_009899237.1\|733773_734106_-	hypothetical protein	Q6QIE2	Burkholderia_phage	2.5e-22	58.2
WP_082256055.1\|734137_735391_-	AAA family ATPase	Q6QIE1	Burkholderia_phage	7.2e-155	69.1
734683:734702	attL	NA	NA	NA	NA
WP_009899242.1\|735387_737184_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	Q6QIE0	Burkholderia_phage	4.3e-278	80.2
WP_045601248.1\|737198_738164_-	DUF3102 domain-containing protein	A4JWN3	Burkholderia_virus	3.2e-102	70.3
WP_009899245.1\|738177_738489_-	helix-turn-helix domain-containing protein	A4JWN4	Burkholderia_virus	1.7e-33	80.0
WP_155722056.1\|738485_738929_-	hypothetical protein	NA	NA	NA	NA
WP_009906820.1\|739003_739246_-	DNA-binding protein	Q6QID3	Burkholderia_phage	7.3e-32	90.0
WP_052712508.1\|739376_739796_+	helix-turn-helix transcriptional regulator	A4JWR8	Burkholderia_virus	6.7e-25	51.4
WP_052712494.1\|739861_740737_+	hypothetical protein	A4JWN9	Burkholderia_virus	7.0e-24	28.9
WP_045601243.1\|741212_741560_+	membrane protein	Q6QIC8	Burkholderia_phage	9.2e-44	79.1
WP_025405408.1\|741562_742171_+	transglycosylase SLT domain-containing protein	Q6QIC7	Burkholderia_phage	3.9e-90	79.8
WP_155275021.1\|742335_742770_+	hypothetical protein	A4JWP5	Burkholderia_virus	4.4e-43	69.3
WP_009906940.1\|742766_743105_+	hypothetical protein	A4JWP6	Burkholderia_virus	4.0e-44	82.7
WP_045601240.1\|743101_743434_+	hypothetical protein	Q6QIC3	Burkholderia_phage	5.0e-47	78.7
WP_045601238.1\|743766_744081_-	hypothetical protein	NA	NA	NA	NA
WP_009906942.1\|744251_744716_+	hypothetical protein	Q6QIB2	Burkholderia_phage	3.9e-42	60.1
WP_009906943.1\|744712_744958_+	hypothetical protein	Q6QIB1	Burkholderia_phage	1.7e-20	62.5
WP_045601234.1\|744961_746395_+\|tail	tail protein	A4JWK5	Burkholderia_virus	6.1e-243	87.2
WP_025405412.1\|746396_746921_+\|tail	phage major tail tube protein	A4JWK6	Burkholderia_virus	1.0e-86	90.8
WP_045599843.1\|747209_748430_-\|transposase	ISL3 family transposase	A9YX10	Burkholderia_phage	2.2e-225	92.4
WP_009906946.1\|748587_748917_+\|tail	phage tail assembly protein	Q6QIA8	Burkholderia_phage	1.8e-25	65.7
WP_009906947.1\|748888_749047_+	hypothetical protein	Q6QIA7	Burkholderia_phage	2.5e-17	80.8
WP_082256159.1\|749662_751756_+\|tail	phage tail tape measure protein	A4JWL0	Burkholderia_virus	2.4e-155	49.8
WP_009906887.1\|751757_752660_+\|tail	phage tail protein	Q6QIA4	Burkholderia_phage	3.5e-71	72.1
WP_009906886.1\|752659_752866_+	membrane protein	A4JWL2	Burkholderia_virus	1.5e-25	78.3
WP_045601230.1\|752853_754059_+	bacteriophage regulatory protein	A4JWL3	Burkholderia_virus	5.0e-137	70.6
WP_045601229.1\|754055_754658_+\|plate	phage baseplate assembly protein V	A4JWL4	Burkholderia_virus	5.6e-65	69.0
WP_144411832.1\|754671_754974_-	hypothetical protein	NA	NA	NA	NA
WP_045601225.1\|756220_756661_+\|tail	phage tail protein	A0A291LAV4	Bordetella_phage	3.4e-19	41.7
WP_009907015.1\|757106_757460_+\|plate	baseplate protein	Q6QIA0	Burkholderia_phage	4.2e-52	82.9
WP_009907014.1\|757456_758608_+\|plate	baseplate protein	A4JWL6	Burkholderia_virus	2.3e-168	79.9
WP_009907013.1\|758600_759182_+\|tail	phage tail protein I	A4JWL7	Burkholderia_virus	1.5e-91	86.5
WP_045601223.1\|759181_761149_+\|tail	tail fiber protein	Q45YG3	Burkholderia_virus	8.7e-131	58.8
WP_045601222.1\|761164_761866_+\|tail	tail fiber assembly protein	E5E3Q6	Burkholderia_phage	7.5e-61	60.8
WP_045601221.1\|762148_763366_-	acyltransferase	A0A2H4IZR3	uncultured_Caudovirales_phage	7.2e-27	26.5
WP_102889782.1\|763771_765005_+\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	3.4e-101	65.2
766592:766611	attR	NA	NA	NA	NA

DBSCAN-SWA_3

2207602 : 2272776

Aeromonas_phage(25.0%)

holin,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009907965.1\|2207602_2208553_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_009900964.1\|2208820_2209765_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_009900966.1\|2210238_2211942_+	peptidase	NA	NA	NA	NA
WP_019254803.1\|2212060_2213287_+	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_009907969.1\|2213345_2214488_-	porin	NA	NA	NA	NA
WP_045602137.1\|2214715_2215714_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_045602134.1\|2215749_2217303_-\|holin	choline-sulfatase	NA	NA	NA	NA
WP_082256115.1\|2217438_2218338_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_009900972.1\|2218481_2219357_+	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_045602130.1\|2219443_2221099_-	APC family permease	NA	NA	NA	NA
WP_045602127.1\|2221278_2222142_-	glycine betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_045602125.1\|2222251_2223391_-	hybrid-cluster NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_009898044.1\|2223411_2224653_-	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_045602123.1\|2224704_2225490_-	drug:proton antiporter	NA	NA	NA	NA
WP_045602121.1\|2225486_2226668_-	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_045602120.1\|2226672_2228598_-	(Fe-S)-binding protein	NA	NA	NA	NA
WP_019254809.1\|2228600_2230664_-	NADH:flavin oxidoreductase	NA	NA	NA	NA
WP_009898053.1\|2230724_2231258_-	4-vinyl reductase	NA	NA	NA	NA
WP_009907974.1\|2231405_2232377_-	membrane dipeptidase	NA	NA	NA	NA
WP_009898057.1\|2232448_2233723_-	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	6.9e-105	53.4
WP_080511307.1\|2233734_2233974_-	hypothetical protein	NA	NA	NA	NA
WP_009898058.1\|2234959_2235985_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_045602117.1\|2236176_2237376_-	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	8.4e-12	26.6
WP_009900983.1\|2237721_2238738_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_082256116.1\|2238924_2240496_+	glycoside hydrolase 68 family protein	NA	NA	NA	NA
WP_045602116.1\|2240614_2242288_+	glycoside hydrolase family 32 protein	F8WPR5	Bacillus_phage	1.1e-54	30.6
WP_045603160.1\|2242739_2244008_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_025405551.1\|2244346_2245909_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_045602113.1\|2245961_2246927_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_045602111.1\|2247059_2248631_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_045602110.1\|2248627_2249896_-	glycosyltransferase	NA	NA	NA	NA
WP_009896560.1\|2250172_2251072_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_102815683.1\|2251351_2251468_+	hypothetical protein	NA	NA	NA	NA
WP_011401418.1\|2251644_2252016_-	hypothetical protein	NA	NA	NA	NA
WP_045602109.1\|2252236_2252668_-	hypothetical protein	NA	NA	NA	NA
WP_009893756.1\|2252690_2253050_-	hypothetical protein	NA	NA	NA	NA
WP_045598703.1\|2253108_2256603_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_082256007.1\|2256599_2258384_-	OmpA family protein	NA	NA	NA	NA
WP_045598705.1\|2258409_2259771_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_009900994.1\|2259767_2260361_-	hypothetical protein	NA	NA	NA	NA
WP_009893761.1\|2260366_2260756_-	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_045598706.1\|2260795_2261512_-	DUF3540 domain-containing protein	NA	NA	NA	NA
WP_045598707.1\|2267081_2269925_-	type VI secretion system ATPase TssH	A0A2I7REQ1	Vibrio_phage	1.2e-61	27.0
WP_009893772.1\|2269927_2270917_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_045598709.1\|2270913_2272776_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

DBSCAN-SWA_4

2283011 : 2343364

Burkholderia_phage(93.48%)

holin,plate,integrase,tail,terminase,transposase

attL 2282291:2282309|attR 2352287:2352305

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2282291:2282309	attL	NA	NA	NA	NA
WP_009901024.1\|2283011_2283779_+\|holin	phosphocholine cytidylyltransferase family protein	NA	NA	NA	NA
WP_019256483.1\|2283775_2285464_+	phosphoenolpyruvate mutase	NA	NA	NA	NA
WP_045602091.1\|2285460_2286642_+	phosphonopyruvate decarboxylase	NA	NA	NA	NA
WP_009901031.1\|2286656_2287724_+	2-aminoethylphosphonate aminotransferase	NA	NA	NA	NA
WP_045603157.1\|2287864_2288455_-	glutamine amidotransferase	NA	NA	NA	NA
WP_045602089.1\|2289250_2290324_+	FUSC family protein	NA	NA	NA	NA
WP_025405833.1\|2290678_2291410_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_082256198.1\|2291597_2292809_-	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_045602087.1\|2292938_2294441_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_045602085.1\|2294574_2295612_-	transglutaminase family protein	NA	NA	NA	NA
WP_045603152.1\|2295602_2298251_-	circularly permuted type 2 ATP-grasp protein	NA	NA	NA	NA
WP_045602082.1\|2298454_2301892_-	transglutaminase family protein	NA	NA	NA	NA
WP_045602080.1\|2302016_2302973_-	transglutaminase family protein	NA	NA	NA	NA
WP_045602078.1\|2302981_2303923_-	alpha-E domain-containing protein	NA	NA	NA	NA
WP_011401430.1\|2304017_2305433_-	circularly permuted type 2 ATP-grasp protein	NA	NA	NA	NA
WP_045602075.1\|2306183_2306618_-\|tail	tail assembly chaperone	A4JWL9	Burkholderia_virus	2.0e-43	75.7
WP_045602073.1\|2306631_2307918_-	hypothetical protein	A4JWL8	Burkholderia_virus	5.0e-127	61.9
WP_045602071.1\|2307929_2308526_-	DUF2313 domain-containing protein	B5TAB0	Burkholderia_phage	9.8e-62	62.8
WP_045602069.1\|2308525_2309647_-\|plate	baseplate J/gp47 family protein	B5TAA9	Burkholderia_phage	6.6e-152	72.7
WP_045602066.1\|2309643_2310231_-\|tail	tail protein	B5TAA8	Burkholderia_phage	2.5e-81	73.4
WP_045602064.1\|2310317_2310833_-\|plate	baseplate assembly protein	B5TAA7	Burkholderia_phage	1.0e-54	63.2
WP_045602062.1\|2310829_2311996_-	hypothetical protein	B5TAA6	Burkholderia_phage	1.7e-182	79.3
WP_045602060.1\|2311998_2313387_-	multidrug DMT transporter	B5TAA5	Burkholderia_phage	4.0e-191	73.4
WP_045602059.1\|2313390_2316054_-\|tail	tail protein	B5TAA4	Burkholderia_phage	3.3e-218	65.4
WP_045602057.1\|2316102_2316651_-	hypothetical protein	B5TAA3	Burkholderia_phage	1.1e-64	70.1
WP_045602055.1\|2316742_2316967_-	hypothetical protein	E5EYD6	Acinetobacter_phage	7.5e-23	66.2
WP_045602053.1\|2316999_2317371_-	hypothetical protein	B5TAA2	Burkholderia_phage	2.4e-50	75.6
WP_045602051.1\|2317417_2318896_-\|tail	tail sheath protein	B5TAA1	Burkholderia_phage	7.5e-220	79.9
WP_045602049.1\|2318946_2319213_-	hypothetical protein	B5TAA0	Burkholderia_phage	1.3e-13	55.8
WP_045603151.1\|2319181_2319784_-	hypothetical protein	B5TA99	Burkholderia_phage	2.7e-51	51.8
WP_045602047.1\|2319798_2320233_-	virion morphogenesis protein	B5TA98	Burkholderia_phage	5.0e-55	75.7
WP_045602045.1\|2320229_2320733_-	DUF1320 domain-containing protein	B5TA97	Burkholderia_phage	1.0e-88	92.8
WP_045603149.1\|2320729_2321131_-	hypothetical protein	B5TA96	Burkholderia_phage	1.2e-10	69.8
WP_045602043.1\|2321204_2322152_-	hypothetical protein	B5TA95	Burkholderia_phage	4.4e-165	92.7
WP_009927839.1\|2322207_2322564_-	hypothetical protein	B5TA94	Burkholderia_phage	3.3e-41	77.1
WP_045602041.1\|2322608_2323757_-	hypothetical protein	B5TA92	Burkholderia_phage	1.5e-188	87.9
WP_006484119.1\|2323970_2324369_-	hypothetical protein	B5TA91	Burkholderia_phage	1.1e-69	100.0
WP_045602036.1\|2324365_2324806_-	regulatory protein GemA	B5TA90	Burkholderia_phage	9.4e-70	92.5
WP_045602033.1\|2324807_2325131_-	hypothetical protein	B5TA89	Burkholderia_phage	1.5e-48	87.6
WP_082256118.1\|2325294_2325579_-	hypothetical protein	B5TA88	Burkholderia_phage	1.6e-14	66.1
WP_045602031.1\|2325654_2325927_-	HU family DNA-binding protein	B5TA87	Burkholderia_phage	1.1e-36	93.3
WP_045602029.1\|2325990_2326383_-	hypothetical protein	B5TA86	Burkholderia_phage	1.8e-67	94.6
WP_045602027.1\|2326393_2327020_-	DUF3164 family protein	B5TA85	Burkholderia_phage	4.6e-102	91.8
WP_045602025.1\|2327016_2327604_-	hypothetical protein	B5TA84	Burkholderia_phage	3.4e-83	92.9
WP_045602024.1\|2327590_2327896_-	hypothetical protein	B5TA83	Burkholderia_phage	3.5e-39	86.1
WP_045603147.1\|2327892_2328081_-	hypothetical protein	B5TA82	Burkholderia_phage	5.7e-16	71.0
WP_045602021.1\|2328088_2329081_-	AAA family ATPase	B5TA81	Burkholderia_phage	2.4e-174	93.9
WP_045602019.1\|2329090_2330716_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	B5TA80	Burkholderia_phage	4.6e-303	95.0
WP_045602017.1\|2330753_2331803_-	hypothetical protein	B5TA79	Burkholderia_phage	2.7e-139	77.8
WP_045602015.1\|2331799_2331991_-	DNA-binding protein	B5TA78	Burkholderia_phage	6.0e-21	76.3
WP_045602013.1\|2332055_2332556_+	helix-turn-helix transcriptional regulator	K4NXA8	Burkholderia_phage	1.3e-11	35.3
WP_045602012.1\|2332599_2333136_+	hypothetical protein	B5TA76	Burkholderia_phage	2.8e-60	67.4
WP_127446971.1\|2333160_2333859_+	hypothetical protein	NA	NA	NA	NA
WP_045602010.1\|2333900_2334383_+	DUF2778 domain-containing protein	NA	NA	NA	NA
WP_045602008.1\|2334379_2334652_+	hypothetical protein	NA	NA	NA	NA
WP_052712509.1\|2334768_2335080_+	hypothetical protein	B5TA74	Burkholderia_phage	7.4e-37	72.6
WP_009927784.1\|2335076_2335751_+	lytic transglycosylase domain-containing protein	B5TA73	Burkholderia_phage	6.3e-89	71.4
WP_082256119.1\|2335747_2336212_+	hypothetical protein	NA	NA	NA	NA
WP_038724579.1\|2336319_2336541_+	hypothetical protein	B5TA71	Burkholderia_phage	4.3e-31	89.0
WP_009927781.1\|2336537_2336828_+	hypothetical protein	B5TA70	Burkholderia_phage	1.3e-40	89.6
WP_038755846.1\|2336831_2337329_+	DUF1804 family protein	B5TA69	Burkholderia_phage	3.5e-81	93.9
WP_045602004.1\|2337335_2338952_+\|terminase	phage terminase large subunit	B5TA68	Burkholderia_phage	2.4e-304	92.4
WP_045602002.1\|2338941_2340474_+	DUF935 family protein	B5TA67	Burkholderia_phage	8.5e-251	89.3
WP_045602001.1\|2340518_2340779_+	hypothetical protein	B5TA66	Burkholderia_phage	7.4e-22	69.8
WP_045602000.1\|2342872_2343364_+	DUF1804 family protein	B5TA69	Burkholderia_phage	4.3e-31	44.9
2352287:2352305	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2404349 : 2472449

Burkholderia_virus(23.81%)

transposase,integrase

attL 2422776:2422793|attR 2471132:2471149

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082256122.1\|2404349_2404733_+\|transposase	transposase	NA	NA	NA	NA
WP_045601945.1\|2405347_2406301_+	leucyl aminopeptidase (aminopeptidase T)	NA	NA	NA	NA
WP_009901108.1\|2406561_2407611_-	hypothetical protein	NA	NA	NA	NA
WP_011401450.1\|2407614_2408661_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_025405852.1\|2408673_2409243_-	acetyltransferase	NA	NA	NA	NA
WP_082256123.1\|2409235_2410291_-	glycosyltransferase family 9 protein	NA	NA	NA	NA
WP_102889805.1\|2410196_2411405_-	glycosyltransferase family 9 protein	NA	NA	NA	NA
WP_045601941.1\|2411626_2412670_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_009901116.1\|2412685_2414041_-	membrane protein	NA	NA	NA	NA
WP_045601940.1\|2414319_2416080_-	GNAT family N-acetyltransferase	A0A2K9L470	Tupanvirus	2.5e-36	37.0
WP_009901118.1\|2416105_2417458_-	lipopolysaccharide biosynthesis protein RfbH	A0A0P0YLZ6	Yellowstone_lake_phycodnavirus	1.0e-50	36.1
WP_082256199.1\|2417461_2418535_-	CDP-glucose 4,6-dehydratase	J7Q7J8	Aeropyrum_coil-shaped_virus	1.1e-13	29.2
WP_009893901.1\|2418537_2419314_-	glucose-1-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_009901124.1\|2419310_2420528_-	chain-length determining protein	NA	NA	NA	NA
WP_045601939.1\|2420532_2423085_-	capsule biosynthesis protein	NA	NA	NA	NA
2422776:2422793	attL	NA	NA	NA	NA
WP_102889804.1\|2423920_2424280_-	hypothetical protein	NA	NA	NA	NA
WP_045601938.1\|2424352_2424997_+	hypothetical protein	NA	NA	NA	NA
WP_045601937.1\|2425826_2428814_+	YjbH domain-containing protein	NA	NA	NA	NA
WP_082256124.1\|2429172_2430879_-	thiamine pyrophosphate-binding protein	M4QSI1	Ostreococcus_lucimarinus_virus	9.4e-65	31.2
WP_009893910.1\|2431111_2431519_-	hypothetical protein	NA	NA	NA	NA
WP_009901130.1\|2432221_2432914_+	hypothetical protein	NA	NA	NA	NA
WP_082256200.1\|2433031_2436610_+	hypothetical protein	NA	NA	NA	NA
WP_082256125.1\|2436593_2448992_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_009893914.1\|2448982_2449717_+	hypothetical protein	NA	NA	NA	NA
WP_102889818.1\|2450120_2451319_-\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	8.8e-102	65.5
WP_045601932.1\|2452386_2452830_+	hypothetical protein	NA	NA	NA	NA
WP_004549731.1\|2452879_2453149_+	BrnT family toxin	NA	NA	NA	NA
WP_045601930.1\|2453132_2453417_+	BrnA antitoxin family protein	K4NZP3	Burkholderia_phage	6.4e-11	52.9
WP_045601929.1\|2453820_2454018_+	hypothetical protein	Q3HQX5	Burkholderia_phage	3.9e-15	70.9
WP_045598729.1\|2454107_2454368_+	hypothetical protein	NA	NA	NA	NA
WP_045598726.1\|2454377_2456000_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	2.1e-66	33.7
WP_082255749.1\|2456099_2456513_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.1e-16	38.5
WP_045598724.1\|2456452_2456920_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_102889803.1\|2457507_2458642_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.2e-14	29.9
WP_052712499.1\|2459038_2459476_+	hypothetical protein	NA	NA	NA	NA
WP_045603129.1\|2460353_2460743_+	type II toxin-antitoxin system death-on-curing family toxin	A0A222YZ88	Escherichia_phage	2.4e-16	39.8
WP_045601927.1\|2460777_2460978_-	hypothetical protein	NA	NA	NA	NA
WP_045603127.1\|2461025_2461364_-	hypothetical protein	A4JX41	Burkholderia_virus	1.9e-49	90.2
WP_102889802.1\|2462155_2463115_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	1.9e-14	29.9
WP_045598892.1\|2463191_2463665_+\|transposase	transposase	NA	NA	NA	NA
WP_045598698.1\|2463640_2463991_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.1e-17	39.4
WP_045598699.1\|2464022_2465588_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	9.8e-69	34.0
WP_155722048.1\|2465822_2465999_+	hypothetical protein	Q8W6Q1	Burkholderia_virus	2.4e-08	84.8
WP_045601921.1\|2466009_2466129_+	hypothetical protein	Q8W6Q2	Burkholderia_virus	9.4e-09	84.2
WP_082256201.1\|2466151_2466334_+	hypothetical protein	NA	NA	NA	NA
WP_045601918.1\|2466361_2466637_+	hypothetical protein	A1YZS4	Burkholderia_virus	1.2e-30	69.8
WP_045601917.1\|2466681_2466897_+	hypothetical protein	Q6JIH9	Burkholderia_virus	4.3e-28	77.5
WP_082256127.1\|2467204_2467777_+\|integrase	site-specific integrase	A0A1W6JTA0	Pseudomonas_phage	2.7e-56	66.5
WP_045601915.1\|2467979_2469995_-	sodium:solute symporter	NA	NA	NA	NA
WP_045143316.1\|2469988_2470369_-	DUF4212 domain-containing protein	NA	NA	NA	NA
WP_045601914.1\|2470466_2472449_-	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	8.9e-83	44.3
2471132:2471149	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP013411

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP013412

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

3. NZ_CP013413

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection