CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Prophage number
NZ_CP013416	Burkholderia ubonensis strain MSMB2035 chromosome 2, complete sequence	2 crisprs	cas3,csa3,c2c9_V-U4,Cas14u_CAS-V,DinG	1	3
NZ_CP013415	Burkholderia ubonensis strain MSMB2035 plasmid pMSMB2035, complete sequence	0 crisprs	WYL,PD-DExK	0	12
NZ_CP013414	Burkholderia ubonensis strain MSMB2035 chromosome 1, complete sequence	1 crisprs	WYL,RT,csa3,cas3,Cas14u_CAS-V,DEDDh,DinG	0	8

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013414_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013414_1

3860940-3861034

Orphan

Consensus_repeat	Method
GCCGCCACGTGCATCACCGGCTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013414_1

>merge|NZ_CP013414|1|3860940-3861034|CRISPRCasFinder
GCCGCCACGTGCATCACCGGCTCCGTCGTGGTGCGAGCCGCCACGTACATCGCCGGCTCCGTCGTCGCGCGGGCCGCCACGTGCATCACCGGCTC

>NZ_CP013414|1|1|3860940-3861034|CRISPRCasFinder
GCCGCCACGTGCATCACCGGCTC	CGTCGTGGTGCGAGCCGCCACGTACATCGCCGGCTCCGTCGTCGCGCGG
GCCGCCACGTGCATCACCGGCTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013414.1\|WP_059749765.1\|3852993_3854493_-\|type-VI-secretion-system-contractile-sheath-large-subunit	unknown	unknown	gnl\|CDD\|226048
NZ_CP013414.1\|WP_059749766.1\|3848983_3850288_-\|type-VI-secretion-system-protein-TssL	unknown	unknown	gnl\|CDD\|236157
NZ_CP013414.1\|WP_059749767.1\|3845060_3848969_-\|type-VI-secretion-system-membrane-subunit-TssM	unknown	unknown	gnl\|CDD\|274531
NZ_CP013414.1\|WP_059527210.1\|3854539_3855079_-\|type-VI-secretion-system-contractile-sheath-small-subunit	unknown	unknown	gnl\|CDD\|226047
NZ_CP013414.1\|WP_088510530.1\|3862069_3862570_-\|type-1-fimbrial-protein	unknown	unknown	gnl\|CDD\|226069
NZ_CP013414.1\|WP_059749757.1\|3867658_3868636_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|377694
NZ_CP013414.1\|WP_080409879.1\|3857095_3857785_-\|type-VI-secretion-system-protein-ImpK	unknown	unknown	gnl\|CDD\|378275
NZ_CP013414.1\|WP_042586571.1\|3863280_3864426_+\|homoserine-O-acetyltransferase	unknown	unknown	gnl\|CDD\|234678
NZ_CP013414.1\|WP_059749758.1\|3865156_3866578_+\|AmpG-family-muropeptide-MFS-transporter	unknown	unknown	gnl\|CDD\|341039
NZ_CP013414.1\|WP_088510532.1\|3861247_3861979_-\|fimbria/pilus-periplasmic-chaperone	unknown	unknown	gnl\|CDD\|236634
NZ_CP013414.1\|WP_059611907.1\|3850284_3851634_-\|type-VI-secretion-system-baseplate-subunit-TssK	unknown	unknown	gnl\|CDD\|226053
NZ_CP013414.1\|WP_059527216.1\|3852312_3852795_-\|type-VI-secretion-system-tube-protein-Hcp	unknown	unknown	gnl\|CDD\|377536
NZ_CP013414.1\|WP_010090334.1\|3868850_3869903_+\|NAD(P)-dependent-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176186
NZ_CP013414.1\|WP_080409880.1\|3851637_3852186_-\|type-VI-secretion-system-lipoprotein-TssJ	unknown	unknown	gnl\|CDD\|378947
NZ_CP013414.1\|WP_059749756.1\|3870019_3870790_-\|exodeoxyribonuclease-III	unknown	unknown	gnl\|CDD\|197336
NZ_CP013414.1\|WP_059749762.1\|3857819_3858392_-\|type-1-fimbrial-protein	unknown	unknown	gnl\|CDD\|226069
NZ_CP013414.1\|WP_042586572.1\|3864422_3865031_+\|methionine-biosynthesis-protein-MetW	unknown	unknown	gnl\|CDD\|273958
NZ_CP013414.1\|WP_059749838.1\|3866567_3867599_+\|M48-family-metallopeptidase	unknown	unknown	gnl\|CDD\|320690
NZ_CP013414.1\|WP_059611938.1\|3870832_3871672_-\|polyphosphate-kinase-2-family-protein	unknown	unknown	gnl\|CDD\|274737
NZ_CP013414.1\|WP_059749764.1\|3855440_3857099_-\|OmpA-family-protein	unknown	unknown	gnl\|CDD\|143586

Protein	Function_ID	Function_description	E-value
NZ_CP013414.1\|WP_059749765.1\|3852993_3854493_-\|type-VI-secretion-system-contractile-sheath-large-subunit	gnl\|CDD\|226048	COG3517, COG3517, Predicted component of the type VI protein secretion system [Intracellular trafficking, secretion, and vesicular transport].	0
NZ_CP013414.1\|WP_059749766.1\|3848983_3850288_-\|type-VI-secretion-system-protein-TssL	gnl\|CDD\|236157	PRK08126, PRK08126, hypothetical protein; Provisional.	0
NZ_CP013414.1\|WP_059749767.1\|3845060_3848969_-\|type-VI-secretion-system-membrane-subunit-TssM	gnl\|CDD\|274531	TIGR03348, VI_IcmF, type VI secretion protein IcmF. Members of this protein family are IcmF homologs and tend to be associated with type VI secretion systems. [Cellular processes, Pathogenesis].	0
NZ_CP013414.1\|WP_059527210.1\|3854539_3855079_-\|type-VI-secretion-system-contractile-sheath-small-subunit	gnl\|CDD\|226047	COG3516, COG3516, Predicted component of the type VI protein secretion system [Intracellular trafficking, secretion, and vesicular transport].	5.16244e-81
NZ_CP013414.1\|WP_088510530.1\|3862069_3862570_-\|type-1-fimbrial-protein	gnl\|CDD\|226069	COG3539, FimA, P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion].	6.67324e-15
NZ_CP013414.1\|WP_059749757.1\|3867658_3868636_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|377694	pfam06719, AraC_N, AraC-type transcriptional regulator N-terminus. This family represents the N-terminus of bacterial ARAC-type transcriptional regulators. In E. coli, these regulate the L-arabinose operon through sensing the presence of arabinose, and when the sugar is present, transmitting this information from the arabinose-binding domains to the protein's DNA-binding domains. This family might represent the N-terminal arm of the protein, which binds to the C-terminal DNA binding domains to hold them in a state where the protein prefers to loop and remain non-activating. All family members contain the pfam00165 domain.	1.50732e-62
NZ_CP013414.1\|WP_080409879.1\|3857095_3857785_-\|type-VI-secretion-system-protein-ImpK	gnl\|CDD\|378275	pfam09850, DotU, Type VI secretion system protein DotU. DotU is a family of Gram-negative bacterial proteins that form part of the membrane-joining complex of the type VI secretion system. DotU binds tightly to IcmF and together they are tethered to the inner membrane at one end and the peptidoglycan layer at the other; they interact with Lip1 which then tethers the peptidoglycan layer to the outer membrane.	1.19482e-17
NZ_CP013414.1\|WP_042586571.1\|3863280_3864426_+\|homoserine-O-acetyltransferase	gnl\|CDD\|234678	PRK00175, metX, homoserine O-acetyltransferase; Provisional.	0
NZ_CP013414.1\|WP_059749758.1\|3865156_3866578_+\|AmpG-family-muropeptide-MFS-transporter	gnl\|CDD\|341039	cd17486, MFS_AmpG_like, AmpG and similar transporters of the Major Facilitator Superfamily. AmpG acts as an inner membrane permease in the beta-lactamase induction system and in peptidoglycan recycling. It transports meuropeptide from the periplasm into the cytosol in gram-negative bacteria, which is essential for the induction of the ampC encoding beta-lactamase. The AmpG family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.35469e-135
NZ_CP013414.1\|WP_088510532.1\|3861247_3861979_-\|fimbria/pilus-periplasmic-chaperone	gnl\|CDD\|236634	PRK09926, PRK09926, fimbrial chaperone.	1.01948e-98
NZ_CP013414.1\|WP_059611907.1\|3850284_3851634_-\|type-VI-secretion-system-baseplate-subunit-TssK	gnl\|CDD\|226053	COG3522, COG3522, Predicted component of the type VI protein secretion system [Intracellular trafficking, secretion, and vesicular transport].	2.09434e-176
NZ_CP013414.1\|WP_059527216.1\|3852312_3852795_-\|type-VI-secretion-system-tube-protein-Hcp	gnl\|CDD\|377536	pfam05638, T6SS_HCP, Type VI secretion system effector, Hcp. HCP is a family of proteins which are expressed in up to 1000 copies in Gram-negative bacteria. Together these copies aggregate into a needle-like shaft or tube that will penetrate other bacteria via a puncturing protein attached to its head. Initially Hcp forms a hexameric structure with a central channel of 40 Angstroms. These hexamers pile up one on top of each other forming nanotubes resembling the gp19 tail phage tube.	7.12094e-51
NZ_CP013414.1\|WP_010090334.1\|3868850_3869903_+\|NAD(P)-dependent-alcohol-dehydrogenase	gnl\|CDD\|176186	cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD). Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	0
NZ_CP013414.1\|WP_080409880.1\|3851637_3852186_-\|type-VI-secretion-system-lipoprotein-TssJ	gnl\|CDD\|378947	pfam12790, T6SS-SciN, Type VI secretion lipoprotein, VasD, EvfM, TssJ, VC_A0113. One of the virulence mechanisms of E coli is the production of toxins which it produces from dedicated machineries called secretion systems. Seven secretion systems have been described, which assemble from 3 to up to more than 20 subunits. These secretion systems derive from or have co-evolved with bacterial organelles such as ABC transporters (type I), type IV pili (type 2), flagella (type 3), or conjugative machines (type IV). The type VI secretion system (T6SS) is present in most pathogens that have contact with animals, plants, or humans. SciN is a lipoprotein tethered to the outer membrane and expressed in the periplasm of E coli and is essential for T6S-dependent secretion of the Hcp-like SciD protein and for biofilm formation.	8.90853e-41
NZ_CP013414.1\|WP_059749756.1\|3870019_3870790_-\|exodeoxyribonuclease-III	gnl\|CDD\|197336	cd10281, Nape_like_AP-endo, Neisseria meningitides Nape-like subfamily of the ExoIII family purinic/apyrimidinic (AP) endonucleases. This subfamily includes Neisseria meningitides Nape and related proteins. These are Escherichia coli exonuclease III (ExoIII)-like AP endonucleases and belong to the large EEP (exonuclease/endonuclease/phosphatase) superfamily that contains functionally diverse enzymes that share a common catalytic mechanism of cleaving phosphodiester bonds. AP endonucleases participate in the DNA base excision repair (BER) pathway. AP sites are one of the most common lesions in cellular DNA. During BER the damaged DNA is first recognized by DNA glycosylase. AP endonucleases then catalyze the hydrolytic cleavage of the phosphodiester bond 5' to the AP site, and this is followed by the coordinated actions of DNA polymerase, deoxyribose phosphatase, and DNA ligase. If left unrepaired, AP sites block DNA replication, and have both mutagenic and cytotoxic effects. AP endonucleases can carry out a variety of excision and incision reactions on DNA, including 3'-5' exonuclease, 3'-deoxyribose phosphodiesterase, 3'-phosphatase, and occasionally, nonspecific DNase activities. Different AP endonuclease enzymes catalyze the different reactions with different efficiences. Many organisms have two AP endonucleases, usually one is the dominant AP endonuclease, the other has weak AP endonuclease activity; for example, Neisseria meningitides Nape and NExo. Nape, found in this subfamily, is the dominant AP endonuclease. It exhibits strong AP endonuclease activity, and also exhibits 3'-5'exonuclease and 3'-deoxyribose phosphodiesterase activities.	7.7807e-153
NZ_CP013414.1\|WP_059749762.1\|3857819_3858392_-\|type-1-fimbrial-protein	gnl\|CDD\|226069	COG3539, FimA, P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion].	7.85182e-17
NZ_CP013414.1\|WP_042586572.1\|3864422_3865031_+\|methionine-biosynthesis-protein-MetW	gnl\|CDD\|273958	TIGR02081, conserved_hypothetical_protein, methionine biosynthesis protein MetW. This protein is found alongside MetX, of the enzyme that acylates homoserine as a first step toward methionine biosynthesis, in many species. It appears to act in methionine biosynthesis but is not fully characterized. [Amino acid biosynthesis, Aspartate family].	1.89286e-98
NZ_CP013414.1\|WP_059749838.1\|3866567_3867599_+\|M48-family-metallopeptidase	gnl\|CDD\|320690	cd07331, M48C_Oma1_like, Peptidase M48C, integral membrane endopeptidase. This subfamily contains peptidase M48C Oma1 (also called mitochondrial metalloendopeptidase OMA1) protease homologs that are mostly uncharacterized. Oma1 is part of the quality control system in the inner membrane of mitochondria, with its catalytic site facing the matrix space. It cleaves and thereby promotes the turnover of mistranslated or misfolded membrane proteins. Oma1 can cleave the misfolded multi-pass membrane protein Oxa1, thus exerting a function similar to the ATP-dependent m-AAA protease for quality control of inner membrane proteins; it cleaves a misfolded polytopic membrane protein at multiple sites. It has been proposed that in the absence of m-AAA protease, proteolysis of Oxa1 is mediated by Oma1 in an ATP-independent manner. Oma1 is part of highly conserved mitochondrial metallopeptidases, with homologs present in higher eukaryotes, eubacteria and archaebacteria, all containing the zinc binding motif (HEXXH). It forms a high molecular mass complex in the inner membrane, possibly a homo-hexamer.	1.45472e-55
NZ_CP013414.1\|WP_059611938.1\|3870832_3871672_-\|polyphosphate-kinase-2-family-protein	gnl\|CDD\|274737	TIGR03709, PPK2_rel_1, polyphosphate:nucleotide phosphotransferase, PPK2 family. Members of this protein family belong to the polyphosphate kinase 2 (PPK2) family, which is not related in sequence to PPK1. While PPK1 tends to act in the biosynthesis of polyphosphate, or poly(P), members of the PPK2 family tend to use the terminal phosphate of poly(P) to regenerate ATP or GTP from the corresponding nucleoside diphosphate, or ADP from AMP as is the case with polyphosphate:AMP phosphotransferase (PAP). Members of this protein family most likely transfer the terminal phosphate between poly(P) and some nucleotide, but it is not clear which. [Central intermediary metabolism, Phosphorus compounds].	1.21039e-140
NZ_CP013414.1\|WP_059749764.1\|3855440_3857099_-\|OmpA-family-protein	gnl\|CDD\|143586	cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA. OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. Well-studied members of this family include the Escherichia coli outer membrane protein OmpA, the Escherichia coli lipoprotein PAL, Neisseria meningitdis RmpM, which interact with the outer membrane, as well as the Escherichia coli motor protein MotB, and the Vibrio flagellar motor proteins PomB and MotY, which interact with the inner membrane.	7.88584e-33

>NZ_CP013414.1|WP_059749762.1|3857819_3858392_-|type-1-fimbrial-protein
MNRTIRTHASKWIGCIALGAAAATFAWPGRVAWGAENPTVTIKFQGSYNTVTCTVVDGKENQLVTLPRISTSLLTSAGQTAGSTAFTIPLRCDGSIQAVRVYFQRGATTNANGNLDVENPTDPASAKGVQIQLLNGNGSPIQVGNAATMTMVNLDASTTTPVPFGAQYYATGATTAGKVRTYATFVIQMP
>NZ_CP013414.1|WP_080409879.1|3857095_3857785_-|type-VI-secretion-system-protein-ImpK
MKFDSSGAALRASLQETVLHIALLVQGASIPEIHVWRARCIGLVERLDQAMRDDGCASDVVRDVGIAQCALLDEVTLRRLPAGRRDEWMRETMLFRFHRVSSGADRIRSRIEARLNGPHSEPQLQDMYAALLDLWLPPEHDAYRPHGSAARPVASPLDPDAAGAAGEPPTQRAVAAVATRAWPPLRRMLPAVVLLAAVWIGCDVSLQRAVERLPDSGPRVAQNDEEARP
>NZ_CP013414.1|WP_059749764.1|3855440_3857099_-|OmpA-family-protein
MNMRSMRETGLVWIVMPVVVIGGAWVLAGLVDWLIAMFVALAVASAVCVAGWHERRRAAHAVSSSAESTDAIGSVAHELAVIVVVGPYAAGLFPRDGGRTTLRRDDRAVWLLADTPERLNDVMAQVKASRGRFPDAALLPVVPEGDDESVLRREFVQWRIALQAAYCHPECVLPCHVAVYACLGPGEDAATQVQWFGDPLDVGVPRLEEAIRLYDRLPAIRRQLASSRQTGAVVRSALGLSVFEWLDEAALLSLISALANTSPFALQGVSLADVGHTPVRPGAWTRWLIGRTGLQPGVTKPVTGPLPPPLVHASTRVAGRHAAPPPTGAEWPLASHVLLSSVVALIVAVAMSGWVNYRLVERIAGDLSTYWNTPGDRITAKIDSFERVREARDEVARNLRDGAPFGAGWWLYPGRALSARLDAALAAYQPPLTTARIDSLSLFASGKATFSPESAHRELAHVLRLIRVNPDQRVLIEGHADSEGSPEANLQLSEARARAIRDWLVTVGGLPVTRFAIQGMGDIRPIADNRSEAGRALNRRVDISLIPDRVRH
>NZ_CP013414.1|WP_059527210.1|3854539_3855079_-|type-VI-secretion-system-contractile-sheath-small-subunit
MAISNSAQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPLESLPAVGDRKFYNIDIDNFDERMKAMKPRVAFSVPNTLSGDGQLMVDITFESMDDFSPAAIAKNVDALSQLLDARTQLANLQTYMDGKSGAENLVSQVLKDPALLSALAKAPKPEVRKTDALEPQEQQ
>NZ_CP013414.1|WP_059749765.1|3852993_3854493_-|type-VI-secretion-system-contractile-sheath-large-subunit
MAVRESQARAAEAQLGAESDFNALLSREFKPKTEQAREAVESAVKTLAEQALANSVTMSDDAYKSIEAIIGEIDRKLSEQINLILHHDDFQKLESAWRGLHHLVTNTETDEKLKIRFMDVSKEDLRRTMKRYKGVAWDQSPFFKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLASIGKVAAAAHAPFITGASPSVLQMDSWQELANPRDLTKIFTQNLEYAPWNSLRNSEDSRYIGLAMPRFLARLPYGIRTNPVDEFDFEESTDGSNHAKYTWANAAYAMAVNINRSFKHYGWCTLIRGVESGGVVENLPCHTFPTDDGGIDMKCPTEIAISDRREAELSKNGFIPLIHRKNTDYAAFIGAQSLQKPAEYYDPDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERDEMQQWLNEWIMYYVDADPANSSQETKARRPLAAAEVVVEEVEGNPGYYQAKFFLRPHFQLEGLTVSLRLVAKLPSVKAAA
>NZ_CP013414.1|WP_059527216.1|3852312_3852795_-|type-VI-secretion-system-tube-protein-Hcp
MAHDIFLKINGIDGESKDATHQNEIEVLSWSWNVSQQSNMHLGSGGGAGKATVDDLQFEHFIDRASPNLIQYCLLGKHIDEAKLTVRKAGGNPLEYILLTMNDVLVTQVSPSGVAADESRPREIVRLSFSRLKQEYVVQNAQGGSGGAITATFDIKKNAA
>NZ_CP013414.1|WP_080409880.1|3851637_3852186_-|type-VI-secretion-system-lipoprotein-TssJ
MVFRFPFGTKTRQARRDAIKRIAVGLSCLSLAACGGMPSRKELASLDLKIKVSDGVNPDELGRPAPIMVRIYELKSAYTFDNADFFSLQSDSKKVLGEDAIVIDEFVLRPGDVRDIRRRLNAATTAIGVLAGYRELGKSVWRGAYRLPPPPDEAWLRVLTARTKIKLNVDVGQRAVLVTELD
>NZ_CP013414.1|WP_059611907.1|3850284_3851634_-|type-VI-secretion-system-baseplate-subunit-TssK
MSWHNKVVWSEGLFLLPQLFQQQERYFEHFAHKRSAPLSPFFWGFSQFEIDQESLAFGKLVFKSGTGVFPDGTPFDVPAHAPPPPPLTIAPEHQNQVIYLAVPLRLPNTEETVFREQTASLARYLAFENELRDSNTIGQGPKPVQLANLRLRLLPEKELTQSWIGIALTRIKALRADGSVSLHDTDHIPPVSQYGADPLLRDWATQLHGLAKLRADALATRLSGSDGRAGAAAEVADYLLLQVLNRYEPLLAHICRIRETPPVEFYRELAMMAGELSTFVRPQTRRPLPTPGYDHAQLYASIRPLVEEVHYLLNQVLIRGAQPIPLTEQPHGIRVAAVMPAELSGYSSLVLAVGAQMSPDVLQQQFASQTKISQPQRLPELIRSHLPGLTMVPLPVPPRQIPFNSSYIYYELSRSGPFWEQIAQQGGLAMHIAGHFPELKLELWGVRHK
>NZ_CP013414.1|WP_059749766.1|3848983_3850288_-|type-VI-secretion-system-protein-TssL
MNSATFDKDAFDFLASDSGTLPEPQKERAGHEKGAPSQPIDIGEFDAVVDIQQRLDEVLAASNPLLEAARPLLRMLADMPATLDTSEAVGSLRTLLVREVSLFQKLCDKADLPWKHMAVVRYCLCTALDEAANRTSWGGGGVWAAQSLLITFEGEVDGGEKFFLLIGRMATDPQEYVDILEILYRVLGLGFEGRYSVVADGRRYLEQIRQRLWTLITGARDALQPELSPHWRGARPGRLPLLRSVPVWASAACAVLALFALFVFYQYNLLSQRYALETRILEIGKERLASAPQRLRLSHLLRDEIARGLLTVDEDDRRSLVVFKGDSMFASGQSTVLPEIEPILNKVAREVARVGGNVLVSGHTDNQPIRSAAFPNNLVLSEKRAAYVAQILQRDGTPADRIRAIGKGDSQPVGDNASVAGRALNRRVEIMVTL
>NZ_CP013414.1|WP_059749767.1|3845060_3848969_-|type-VI-secretion-system-membrane-subunit-TssM
MSYLKRLFRWFFSWRMLACVAVLLVCVAVWFLGPLFAFGELHPFAGVAIRLIVIALLLGLLVLRLLRWPLSPIWVIALCVALWHVGPLFGLGDHHPVEPIWVRVLLIATIAFCYMAYGLYKLWQALRSNDALLKRFLQPKGDKPVEAGRDEVRAVAMVVSKAIAQLKRLRGGTLGWRRLLEVDRHLYGLPWYMMVGTPGAGKTTAILGSGLQFPLTEQMGAVSAHGIESTANCEWWFANEAVLIDTAGRYVEQDDPQDEAVTAVNAAEWKELLGQLRKHRPRAPLNGAILAVSAADLVNRSDAERTVLAASLRARLGELRQQLGIRFPVYVFVTKLDLLPGFTEYFQSLTAEGRTQIWGFTLPCDESGAASVDGLRRHCAHELTLLEARIDAGLNNRFLEEYEGDRRKRLYPLAQEFRSLSTLVTDLLDLVFLDSRYDDVQLQNTLRGVYFTSAEQTDQVIAADRETVLQRLRRKLARMRTNSDAAAQVRGEGPVSGHRSFFLRNVFQHVIVPEAHLVRADLKWEIRFRAMRWAGHLLTAILFVWLVFSLTVSYDNNRNYLTAISGKTTALAARAAAYNKSPKAAAIGGLLDSSRDLPRYGDLDLDAPGGAYRYGLYVVPAIVKASDTTYLSLLKQTLLPQIVRRAESELSTQINAQNADDVYRTLTIYLMLYDDDRYDAKAVRTWVLRDWERSDSAAAMGGRNLMVRHLDALFIDGRPVKPTVAQDAALVQRARLFLSQNPAPKRLYERAIGAMEKEAPENFTLAQALGLQGASLFKLVDGSRFEQGVPGLYTYDGYHALFNQRLPEFLARAQDDDGWVMGRAGKRSDLTASIQGMRVVAARSSLADDIRRQYLIDYGNYWQQFLADIRPATSGENGRDGTLALDQATLRALAAPDSPLVRLARAVVRETSLSVVDVQEPSSLNDLALTAVGRKSSTARTAALEARKIAAQRPEQRLEKEFVDNRFAALREVTTGQADTGSGPAMTDTPIAAGGKALQLDAILTLINEQYTRLVVASNALSANSMPPALDIGTTLQTEAEKLPAPLRLVLGGIATQVADKVGQEVGGLLAMQVDTSVGQSCRRTIDGKYPFVRSSQEVDVEDFNRMFAAGGVFDEFFQKSLASYVDTNAKPWRYKSLSPGMPPIKGPSLEPFERASAIREVFFRDQGAKRMAWKMDAKVASIDPEITELLIDVDGQTQRYVHGPVTPFALSWPGPRGGAMAEVAAKPAIRPDTSTIVATGPWALFRLIERGRLTGTASASRLTLAFDFDGRHAALELMTSGQLNPLTSNLLTGFHCPGGLA
>NZ_CP013414.1|WP_088510532.1|3861247_3861979_-|fimbria/pilus-periplasmic-chaperone
MRSWKWKGIAAAFALGMAALSAQAAIVITGTRVVYPEQSREVNVRLTNIETAPVLVQSWIDDGDSDANPDQIKVPFVLTPPVFRVEPKKGQTLRIMYTGTNLPTDRESVFWLNVQEIPPQPTNAEDTNLLQLAFRTRIKLFFRPAALQDGPSGELLKWKVVHDGKGQSVLRVDNPSPYYVSFSRVALKAGDKEIQFDPSMVAPFGHVSFTQQPGTRSTLARGAVSYKLLNDYGAEVAGSATAE
>NZ_CP013414.1|WP_088510530.1|3862069_3862570_-|type-1-fimbrial-protein
MAASTAFAQTAVTQGKVTFDGELTTSTCSIKAGDEDKKVILPKISTVDLAKRGDTAGSTSFDITTTNCAADVNKVAAHFEMTNMDPDTGNLKNLLAGDTAAKNVVVQLVNSDGTGIRAGSTGRYYDVTGTGTGRGATMLYGGQYFATGQTTAGKVNTFARFTLAYQ
>NZ_CP013414.1|WP_042586571.1|3863280_3864426_+|homoserine-O-acetyltransferase
MESIGIVAPQTMHFAEPLRLQSGSVIGNYQLVVETYGELNAARSNAVLVCHALNASHHVAGVYADDPRSTGWWDNMVGPGKPLDTNRFFVIGVNNLGSCFGSTGPMSIDPSTGQPYGARFPVVTVEDWVHAQARVADAFGIERFAAVMGGSLGGMQALAWSLMYPERVAHCIDIASTPKLSAQNIAFNEVARSAILSDPDFHGGDYYAHGVKPKRGLRVARMIGHITYLSDDDMAEKFGRALRRADGALDAYNFSFDVEFEVESYLRYQGDKFADYFDANTYLLITRALDYFDPAKAFDGNLTAALAHTKAKYLIASFSTDWRFAPARSREIVKALLDNKRTVSYAEIDAPHGHDAFLLDDARYHNLIRAYYERIANEVGA
>NZ_CP013414.1|WP_042586572.1|3864422_3865031_+|methionine-biosynthesis-protein-MetW
MNQQALNSLSARADFRTIARWVEPRSTVLDLGCGDGSLLSLLTEELDVSGYGIELNDAGVLASAKNGINVIQQNLEDGLRLFEDHSFDIAILSQTLQTIHQTAAILRETARVGRECIVSFPNFGYWAHRLSVLRGRMPVSKSLPYQWHNTPNVRVLTIKDFEALAPEVGVTILDRVVLHEGQPIRWGANWRGSLAVYRVKRS
>NZ_CP013414.1|WP_059749758.1|3865156_3866578_+|AmpG-family-muropeptide-MFS-transporter
MSKTPHEAPALTAHEDHPGWRAFLNTHMLICVFLGFTSGLPLFTLVYLVQAWLRSEGVNLKEIGLFALIQFPYTWKFLWAPLMDRYLPRLPGWRPGRRRGWMLLTQLLVAGAIAALGFVSPRDSIWTVAALTTLVAFFGASADIVIDAYRRELLRDTEQGLGNAVHVNAYKLAALIPGSLALILSDHLPWDVVFAITGAFMLPGIVMTLLVREPEVVGAPPRNLRDAIVLPFREFIERDGWAGALLVIAFIFLFKIGDTMATTLSTSFFLDIGFSRTEIGIVAKTTALVASVAGGIIGGVWLVKIGIGRGLWIFGALQMVSTLGFAWLAQVGPGSAVLATLYDFTVAASHAIASVMSVVGIEVTPQLSPMTVALALVYGFETFTTGLTMAAFVAYIASTTDPRYTATQFALFTSLASVPRTLASAASGFIVAKTGWFDYFLLCTVLAIPGMMLLFKIAPWRGDARNGEAPRVQ
>NZ_CP013414.1|WP_059749838.1|3866567_3867599_+|M48-family-metallopeptidase
MSNDRLRRTYRIARLAASLSVGIAALGAHAGDTGSAAAPGSAPPATPAPSSNPSATAEPAQPTGAAASAKAYTPTPQQVRFGNAVAFRTLIPSPLLEQLTANEYAQIVQAAAQNNRLLPANQPRVKRLRAIVAKLAPYSVKWNDRVKTWAWDVNAIRSRDIRVSCLPGGKILVYGGLLDRVRLNDDELGVLLAHGIAHALREHARSSFSDTSQTSLRAAALPPLFGVGDPLPQPLNLDERLQTLRYDPTDETEADVIGGDIAARAGFDPRAAITLWDKLAAATRANRESGFIYTHPYDAARRQDLLNRLPDLLPLYAKAMAKRVDALPDYAGISAQRRKVSRR
>NZ_CP013414.1|WP_059749757.1|3867658_3868636_-|AraC-family-transcriptional-regulator
MSFQPLFADAGDHVQRRMIDLLAHLAPNEGFTHADMEGVHFIRANRPVPRMPVLYEPSIVVVCQGRKHGYLGDQSFIYDAQQYLVLSVPLPFECETFASENEPFLAISIRVDLAVIAELAILLDETRGVAVSEPRGVYSTPLDAPLADAVLRLLEALASPHDTRVLGPSIMREIAYRVLTGAQGDAIRAALVQQHQFGRIAKALRRIHADLTGDLDVDTLAREAGMSVAVFHAQFKSVTATSPMQYVKTTRLHQARLMMVQDGIGAGAAAARVGYASASQFSREFKRLFGRSPGDEVRWMREMGSRTIGGGAVIDYWTDEREVGA
>NZ_CP013414.1|WP_010090334.1|3868850_3869903_+|NAD(P)-dependent-alcohol-dehydrogenase
MSTTYAFAATDAQSPLAPFEFQPRALRDLDVQIEILYCGVCHSDLHQARNEWRNTIYPVVPGHEIVGRVSATGPQVSRFKVGELVGVGCLVDSCRTCPSCAEGLEQYCENGFVGTYNGRDRVSGDVTYGGYSTQIVVDEAFVLRVPDTLDPAGAAPLLCAGITTYSPLRQWNVGPGKKVGIVGLGGLGHMGVKLARAMGAQVVLFTTSPSKVEDGKRLGAHEVVISKDEAQMSAHLNSFDFILNTVAAQHDLNPFLHLLKRDGTMTLVGAPEHDHPSPQVFNLIFKRRRLAGSLIGGIAETQEMLDFCAEHGITSDIETIPMQQINAAYERMLKSDVKYRFVIDMASIKA
>NZ_CP013414.1|WP_059749756.1|3870019_3870790_-|exodeoxyribonuclease-III
MMRVITANLNGIRSAAKKGFFEWLGEQNADCVCVQEIKVSADDLPAEFLEPHGLRSYFHHAEKKGYSGAGLYSRHEPDDVIIGFGSSEFDSEGRYVEARYGKLSVVSVYVPSGSSGDERQQAKYRFMDEFMPHLAELKKKREVILCGDVNIVHKEIDIKNWKSNQKNSGCLPEERAWLTQLFDDVGYVDVFRTLDPRPEQYTWWSNRGQAYAKNVGWRIDYQIATPGVAGTAKSTSIFKDIKFSDHAPLTVDYDYK
>NZ_CP013414.1|WP_059611938.1|3870832_3871672_-|polyphosphate-kinase-2-family-protein
MAKQPSLDDYRVPYHTREKDAAAFSLGAYDPSAKPFSSGAKETDRERLSAVSMELDVQQERLHTQQKKRVLLVLQGMDTSGKDGTVRAVFREVDPLGLRVVSFKAPTPLEAAHDFLWRVHAQVPAAGELAIFNRSHYEDVLVPRVLGAIDEKECERRYRQIRDFETMLVENGTTVVKCFLHISKDEQRDRLQARIDDPVKHWKFDISDLDARKHWDAYQDAYRDALAATSAEHAPWYVIPANSKTHRNVMIAELLLRTLTDMKLEFPPAKPELEGVKIR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

167400 : 249585

Burkholderia_phage(65.71%)

tail,transposase,holin,plate,integrase

attL 211594:211613|attR 224182:224201

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059757018.1\|167400_168207_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_059760425.1\|168617_169748_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_059759685.1\|170598_172107_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	7.1e-32	30.8
WP_059759687.1\|172147_173800_-	isovaleryl-CoA dehydrogenase	NA	NA	NA	NA
WP_059759690.1\|173854_174532_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_059759692.1\|174757_175912_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_059609443.1\|175942_176725_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_059759694.1\|176738_178157_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_059759696.1\|178197_178764_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_059759699.1\|178839_179271_-	Cd(II)/Pb(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_059759702.1\|179352_181821_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	6.4e-131	45.9
WP_059759704.1\|181852_182176_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_059759706.1\|182274_183141_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_059759709.1\|183425_184886_+	mechanosensitive ion channel	NA	NA	NA	NA
WP_059658326.1\|185092_186505_+	ethanolamine permease	NA	NA	NA	NA
WP_059609435.1\|186587_187985_+	ethanolamine ammonia-lyase subunit EutB	NA	NA	NA	NA
WP_059759712.1\|187981_188773_+	ethanolamine ammonia-lyase subunit EutC	NA	NA	NA	NA
WP_080410208.1\|189220_192757_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_155122333.1\|192746_194177_+	hypothetical protein	NA	NA	NA	NA
WP_059759720.1\|194178_194466_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_059759721.1\|194487_195927_+	hypothetical protein	NA	NA	NA	NA
WP_059759723.1\|195933_196374_+	hypothetical protein	NA	NA	NA	NA
WP_059759725.1\|196404_197289_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_059759726.1\|197437_198973_+	MFS transporter	NA	NA	NA	NA
WP_059759727.1\|199202_199670_+	hypothetical protein	NA	NA	NA	NA
WP_059759729.1\|199880_201407_+	aldehyde dehydrogenase	NA	NA	NA	NA
WP_059759733.1\|201840_202872_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_059759735.1\|202896_203946_-	hypothetical protein	NA	NA	NA	NA
WP_059759737.1\|203962_205666_-	thiamine pyrophosphate-binding protein	NA	NA	NA	NA
WP_059759739.1\|206225_207614_-	L-serine ammonia-lyase	NA	NA	NA	NA
WP_059759848.1\|207641_208784_-	alginate lyase family protein	NA	NA	NA	NA
WP_059759741.1\|208933_211861_-	aminomethyl-transferring glycine dehydrogenase	M4QFZ1	Prochlorococcus_phage	3.1e-257	51.3
211594:211613	attL	NA	NA	NA	NA
WP_059759743.1\|211933_212314_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_059759745.1\|212410_213529_-	glycine cleavage system aminomethyltransferase GcvT	NA	NA	NA	NA
WP_059609549.1\|213996_214386_-	hypothetical protein	NA	NA	NA	NA
WP_059759747.1\|214534_215587_-	oxidoreductase	NA	NA	NA	NA
WP_059759749.1\|216095_218186_+	AAA family ATPase	A7KV33	Bacillus_phage	9.9e-101	35.8
WP_059631748.1\|218273_219164_-	cytochrome c5 family protein	NA	NA	NA	NA
WP_059759751.1\|219543_220620_-\|integrase	site-specific integrase	A0A1S5NNJ1	Burkholderia_phage	1.9e-172	85.2
WP_080410209.1\|220487_220928_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_080410210.1\|220937_221321_-	hypothetical protein	NA	NA	NA	NA
WP_059759753.1\|221317_224110_-	hypothetical protein	E5E3N5	Burkholderia_phage	0.0e+00	92.9
WP_059759755.1\|224113_224377_-	hypothetical protein	E5E3N6	Burkholderia_phage	1.7e-18	66.3
224182:224201	attR	NA	NA	NA	NA
WP_010095912.1\|224581_224830_-	ogr/Delta-like zinc finger family protein	K4PAZ0	Burkholderia_phage	5.9e-37	91.5
WP_010095910.1\|224954_225170_-	hypothetical protein	E5E3U1	Burkholderia_phage	2.0e-20	81.4
WP_155122334.1\|225296_225752_+	transcriptional regulator	E5E3U2	Burkholderia_phage	1.4e-44	63.6
WP_059759757.1\|226122_226419_+	hypothetical protein	E5E3U3	Burkholderia_phage	1.6e-12	50.5
WP_059759760.1\|226550_227630_-	phage late control D family protein	K4PAY4	Burkholderia_phage	8.7e-133	71.8
WP_059759762.1\|227626_228082_-\|tail	phage tail protein	K4NXK5	Burkholderia_phage	6.8e-39	62.0
WP_059759764.1\|228111_230664_-	hypothetical protein	A4JWS3	Burkholderia_virus	2.5e-154	47.2
WP_076481858.1\|230679_230793_-\|tail	GpE family phage tail protein	E5E3U7	Burkholderia_phage	4.0e-09	75.7
WP_059759766.1\|230801_231185_-\|tail	phage tail assembly protein	K4NXA3	Burkholderia_phage	1.7e-27	68.0
WP_010095894.1\|231255_231759_-\|tail	phage major tail tube protein	E5E3U9	Burkholderia_phage	4.8e-70	74.3
WP_059759768.1\|231793_232966_-\|tail	phage tail sheath protein	A4JWS7	Burkholderia_virus	1.2e-188	83.3
WP_059759771.1\|233048_233885_-\|tail	phage tail protein	E5E3Q6	Burkholderia_phage	8.0e-94	62.0
WP_059759773.1\|233899_236197_-	hypothetical protein	E5E3V2	Burkholderia_phage	2.8e-274	63.9
WP_059759776.1\|236203_236746_-\|tail	phage tail protein I	E5FFH2	Burkholderia_phage	1.2e-71	72.6
WP_059759779.1\|236738_237653_-\|plate	baseplate assembly protein	E5FFH3	Burkholderia_phage	6.4e-121	73.9
WP_059759781.1\|237649_238012_-\|plate	baseplate assembly protein	K4PAX6	Burkholderia_phage	7.1e-39	66.7
WP_059631727.1\|238008_238692_-\|plate	phage baseplate assembly protein V	K4NXJ5	Burkholderia_phage	7.5e-82	70.0
WP_059759784.1\|239298_239742_-\|tail	phage tail protein	A0A291LAV4	Bordetella_phage	1.8e-23	45.7
WP_059759786.1\|239752_240817_-	hypothetical protein	A4JWL8	Burkholderia_virus	5.9e-57	45.3
WP_059759788.1\|240813_241380_-\|tail	phage tail protein I	A4JWL7	Burkholderia_virus	1.3e-39	57.3
WP_059759791.1\|241372_242284_-\|plate	baseplate assembly protein	E5FFH3	Burkholderia_phage	1.5e-74	50.2
WP_059759793.1\|242280_242736_-\|tail	phage tail protein	E5E3V9	Burkholderia_phage	5.2e-31	55.0
WP_080410211.1\|242852_243293_-	protein lysB	E5E3W1	Burkholderia_phage	5.8e-19	45.2
WP_059759800.1\|243289_244123_-	DUF3380 domain-containing protein	A4JWZ0	Burkholderia_virus	5.0e-96	67.4
WP_045566864.1\|244126_244393_-\|holin	phage holin family protein	E5E3W3	Burkholderia_phage	1.6e-24	66.3
WP_010095861.1\|244394_244739_-	membrane protein	A4JWU2	Burkholderia_virus	6.7e-39	79.6
WP_059759802.1\|244754_244961_-\|tail	phage tail protein	E5E3W5	Burkholderia_phage	7.1e-20	70.6
WP_059609547.1\|245367_245838_-	DUF523 domain-containing protein	NA	NA	NA	NA
WP_059759852.1\|246029_247604_+	TIGR04222 domain-containing membrane protein	NA	NA	NA	NA
WP_059759804.1\|247902_249585_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	5.3e-20	28.7

DBSCAN-SWA_2

334831 : 396294

Stx2-converting_phage(28.57%)

transposase,integrase

attL 334785:334844|attR 373765:374631

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
334785:334844	attL	NA	NA	NA	NA
WP_059757018.1\|334831_335638_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_080409939.1\|335694_336156_-	hypothetical protein	NA	NA	NA	NA
WP_059750528.1\|336145_337348_-	ThiF family adenylyltransferase	NA	NA	NA	NA
WP_059750527.1\|337322_337580_-	hypothetical protein	NA	NA	NA	NA
WP_080409938.1\|337708_338545_+	TIGR04255 family protein	NA	NA	NA	NA
WP_080409937.1\|338541_339225_+	hypothetical protein	NA	NA	NA	NA
WP_059750526.1\|339221_339917_+	AAA family ATPase	NA	NA	NA	NA
WP_059750503.1\|340307_341903_-\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	6.8e-134	57.1
WP_059726816.1\|341933_342278_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	1.1e-41	73.8
WP_059751474.1\|342774_343593_-	hypothetical protein	NA	NA	NA	NA
WP_059751472.1\|343922_344981_-\|integrase	integrase	W6MYA3	Pseudomonas_phage	1.3e-56	43.1
WP_059751471.1\|345512_345779_+	hypothetical protein	NA	NA	NA	NA
WP_059751469.1\|345763_346150_+	hypothetical protein	NA	NA	NA	NA
WP_059751476.1\|346192_347611_-	glucarate dehydratase	NA	NA	NA	NA
WP_059751467.1\|347667_349008_-	MFS transporter	NA	NA	NA	NA
WP_059751466.1\|349161_350067_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_059751464.1\|350173_350896_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_059751462.1\|350908_352075_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_059751460.1\|352083_353238_-	ABC transporter permease	NA	NA	NA	NA
WP_059751459.1\|353259_353970_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.6e-34	39.7
WP_059751457.1\|353971_355180_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_059751455.1\|355491_355725_+	hypothetical protein	NA	NA	NA	NA
WP_059751453.1\|355809_356553_-	Mut7-C ubiquitin/RNAse domain-containing protein	NA	NA	NA	NA
WP_059751451.1\|356647_357517_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_059614850.1\|357596_358238_+	LysE family translocator	NA	NA	NA	NA
WP_059751449.1\|358304_359597_-	MFS transporter	NA	NA	NA	NA
WP_059751447.1\|359690_360617_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_059751445.1\|360776_361613_-	OmpW family protein	NA	NA	NA	NA
WP_059751443.1\|361631_362873_-	DUF2957 domain-containing protein	NA	NA	NA	NA
WP_059751441.1\|363021_364440_-	DUF2957 domain-containing protein	NA	NA	NA	NA
WP_059751439.1\|364870_365821_-	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_059751437.1\|365966_366539_-	flavodoxin family protein	NA	NA	NA	NA
WP_059751435.1\|366699_367296_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_059751433.1\|367520_368207_-	orotate phosphoribosyltransferase	S4W4D9	Pandoravirus	1.4e-14	28.2
WP_059751431.1\|368674_370945_+	NADP-dependent malic enzyme	NA	NA	NA	NA
WP_155122338.1\|371188_372964_+	hypothetical protein	NA	NA	NA	NA
WP_059757018.1\|372970_373777_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_059749364.1\|373929_377517_-	indolepyruvate ferredoxin oxidoreductase family protein	NA	NA	NA	NA
373765:374631	attR	NA	NA	NA	NA
WP_059658273.1\|377835_378030_+	hypothetical protein	NA	NA	NA	NA
WP_045566820.1\|378160_379258_-	4-hydroxyphenylpyruvate dioxygenase	NA	NA	NA	NA
WP_059749363.1\|379411_379936_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_059749362.1\|380002_380650_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_042586829.1\|380883_381489_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_059749361.1\|381504_382314_-	DUF1835 domain-containing protein	NA	NA	NA	NA
WP_059749360.1\|382463_383552_-	phenylacetate-CoA oxygenase/reductase subunit PaaK	NA	NA	NA	NA
WP_059593248.1\|383553_384111_-	phenylacetate-CoA oxygenase subunit PaaJ	NA	NA	NA	NA
WP_059749359.1\|384136_384940_-	phenylacetate-CoA oxygenase subunit PaaC	NA	NA	NA	NA
WP_010092957.1\|384950_385235_-	1,2-phenylacetyl-CoA epoxidase subunit B	NA	NA	NA	NA
WP_059609306.1\|385270_386269_-	1,2-phenylacetyl-CoA epoxidase subunit A	NA	NA	NA	NA
WP_059749358.1\|386470_387730_+	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_063801159.1\|393894_394371_+\|transposase	transposase	NA	NA	NA	NA
WP_034190888.1\|394346_394697_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	2.5e-17	39.4
WP_069240679.1\|394728_396294_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	4.4e-69	34.4

DBSCAN-SWA_3

1115326 : 1124705

Bacillus_virus(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059749549.1\|1115326_1116637_+	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.6e-80	40.0
WP_059749550.1\|1116659_1116926_-	DUF2164 domain-containing protein	NA	NA	NA	NA
WP_059731386.1\|1117098_1118400_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.3e-94	52.3
WP_059749551.1\|1119033_1121820_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	4.1e-41	25.3
WP_059617943.1\|1121827_1123534_+	peptidoglycan DD-metalloendopeptidase family protein	D6QWN8	uncultured_phage	1.0e-10	30.9
WP_080409862.1\|1123551_1124355_+	hypothetical protein	A0A2I6UFG0	Klebsiella_phage	1.3e-05	32.4
WP_059749552.1\|1124423_1124705_+	PAAR domain-containing protein	A4PE23	Ralstonia_virus	9.5e-07	39.8

DBSCAN-SWA_4

1806704 : 1834641

Burkholderia_phage(27.27%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059757974.1\|1806704_1807670_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.0e-28	37.1
WP_006400187.1\|1807725_1807941_+	transporter	NA	NA	NA	NA
WP_042583946.1\|1808081_1808279_+	hypothetical protein	NA	NA	NA	NA
WP_059757977.1\|1808318_1808573_+	hypothetical protein	NA	NA	NA	NA
WP_059757979.1\|1808848_1809109_-	Pyocin activator protein PrtN	I6NSR8	Burkholderia_phage	1.6e-29	73.2
WP_059757981.1\|1809105_1809792_-	hypothetical protein	Q5QF30	Pseudomonas_virus	3.1e-35	42.9
WP_059757984.1\|1809788_1810031_-	hypothetical protein	NA	NA	NA	NA
WP_059757987.1\|1810027_1810516_-	DUF1643 domain-containing protein	B5WZV8	Pseudomonas_phage	4.1e-42	52.5
WP_155122368.1\|1810512_1811301_-	hypothetical protein	A0A291LAU4	Bordetella_phage	5.3e-71	55.2
WP_155122369.1\|1811287_1812805_-	hypothetical protein	A1YZU8	Burkholderia_virus	2.2e-17	53.9
WP_059757995.1\|1812819_1814496_-	DNA methyltransferase	H9C171	Pectobacterium_phage	1.8e-140	43.9
WP_155122370.1\|1814594_1815254_-	hypothetical protein	NA	NA	NA	NA
WP_059758002.1\|1815287_1815719_-	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_059758005.1\|1815744_1816155_-	hypothetical protein	NA	NA	NA	NA
WP_059758008.1\|1816156_1816351_-	hypothetical protein	A9YX20	Burkholderia_phage	5.7e-19	82.1
WP_059758506.1\|1816347_1816821_-	hypothetical protein	A9YX19	Burkholderia_phage	1.9e-52	67.4
WP_059758011.1\|1816826_1817279_-	HNH endonuclease	A0A1Z1LW18	Escherichia_phage	5.8e-22	43.0
WP_059758013.1\|1817281_1817770_-	DUF1566 domain-containing protein	NA	NA	NA	NA
WP_059758016.1\|1817800_1818166_-	DUF1566 domain-containing protein	NA	NA	NA	NA
WP_059758019.1\|1818263_1818926_-	hypothetical protein	NA	NA	NA	NA
WP_059758022.1\|1818952_1820554_-	endonuclease	A0A2H4J6P1	uncultured_Caudovirales_phage	1.7e-92	46.6
WP_059758026.1\|1820546_1821452_-	ERF family protein	B5WZW4	Pseudomonas_phage	1.6e-55	68.6
WP_155122371.1\|1821466_1821634_-	hypothetical protein	NA	NA	NA	NA
WP_155122372.1\|1821630_1822080_-	HNH endonuclease	W6PP19	Citrobacter_phage	2.7e-19	38.5
WP_059758038.1\|1822390_1822705_-	hypothetical protein	NA	NA	NA	NA
WP_059758042.1\|1823120_1823405_-	KTSC domain-containing protein	A9YWW2	Burkholderia_phage	2.0e-20	58.3
WP_080410181.1\|1823461_1823698_-	acyl carrier protein	B2ZXV3	Ralstonia_phage	1.9e-08	40.3
WP_155122373.1\|1823739_1823910_-	hypothetical protein	NA	NA	NA	NA
WP_155122374.1\|1824047_1824221_-	hypothetical protein	NA	NA	NA	NA
WP_155122375.1\|1824238_1824412_-	hypothetical protein	NA	NA	NA	NA
WP_059758049.1\|1824795_1825488_-	hypothetical protein	NA	NA	NA	NA
WP_080410162.1\|1825509_1826385_-	helix-turn-helix transcriptional regulator	A0A139ZPI7	Marinitoga_camini_virus	1.5e-05	24.9
WP_080410163.1\|1826383_1826584_+	hypothetical protein	NA	NA	NA	NA
WP_059758064.1\|1826822_1827083_+	hypothetical protein	NA	NA	NA	NA
WP_155122376.1\|1827306_1827525_+	hypothetical protein	NA	NA	NA	NA
WP_059758072.1\|1827521_1827944_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_080410164.1\|1827723_1829007_+	replication protein	I6PDJ3	Cronobacter_phage	3.7e-13	47.4
WP_059758080.1\|1829003_1829273_+	hypothetical protein	NA	NA	NA	NA
WP_059758084.1\|1829269_1829749_+	adenine methyltransferase	Q3HQW3	Burkholderia_phage	1.1e-82	85.4
WP_059758088.1\|1829745_1831140_+	replicative DNA helicase	C7BGG1	Burkholderia_phage	1.4e-90	46.5
WP_088510644.1\|1831084_1831648_+	hypothetical protein	S5YLC4	Mycobacterium_phage	7.0e-17	32.9
WP_063801222.1\|1831644_1832103_+	hypothetical protein	K4ICN3	Acidithiobacillus_phage	4.2e-28	46.3
WP_155122377.1\|1832099_1832714_+	hypothetical protein	NA	NA	NA	NA
WP_059758091.1\|1832722_1833013_+	hypothetical protein	NA	NA	NA	NA
WP_059758093.1\|1833009_1833273_+	hypothetical protein	NA	NA	NA	NA
WP_059758096.1\|1833269_1833509_+	hypothetical protein	NA	NA	NA	NA
WP_155122378.1\|1833505_1833700_+	hypothetical protein	NA	NA	NA	NA
WP_080410165.1\|1833752_1834049_+	hypothetical protein	NA	NA	NA	NA
WP_080410166.1\|1834041_1834641_+	hypothetical protein	U5PWK7	Bacillus_phage	3.0e-26	53.1

DBSCAN-SWA_5

1850439 : 1862343

Ralstonia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059758170.1\|1850439_1853487_+	hypothetical protein	L7P7M2	Pseudomonas_phage	4.0e-10	22.7
WP_080410168.1\|1853488_1854403_+	hypothetical protein	NA	NA	NA	NA
WP_059758177.1\|1854399_1855494_+	DUF2163 domain-containing protein	A0A0B5A5B8	Paracoccus_phage	6.1e-25	39.1
WP_059758180.1\|1855495_1855900_+	hypothetical protein	A0A1W6DXC5	Sphingobium_phage	9.1e-19	41.2
WP_059758183.1\|1855901_1859102_+	hypothetical protein	K4K665	Caulobacter_phage	7.2e-50	23.1
WP_059758187.1\|1859104_1860868_+	hypothetical protein	B2ZY69	Ralstonia_phage	1.3e-05	43.5
WP_059758190.1\|1860948_1861314_+	hypothetical protein	NA	NA	NA	NA
WP_059758193.1\|1861315_1861702_+	hypothetical protein	NA	NA	NA	NA
WP_059758196.1\|1861692_1862343_+	glycoside hydrolase family 19 protein	A0A0X8WP64	Ralstonia_phage	1.4e-29	37.7

DBSCAN-SWA_6

2177108 : 2270240

uncultured_Caudovirales_phage(21.95%)

protease,tail,transposase,holin,plate,portal,integrase,terminase,capsid,head

attL 2166460:2166477|attR 2253260:2253277

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2166460:2166477	attL	NA	NA	NA	NA
WP_059627200.1\|2177108_2178131_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	3.4e-38	31.8
WP_059761210.1\|2179113_2180469_+\|transposase	IS110 family transposase	Q9JMN8	Wolbachia_phage	2.0e-110	46.5
WP_059752403.1\|2181946_2183539_-	ABC-F family ATPase	A0A2K9L0W2	Tupanvirus	6.9e-54	27.3
WP_059752398.1\|2183705_2185970_-	AsmA family protein	NA	NA	NA	NA
WP_059752393.1\|2186132_2186831_+	ATP-binding cassette domain-containing protein	A0A1V0SE00	Indivirus	9.0e-06	24.2
WP_059752389.1\|2186827_2187631_+	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_059752384.1\|2187648_2188119_-	hypothetical protein	NA	NA	NA	NA
WP_059752380.1\|2188349_2188901_-	hypothetical protein	NA	NA	NA	NA
WP_059752411.1\|2189058_2190075_-	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_059752376.1\|2190200_2191166_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_059752373.1\|2191393_2192239_+	phosphoserine phosphatase SerB	NA	NA	NA	NA
WP_059752369.1\|2192309_2193506_-	cystathionine beta-lyase	NA	NA	NA	NA
WP_059752365.1\|2193620_2194199_-	hypothetical protein	NA	NA	NA	NA
WP_059752362.1\|2194218_2195409_-	acetyl-CoA C-acyltransferase family protein	NA	NA	NA	NA
WP_059752358.1\|2195474_2196401_-	sugar kinase	NA	NA	NA	NA
WP_059752355.1\|2196404_2197778_-	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
WP_059752407.1\|2197793_2199446_+\|integrase	integrase	Q3HQV4	Burkholderia_phage	7.9e-202	64.6
WP_080410015.1\|2199385_2200585_+	hypothetical protein	NA	NA	NA	NA
WP_080410014.1\|2200588_2201317_+	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_080410013.1\|2201690_2202104_-	DUF159 family protein	Q8W6R8	Burkholderia_virus	7.8e-58	72.8
WP_038799209.1\|2202174_2202717_+\|transposase	transposase	NA	NA	NA	NA
WP_059752349.1\|2202692_2203043_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	9.6e-17	39.4
WP_059752344.1\|2203074_2204640_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	9.8e-69	33.8
WP_059752337.1\|2204976_2205603_+	hypothetical protein	Q8W6R9	Burkholderia_virus	2.0e-44	47.8
WP_059752334.1\|2205693_2206104_+	PAAR domain-containing protein	Q8W6S2	Burkholderia_virus	4.0e-14	48.8
WP_059752329.1\|2206108_2206612_+	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	1.4e-21	43.9
WP_059752327.1\|2206604_2207078_+	hypothetical protein	NA	NA	NA	NA
WP_080410012.1\|2206959_2207568_+	hypothetical protein	NA	NA	NA	NA
WP_059752324.1\|2207580_2208291_+	LysR family transcriptional regulator	A4PE26	Ralstonia_virus	3.8e-36	38.1
WP_059752321.1\|2208330_2209119_-	DNA adenine methylase	Q8W6S4	Burkholderia_virus	4.7e-144	90.1
WP_059752318.1\|2209289_2209784_-	DUF2514 family protein	C7BGD9	Burkholderia_phage	5.1e-32	50.6
WP_059752316.1\|2209780_2210275_-	glycoside hydrolase family 104 protein	Q6J1Q5	Burkholderia_virus	5.3e-77	87.0
WP_059752314.1\|2210277_2210562_-\|holin	holin	C7BGD7	Burkholderia_phage	3.8e-40	92.6
WP_059752312.1\|2210636_2211689_-	late control protein	A0A2H4JBF6	uncultured_Caudovirales_phage	6.4e-80	46.8
WP_059752311.1\|2211698_2211905_-\|tail	phage tail protein	R9TR63	Vibrio_phage	1.6e-08	47.8
WP_059752309.1\|2211879_2212761_-\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	1.3e-33	38.3
WP_069240690.1\|2212772_2215217_-\|tail	phage tail tape measure protein	A0A2H4JG00	uncultured_Caudovirales_phage	1.4e-53	33.3
WP_059774786.1\|2215283_2215613_-\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_069240691.1\|2215697_2216201_-\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	5.1e-43	49.4
WP_069240692.1\|2216211_2217381_-\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	1.5e-162	74.0
WP_059751527.1\|2217461_2217917_-	hypothetical protein	NA	NA	NA	NA
WP_059751525.1\|2217934_2218996_-	hypothetical protein	A4JWL8	Burkholderia_virus	1.5e-57	47.3
WP_059751523.1\|2218992_2219559_-\|tail	phage tail protein I	A4JWL7	Burkholderia_virus	2.6e-35	47.6
WP_059751521.1\|2219548_2220442_-\|plate	baseplate J protein	D5LGZ3	Escherichia_phage	1.7e-49	38.8
WP_059751519.1\|2220438_2220783_-\|plate	phage baseplate protein	A0A2H4JA09	uncultured_Caudovirales_phage	1.9e-25	51.9
WP_059751517.1\|2220779_2220986_-	hypothetical protein	NA	NA	NA	NA
WP_059751515.1\|2221049_2221730_-\|plate	phage baseplate assembly protein V	NA	NA	NA	NA
WP_059751512.1\|2221726_2222254_-	hypothetical protein	Q9JML9	Wolbachia_phage	6.7e-22	37.1
WP_059751510.1\|2222246_2222774_-\|tail	phage tail protein	K7R9K2	Vibrio_phage	1.8e-19	30.2
WP_059751508.1\|2222779_2223070_-	hypothetical protein	NA	NA	NA	NA
WP_045567536.1\|2223071_2224067_-\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	4.6e-112	60.3
WP_059743317.1\|2224133_2224478_-\|head	head decoration protein	NA	NA	NA	NA
WP_059751506.1\|2224490_2225588_-\|protease	Clp protease ClpP	A0A2H4JDI2	uncultured_Caudovirales_phage	3.5e-49	37.2
WP_059751505.1\|2225584_2227075_-\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	2.8e-134	51.5
WP_059751503.1\|2227071_2227278_-	hypothetical protein	NA	NA	NA	NA
WP_059751501.1\|2227287_2229402_-\|terminase	phage terminase large subunit family protein	A0A2D1GMT1	Marinobacter_phage	2.7e-178	52.9
WP_155122387.1\|2229995_2230646_+	hypothetical protein	NA	NA	NA	NA
WP_059751533.1\|2230918_2231692_-	hypothetical protein	NA	NA	NA	NA
WP_059751497.1\|2231908_2234401_-	virulence protein E	A0A2D1GN57	Marinobacter_phage	3.2e-98	42.2
WP_059751531.1\|2234559_2234943_-	hypothetical protein	NA	NA	NA	NA
WP_059751496.1\|2234944_2235502_-	hypothetical protein	C7BGG0	Burkholderia_phage	2.1e-29	46.5
WP_080409988.1\|2235513_2235732_-	hypothetical protein	A0A2H4JCB6	uncultured_Caudovirales_phage	1.2e-09	56.7
WP_155122388.1\|2235730_2236357_+	hypothetical protein	NA	NA	NA	NA
WP_059751492.1\|2236671_2236890_+	hypothetical protein	NA	NA	NA	NA
WP_059751490.1\|2236941_2237304_+	hypothetical protein	NA	NA	NA	NA
WP_059751488.1\|2237300_2237900_+	hypothetical protein	NA	NA	NA	NA
WP_059751529.1\|2237899_2239330_+	hypothetical protein	A0A2I7QW51	Vibrio_phage	8.5e-11	30.0
WP_059751485.1\|2239431_2239782_+	hypothetical protein	NA	NA	NA	NA
WP_080409987.1\|2239795_2240029_+	hypothetical protein	A8YQQ5	Burkholderia_virus	4.9e-17	62.3
WP_155122389.1\|2240163_2240895_-	hypothetical protein	NA	NA	NA	NA
WP_080409986.1\|2240887_2242096_-	RNA-directed DNA polymerase	A0A0F7LDS3	Escherichia_phage	4.0e-94	45.7
WP_059751483.1\|2242793_2244494_+	dihydroxyacetone kinase subunit DhaK	NA	NA	NA	NA
WP_059751480.1\|2244763_2246128_+	insulinase family protein	NA	NA	NA	NA
WP_059751478.1\|2246124_2247471_+	insulinase family protein	NA	NA	NA	NA
WP_155122390.1\|2247601_2247919_-	hypothetical protein	NA	NA	NA	NA
WP_080400612.1\|2248879_2249119_+	hypothetical protein	NA	NA	NA	NA
WP_059611667.1\|2249669_2250233_-	polyhydroxyalkanoate synthesis repressor PhaR	NA	NA	NA	NA
WP_010092274.1\|2250353_2251094_-	3-ketoacyl-ACP reductase	NA	NA	NA	NA
WP_069240714.1\|2251199_2252381_-	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_059750758.1\|2252480_2254346_-	class I poly(R)-hydroxyalkanoic acid synthase	NA	NA	NA	NA
2253260:2253277	attR	NA	NA	NA	NA
WP_059750932.1\|2254711_2255551_-	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_059750760.1\|2255557_2256760_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_059750762.1\|2256801_2257626_+	outer membrane protein assembly factor BamD	NA	NA	NA	NA
WP_059750765.1\|2257695_2259942_-	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	2.2e-77	29.5
WP_010092269.1\|2259997_2260213_-	YdcH family protein	NA	NA	NA	NA
WP_059750767.1\|2260291_2261050_-	hypothetical protein	NA	NA	NA	NA
WP_059750770.1\|2261216_2263544_+	RNA-binding transcriptional accessory protein	NA	NA	NA	NA
WP_059750772.1\|2263635_2265555_-	potassium transporter Kup	A7J6G4	Paramecium_bursaria_Chlorella_virus	1.3e-78	32.7
WP_059750774.1\|2265809_2266400_-	phosphoribosyltransferase	NA	NA	NA	NA
WP_059750775.1\|2266406_2267753_-	adenylosuccinate synthase	A0A160ER07	Powai_lake_megavirus	9.0e-71	36.8
WP_059618057.1\|2267866_2269015_-	ATP phosphoribosyltransferase regulatory subunit	NA	NA	NA	NA
WP_010092260.1\|2269112_2269304_-	DUF2065 domain-containing protein	NA	NA	NA	NA
WP_059750776.1\|2269340_2270240_-\|protease	protease modulator HflC	NA	NA	NA	NA

DBSCAN-SWA_7

2359295 : 2432115

uncultured_Caudovirales_phage(25.71%)

protease,tail,holin,plate,portal,integrase,terminase,capsid,head

attL 2353237:2353255|attR 2370740:2370758

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2353237:2353255	attL	NA	NA	NA	NA
WP_059750902.1\|2359295_2360498_+\|integrase	tyrosine-type recombinase/integrase	A0A1B0VMI6	Pseudomonas_phage	4.7e-71	41.8
WP_155122391.1\|2360881_2361661_+	hypothetical protein	NA	NA	NA	NA
WP_080409962.1\|2361657_2362563_+	DUF3037 domain-containing protein	NA	NA	NA	NA
WP_155122392.1\|2362884_2363373_-	hypothetical protein	NA	NA	NA	NA
WP_059750906.1\|2363570_2364197_+	hypothetical protein	Q8W6R9	Burkholderia_virus	7.4e-44	47.3
WP_080401268.1\|2364221_2364545_-	hypothetical protein	A4PE26	Ralstonia_virus	4.7e-18	49.0
WP_063801163.1\|2364950_2365562_-	hypothetical protein	NA	NA	NA	NA
WP_059750909.1\|2365449_2365920_-	hypothetical protein	NA	NA	NA	NA
WP_059750911.1\|2365909_2366407_-	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	4.0e-16	36.0
WP_080409963.1\|2366413_2367058_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_059750915.1\|2367026_2367815_-	DNA adenine methylase	Q8W6S4	Burkholderia_virus	1.2e-144	90.8
WP_080409964.1\|2367985_2368480_-	DUF2514 family protein	C7BGD9	Burkholderia_phage	1.4e-37	57.6
WP_059750920.1\|2368476_2368968_-	glycoside hydrolase family 104 protein	Q6J1Q5	Burkholderia_virus	1.6e-78	90.7
WP_059529388.1\|2368970_2369255_-\|holin	holin	C7BGD7	Burkholderia_phage	6.6e-40	92.6
WP_059750922.1\|2369328_2370381_-	late control protein	A0A2H4JBF6	uncultured_Caudovirales_phage	1.1e-79	47.1
WP_059750925.1\|2370390_2370597_-\|tail	phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	2.8e-16	59.7
WP_059750928.1\|2370571_2371453_-\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	1.7e-33	38.7
2370740:2370758	attR	NA	NA	NA	NA
WP_069240693.1\|2371465_2373898_-\|tail	phage tail tape measure protein	A0A2H4JG00	uncultured_Caudovirales_phage	2.5e-55	33.6
WP_069240694.1\|2373964_2374294_-\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_069240695.1\|2374378_2374882_-\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	6.0e-44	50.0
WP_069240696.1\|2374892_2376062_-\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	8.7e-163	74.2
WP_059750533.1\|2376142_2376598_-\|tail	phage tail protein	NA	NA	NA	NA
WP_155122393.1\|2376616_2377687_-	hypothetical protein	A4JWL8	Burkholderia_virus	2.2e-56	43.2
WP_059750534.1\|2377683_2378250_-\|tail	phage tail protein I	A4JWL7	Burkholderia_virus	8.0e-37	50.6
WP_059750535.1\|2378239_2379133_-\|plate	baseplate J protein	D5LGZ3	Escherichia_phage	3.8e-49	38.4
WP_059643540.1\|2379129_2379474_-\|plate	phage baseplate protein	A0A2H4JA09	uncultured_Caudovirales_phage	1.9e-25	51.9
WP_059529352.1\|2379470_2379677_-	hypothetical protein	NA	NA	NA	NA
WP_059743320.1\|2379740_2380421_-\|plate	phage baseplate assembly protein V	NA	NA	NA	NA
WP_059750536.1\|2380417_2380945_-	hypothetical protein	Q9JML9	Wolbachia_phage	3.0e-22	37.9
WP_059750537.1\|2380937_2381465_-\|tail	phage tail protein	D4HTU8	Vibrio_phage	1.2e-18	29.2
WP_059750538.1\|2381470_2381761_-	hypothetical protein	NA	NA	NA	NA
WP_059750539.1\|2381762_2382758_-\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	8.3e-114	60.9
WP_059750540.1\|2382831_2383176_-\|head	head decoration protein	NA	NA	NA	NA
WP_059750541.1\|2383205_2384282_-\|protease	Clp protease ClpP	A0A2H4JDI2	uncultured_Caudovirales_phage	2.7e-49	37.6
WP_059750542.1\|2384278_2385769_-\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	1.7e-134	51.6
WP_059750543.1\|2385765_2385972_-	hypothetical protein	NA	NA	NA	NA
WP_059750544.1\|2385981_2388096_-\|terminase	phage terminase large subunit family protein	A0A2D1GMT1	Marinobacter_phage	2.4e-179	53.0
WP_155122394.1\|2388777_2389656_+	hypothetical protein	NA	NA	NA	NA
WP_059750545.1\|2389724_2390105_-	hypothetical protein	NA	NA	NA	NA
WP_059750546.1\|2390451_2391225_-	hypothetical protein	NA	NA	NA	NA
WP_059750547.1\|2391447_2393955_-	virulence protein E	A0A2D1GN57	Marinobacter_phage	3.0e-96	40.4
WP_155122395.1\|2394037_2394610_-	hypothetical protein	NA	NA	NA	NA
WP_059750549.1\|2394807_2395191_-	hypothetical protein	NA	NA	NA	NA
WP_155122396.1\|2395192_2395540_-	hypothetical protein	C7BGG0	Burkholderia_phage	2.3e-10	40.4
WP_155122397.1\|2395559_2395694_-	DUF1922 domain-containing protein	NA	NA	NA	NA
WP_088507965.1\|2395805_2395997_-	hypothetical protein	NA	NA	NA	NA
WP_080409945.1\|2396047_2396656_+	helix-turn-helix transcriptional regulator	G9L6A6	Escherichia_phage	4.0e-10	40.2
WP_155122398.1\|2396600_2397065_+	hypothetical protein	NA	NA	NA	NA
WP_059750554.1\|2397196_2397415_+	hypothetical protein	NA	NA	NA	NA
WP_080409941.1\|2397466_2397823_+	beta-hexosaminidase	NA	NA	NA	NA
WP_059750555.1\|2397870_2398419_+	hypothetical protein	NA	NA	NA	NA
WP_059750603.1\|2398418_2399849_+	hypothetical protein	A0A2I7QW51	Vibrio_phage	2.1e-09	27.9
WP_080409943.1\|2399845_2400292_+	hypothetical protein	NA	NA	NA	NA
WP_088510561.1\|2400357_2400513_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_155122399.1\|2400773_2401730_-	hypothetical protein	NA	NA	NA	NA
WP_059750558.1\|2402253_2402652_+	hypothetical protein	NA	NA	NA	NA
WP_059750559.1\|2402694_2404143_-	GGDEF domain-containing protein	NA	NA	NA	NA
WP_059750560.1\|2404469_2405648_-	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_059611660.1\|2405695_2406328_-	bifunctional nicotinamidase/pyrazinamidase	A0A2K9L2K0	Tupanvirus	5.2e-21	36.5
WP_059750561.1\|2406379_2408464_-	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
WP_059750562.1\|2408613_2410251_-	fatty-acid--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	5.9e-24	23.5
WP_059750563.1\|2410646_2412224_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	8.1e-55	32.0
WP_059611584.1\|2412262_2412694_+	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_059750564.1\|2412808_2413339_+	septation protein A	NA	NA	NA	NA
WP_059611586.1\|2413340_2413649_+	BolA family transcriptional regulator	NA	NA	NA	NA
WP_059750565.1\|2413670_2414450_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_059750566.1\|2414529_2415081_-	N-acetyltransferase	NA	NA	NA	NA
WP_059750567.1\|2415085_2419150_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	9.9e-222	92.4
WP_059750568.1\|2419390_2420695_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_059750569.1\|2420739_2422302_+	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
WP_059750570.1\|2422415_2424038_+	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_059527683.1\|2424086_2424800_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.9e-33	41.4
WP_059611600.1\|2424798_2425479_+	arylesterase	NA	NA	NA	NA
WP_059750571.1\|2425567_2427502_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_059618272.1\|2428220_2430644_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.6e-222	52.9
WP_010092138.1\|2430843_2432115_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.7e-133	58.5

DBSCAN-SWA_8

3815572 : 3851634

Erwinia_phage(20.0%)

plate,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042586564.1\|3815572_3816109_+\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_059611865.1\|3816119_3817463_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A191ZC11	Erwinia_phage	3.0e-42	29.6
WP_155122424.1\|3817682_3818060_+	hypothetical protein	NA	NA	NA	NA
WP_059749840.1\|3818967_3819408_+	hypothetical protein	NA	NA	NA	NA
WP_059611872.1\|3819633_3820176_-	response regulator transcription factor	NA	NA	NA	NA
WP_059749783.1\|3820210_3821584_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_059749782.1\|3821672_3821897_-	cysteine-rich CWC family protein	NA	NA	NA	NA
WP_010090348.1\|3822215_3823115_+	acetylglutamate kinase	NA	NA	NA	NA
WP_059749781.1\|3823111_3823903_+	pyrimidine 5'-nucleotidase	NA	NA	NA	NA
WP_059749780.1\|3823869_3824550_+	nucleoid occlusion factor SlmA	NA	NA	NA	NA
WP_059749779.1\|3824591_3827264_-	type VI secretion system ATPase TssH	A0A248SJW6	Salicola_phage	2.5e-72	30.8
WP_080409882.1\|3827751_3828777_+	TagK domain-containing protein	NA	NA	NA	NA
WP_059749777.1\|3828757_3829618_+	ImpE protein superfamily protein	NA	NA	NA	NA
WP_059749776.1\|3829601_3830123_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_059749775.1\|3830124_3832005_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_059749774.1\|3832008_3833070_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_059749773.1\|3833066_3834125_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_059749772.1\|3834175_3835207_+	fimbrial protein	NA	NA	NA	NA
WP_059749771.1\|3835237_3836590_+	hypothetical protein	A0A292GJ55	Xanthomonas_phage	1.1e-108	45.5
WP_059749770.1\|3836642_3840095_-	RHS repeat protein	A0A2H4JHK7	uncultured_Caudovirales_phage	1.0e-17	44.3
WP_076480801.1\|3840106_3840373_-	hypothetical protein	NA	NA	NA	NA
WP_080409881.1\|3840460_3843619_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	2.4e-37	26.8
WP_059749769.1\|3843719_3844283_-	hypothetical protein	NA	NA	NA	NA
WP_059749768.1\|3844263_3845064_-	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_059749767.1\|3845060_3848969_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_059749766.1\|3848983_3850288_-	type VI secretion system protein TssL	NA	NA	NA	NA
WP_059611907.1\|3850284_3851634_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP013415

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 2188

Rhizobium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069240717.1\|354_735_+	hypothetical protein	R9TN97	Rhizobium_phage	7.7e-20	68.6
WP_059673161.1\|737_1091_+	hypothetical protein	NA	NA	NA	NA
WP_080410100.1\|1087_2188_+	phage Gp37/Gp68 family protein	Q6JIJ3	Burkholderia_virus	3.6e-78	47.8

DBSCAN-SWA_2

18039 : 18672

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080410102.1\|18039_18672_-	DUF159 family protein	Q8W6R8	Burkholderia_virus	1.7e-80	71.1

DBSCAN-SWA_3

23850 : 26591

Escherichia_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059714374.1\|23850_24546_-	ParA family protein	A0A0M3ULE3	Mycobacterium_phage	3.1e-14	32.8
WP_059673144.1\|26001_26271_+	type II toxin-antitoxin system ParD family antitoxin	A0A0N7C055	Escherichia_phage	5.3e-15	57.1
WP_059755323.1\|26276_26591_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A2R2Z2Y1	Escherichia_phage	8.1e-15	38.8

DBSCAN-SWA_4

31937 : 125763

Stx2-converting_phage(13.33%)

protease,transposase,integrase

attL 35164:35180|attR 117739:117755

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088506841.1\|31937_33118_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.8e-60	42.1
WP_080410104.1\|34427_35645_-	porin	NA	NA	NA	NA
35164:35180	attL	NA	NA	NA	NA
WP_059755228.1\|35892_36597_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_059755231.1\|36602_37877_-	glucarate dehydratase	NA	NA	NA	NA
WP_063801202.1\|38323_39616_+	carbohydrate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_059755233.1\|39692_40670_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_059755236.1\|40669_41722_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_059755238.1\|41742_42792_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G3M9Y6	Bacillus_virus	1.4e-23	31.9
WP_059755242.1\|42788_44915_+	hypothetical protein	NA	NA	NA	NA
WP_059755245.1\|45024_45882_+	NAD(P)-dependent oxidoreductase	A0A1V0SKV4	Klosneuvirus	2.9e-06	28.1
WP_063801207.1\|45907_46870_+	aldose 1-epimerase	NA	NA	NA	NA
WP_059755251.1\|49589_50255_-	hypothetical protein	NA	NA	NA	NA
WP_080410105.1\|50327_50912_-	DUF945 domain-containing protein	A0A2C9CYF8	Yersinia_phage	6.1e-24	38.6
WP_059755254.1\|51002_52292_-\|integrase	tyrosine-type recombinase/integrase	G8I6R6	Mycobacterium_virus	1.1e-06	26.3
WP_059755260.1\|52402_53440_+	DNA-binding protein	NA	NA	NA	NA
WP_155122428.1\|53492_54230_+	hypothetical protein	NA	NA	NA	NA
WP_155122429.1\|54302_54791_+	hypothetical protein	NA	NA	NA	NA
WP_059755266.1\|56219_56798_+	DUF4337 domain-containing protein	NA	NA	NA	NA
WP_088510507.1\|57295_58416_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.4e-45	40.9
WP_059750474.1\|59080_59830_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	5.9e-80	60.4
WP_069240720.1\|62650_62920_+	flagellar biosynthetic protein FliQ	NA	NA	NA	NA
WP_063801150.1\|62920_63682_+	flagellar biosynthetic protein FliR	NA	NA	NA	NA
WP_080409928.1\|63678_64749_+	EscU/YscU/HrcU family type III secretion system export apparatus switch protein	NA	NA	NA	NA
WP_059750477.1\|64745_66779_+	FHIPEP family type III secretion protein	NA	NA	NA	NA
WP_080409929.1\|66838_67564_+	flagellar hook-basal body complex protein	NA	NA	NA	NA
WP_063801151.1\|67560_68346_+	flagellar hook-basal body protein	NA	NA	NA	NA
WP_080409930.1\|68354_69071_+	hypothetical protein	NA	NA	NA	NA
WP_080409931.1\|69067_69652_+	flagellar basal body L-ring protein FlgH	NA	NA	NA	NA
WP_088510555.1\|69633_70755_+	flagellar basal body P-ring protein FlgI	NA	NA	NA	NA
WP_059750480.1\|70760_71111_+	hypothetical protein	NA	NA	NA	NA
WP_059750481.1\|71111_71540_+	flagellar basal body rod protein FlgC	NA	NA	NA	NA
WP_088510557.1\|71548_71839_+	flagellar hook-basal body complex protein FliE	NA	NA	NA	NA
WP_059750483.1\|71847_73266_+	flagellar M-ring protein FliF	NA	NA	NA	NA
WP_155122430.1\|73258_73729_+	hypothetical protein	NA	NA	NA	NA
WP_155122431.1\|73683_74442_+	hypothetical protein	NA	NA	NA	NA
WP_063801152.1\|74438_75743_+	FliI/YscN family ATPase	NA	NA	NA	NA
WP_059750485.1\|75757_76204_+	hypothetical protein	NA	NA	NA	NA
WP_155122432.1\|76190_76898_+	hypothetical protein	NA	NA	NA	NA
WP_059750487.1\|76897_77296_+	flagellar hook capping protein	NA	NA	NA	NA
WP_063801153.1\|77305_78490_+	flagellar hook-basal body complex protein	NA	NA	NA	NA
WP_155122433.1\|78804_79578_+	hypothetical protein	NA	NA	NA	NA
WP_155122434.1\|79622_79964_+	hypothetical protein	NA	NA	NA	NA
WP_080409935.1\|80038_80752_+	flagellar type III secretion system pore protein FliP	NA	NA	NA	NA
WP_080409934.1\|80726_81491_+	sigma-70 family RNA polymerase sigma factor	A0A0Y0AU18	Bacillus_phage	2.6e-06	23.7
WP_059750492.1\|81517_82069_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_155122435.1\|82158_82443_+	hypothetical protein	NA	NA	NA	NA
WP_059750493.1\|82529_83702_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_069240722.1\|83894_98588_+	hypothetical protein	A0A248XD62	Klebsiella_phage	2.7e-99	29.3
WP_059750495.1\|98584_99175_+	hypothetical protein	NA	NA	NA	NA
WP_059750496.1\|99194_99779_-	DUF4291 domain-containing protein	NA	NA	NA	NA
WP_059750503.1\|100477_102073_-\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	6.8e-134	57.1
WP_059726816.1\|102103_102448_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	1.1e-41	73.8
WP_155122436.1\|103199_103769_-\|transposase	transposase	NA	NA	NA	NA
WP_059749007.1\|104035_105985_-	cation-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	7.2e-53	28.5
WP_059749006.1\|105981_107025_-	hypothetical protein	NA	NA	NA	NA
WP_059749008.1\|107021_108059_-\|protease	protease modulator HflC	NA	NA	NA	NA
WP_059749005.1\|108152_110048_-\|protease	protease modulator HflK	NA	NA	NA	NA
WP_059715634.1\|111713_112919_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_059750505.1\|113866_114730_+	hypothetical protein	NA	NA	NA	NA
WP_069240723.1\|114749_115556_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_155122437.1\|115646_115922_+	hypothetical protein	NA	NA	NA	NA
WP_059756771.1\|115918_116494_+	hypothetical protein	NA	NA	NA	NA
WP_155122438.1\|116726_117080_+	hypothetical protein	NA	NA	NA	NA
WP_155122439.1\|117092_117902_+	hypothetical protein	NA	NA	NA	NA
117739:117755	attR	NA	NA	NA	NA
WP_080410138.1\|118485_119754_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	2.3e-39	43.3
WP_080410136.1\|119835_120657_+\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	1.1e-07	27.5
WP_059756752.1\|121029_122439_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_155122440.1\|122502_122670_+	hypothetical protein	NA	NA	NA	NA
WP_059756748.1\|122673_124161_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_059724236.1\|124589_124958_-	glyoxalase	NA	NA	NA	NA
WP_059756745.1\|125064_125763_+	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	1.1e-14	29.2

DBSCAN-SWA_5

133727 : 136307

Paenibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080410134.1\|133727_136307_-	hypothetical protein	D0R7J2	Paenibacillus_phage	6.4e-41	35.1

DBSCAN-SWA_6

145368 : 154987

Pandoravirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080410132.1\|145368_146478_+	3-deoxy-7-phosphoheptulonate synthase	S4W5F1	Pandoravirus	2.2e-83	48.9
WP_059724219.1\|146831_147557_-	hypothetical protein	A0A1I9KF49	Aeromonas_phage	3.0e-12	26.1
WP_069240726.1\|149220_149883_+	hypothetical protein	NA	NA	NA	NA
WP_069240727.1\|149957_152738_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	3.0e-84	33.3
WP_059760397.1\|152758_154987_+	hypothetical protein	A0A077K801	Ralstonia_phage	4.4e-38	32.0

DBSCAN-SWA_7

166054 : 169363

Burkholderia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059760409.1\|166054_166333_-	HU family DNA-binding protein	Q6QIE5	Burkholderia_phage	1.8e-18	58.4
WP_071750864.1\|166696_167614_+	hypothetical protein	NA	NA	NA	NA
WP_059760413.1\|168205_169363_+	DUF1016 domain-containing protein	A0A0U2BZN7	Salmonella_phage	1.9e-53	65.1

DBSCAN-SWA_8

177488 : 178274

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059755491.1\|177488_178274_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.1e-19	35.6

DBSCAN-SWA_9

181935 : 222087

Leptospira_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063801159.1\|181935_182412_+\|transposase	transposase	NA	NA	NA	NA
WP_034190888.1\|182387_182738_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	2.5e-17	39.4
WP_069240679.1\|182769_184335_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	4.4e-69	34.4
WP_059754025.1\|184513_184744_-	hypothetical protein	NA	NA	NA	NA
WP_059754036.1\|184691_185099_+\|transposase	transposase	A0A0P0ZBP6	Stx2-converting_phage	6.4e-12	45.6
WP_034184982.1\|185095_185443_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	1.6e-40	72.9
WP_059754028.1\|185520_187035_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	9.0e-152	55.2
WP_059754033.1\|187031_187397_-	hypothetical protein	NA	NA	NA	NA
WP_155122445.1\|189267_191574_-	EAL domain-containing protein	NA	NA	NA	NA
WP_080409794.1\|191691_192096_-	hypothetical protein	NA	NA	NA	NA
WP_080409785.1\|192435_193269_-	molecular chaperone	NA	NA	NA	NA
WP_080409786.1\|193268_195890_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_080409787.1\|195962_196742_-	fimbria/pilus periplasmic chaperone	NA	NA	NA	NA
WP_155122446.1\|196835_197375_-	hypothetical protein	NA	NA	NA	NA
WP_155122447.1\|197480_198020_-	hypothetical protein	NA	NA	NA	NA
WP_080409788.1\|198083_199502_-	fimbrial protein	NA	NA	NA	NA
WP_080409789.1\|199775_200108_-	H-NS histone family protein	NA	NA	NA	NA
WP_080409790.1\|200253_200883_-	response regulator transcription factor	NA	NA	NA	NA
WP_155122448.1\|202926_203310_-	hypothetical protein	NA	NA	NA	NA
WP_059748663.1\|203404_205039_-	GMC family oxidoreductase	NA	NA	NA	NA
WP_155122449.1\|205709_208457_-	hypothetical protein	NA	NA	NA	NA
WP_059748664.1\|208942_209338_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_080409792.1\|212766_213756_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_088510507.1\|214964_216085_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.4e-45	40.9
WP_088510619.1\|216186_217306_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.6e-49	39.5
WP_080410106.1\|217376_218234_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_059755015.1\|218479_218851_-	IS66 family insertion sequence hypothetical protein	A0A0P0ZBP6	Stx2-converting_phage	1.3e-06	30.7
WP_155122450.1\|218847_219012_-	hypothetical protein	NA	NA	NA	NA
WP_059755018.1\|219298_220318_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_059755021.1\|220596_222087_+\|transposase	ISNCY family transposase	NA	NA	NA	NA

DBSCAN-SWA_10

241450 : 251356

Pseudomonas_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059755054.1\|241450_243412_+	DNA cytosine methyltransferase	Q9ZXI4	Pseudomonas_virus	1.3e-190	63.9
WP_059755056.1\|243471_243792_+	hypothetical protein	NA	NA	NA	NA
WP_059755059.1\|244392_245220_+	DUF945 domain-containing protein	A0A2C9CX26	Yersinia_phage	7.3e-47	38.4
WP_059755062.1\|245288_245954_+	hypothetical protein	NA	NA	NA	NA
WP_059755291.1\|246012_246486_+	hypothetical protein	NA	NA	NA	NA
WP_059755064.1\|246901_247543_+	DNA methylase	A0A2K9VH43	Faecalibacterium_phage	1.0e-32	41.8
WP_042585090.1\|247576_248086_+	hypothetical protein	NA	NA	NA	NA
WP_143135103.1\|248143_248314_+	PQQ-dependent sugar dehydrogenase	NA	NA	NA	NA
WP_059755068.1\|248310_248505_+	hypothetical protein	A0A1B0RXC3	Streptococcus_phage	1.2e-08	58.3
WP_059755071.1\|249268_251356_+	ParB/RepB/Spo0J family partition protein	G8DH78	Emiliania_huxleyi_virus	4.6e-21	29.1

DBSCAN-SWA_11

259657 : 266059

Klebsiella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059755088.1\|259657_262480_+	relaxase domain-containing protein	A0A159B7W8	Klebsiella_phage	3.5e-08	27.6
WP_059755091.1\|262598_263606_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_059755094.1\|263608_264037_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_059755096.1\|264163_266059_+	ABC transporter permease subunit	Q6GZ02	Mycoplasma_phage	9.9e-07	23.2

DBSCAN-SWA_12

288020 : 293299

Burkholderia_virus(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059755134.1\|288020_289073_+	site-specific DNA-methyltransferase	Q8W6P4	Burkholderia_virus	2.0e-121	61.9
WP_059755136.1\|290056_290557_+	hypothetical protein	NA	NA	NA	NA
WP_088510618.1\|290657_290969_+	hypothetical protein	A0A1V0E8G7	Vibrio_phage	2.2e-28	61.1
WP_059755144.1\|290965_291391_+	HNH endonuclease	Q3HQV7	Burkholderia_phage	2.8e-55	72.1
WP_059755149.1\|291387_291846_+	hypothetical protein	R9TN97	Rhizobium_phage	9.3e-20	68.6
WP_059673161.1\|291848_292202_+	hypothetical protein	NA	NA	NA	NA
WP_080410100.1\|292198_293299_+	phage Gp37/Gp68 family protein	Q6JIJ3	Burkholderia_virus	3.6e-78	47.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP013416

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013416_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013416_1

1897792-1897890

Orphan

Consensus_repeat	Method
TGCACCGAGGCTGCTGTTCGTCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013416_1

>merge|NZ_CP013416|1|1897792-1897890|CRISPRCasFinder
TGCACCGAGGCTGCTGTTCGTCGCATTCACGCTGGTCGACAGCGACACCACGTCAGTCGATTCCTGCGTCGACAGTGCACCGAGACTGCTGTTCGTCGC

>NZ_CP013416|1|1|1897792-1897890|CRISPRCasFinder
TGCACCGAGGCTGCTGTTCGTCGC	ATTCACGCTGGTCGACAGCGACACCACGTCAGTCGATTCCTGCGTCGACAG
TGCACCGAGACTGCTGTTCGTCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013416.1\|WP_059748976.1\|1905925_1906783_-\|peptidylprolyl-isomerase	unknown	unknown	gnl\|CDD\|376360
NZ_CP013416.1\|WP_059748768.1\|1908601_1910407_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|374891
NZ_CP013416.1\|WP_059750381.1\|1888947_1889250_+\|DUF1330-domain-containing-protein	unknown	unknown	gnl\|CDD\|377765
NZ_CP013416.1\|WP_059750384.1\|1884070_1884841_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|183833
NZ_CP013416.1\|WP_059750379.1\|1890467_1891592_-\|DUF2827-domain-containing-protein	unknown	unknown	gnl\|CDD\|371305
NZ_CP013416.1\|WP_059661000.1\|1903465_1903945_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013416.1\|WP_059748975.1\|1904715_1905084_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013416.1\|WP_059748763.1\|1904212_1904677_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013416.1\|WP_059748766.1\|1907264_1907831_-\|YbjN-domain-containing-protein	unknown	unknown	gnl\|CDD\|341122
NZ_CP013416.1\|WP_059750378.1\|1891585_1892731_-\|DUF2827-family-protein	unknown	unknown	gnl\|CDD\|371305
NZ_CP013416.1\|WP_017329029.1\|1886262_1886580_-\|non-heme-iron-oxygenase-ferredoxin-subunit	unknown	unknown	gnl\|CDD\|239604
NZ_CP013416.1\|WP_080409925.1\|1889288_1890227_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP013416.1\|WP_059748767.1\|1907893_1908589_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274008
NZ_CP013416.1\|WP_080409806.1\|1901273_1902857_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|276809
NZ_CP013416.1\|WP_059750382.1\|1887017_1888097_+\|porin	unknown	unknown	gnl\|CDD\|238208
NZ_CP013416.1\|WP_059748762.1\|1903998_1904199_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013416.1\|WP_059750469.1\|1888161_1888782_-\|CDP-diacylglycerol--serine-O-phosphatidyltransferase	unknown	unknown	gnl\|CDD\|224104
NZ_CP013416.1\|WP_059748765.1\|1906800_1907268_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013416.1\|WP_059612508.1\|1885947_1886259_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013416.1\|WP_059750383.1\|1884833_1885904_-\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	unknown	unknown	gnl\|CDD\|226985

Protein	Function_ID	Function_description	E-value
NZ_CP013416.1\|WP_059748768.1\|1908601_1910407_-\|hypothetical-protein	gnl\|CDD\|374891	pfam16930, Porin_5, Putative porin.	0
NZ_CP013416.1\|WP_059750381.1\|1888947_1889250_+\|DUF1330-domain-containing-protein	gnl\|CDD\|377765	pfam07045, DUF1330, Domain of unknown function (DUF1330). This family consists of several hypothetical bacterial proteins of around 90 residues in length. The function of this family is unknown.	1.32712e-27
NZ_CP013416.1\|WP_059750384.1\|1884070_1884841_-\|SDR-family-oxidoreductase	gnl\|CDD\|183833	PRK12939, PRK12939, short chain dehydrogenase; Provisional.	4.66872e-114
NZ_CP013416.1\|WP_059750379.1\|1890467_1891592_-\|DUF2827-domain-containing-protein	gnl\|CDD\|371305	pfam10933, DUF2827, Protein of unknown function (DUF2827). This is a family of uncharacterized proteins found in Burkholderia.	0
NZ_CP013416.1\|WP_059748766.1\|1907264_1907831_-\|YbjN-domain-containing-protein	gnl\|CDD\|341122	cd17511, YbjN_AmyR-like, YbjN protein family is structurally similar to type III secretion system chaperones. This YbjN protein family includes Escherichia coli YbjN, Erwinia amylovora AmyR, and similar proteins. YbjN proteins share a class I type III secretion chaperone (T3SC)-like fold with type III secretion system (T3SS) chaperone proteins but appear to function independently of the T3SS. YbjN is an enterobacteria-specific protein. In E. coli, it acts as a sensory transduction regulator that may play important roles in regulating bacterial multicellular behavior, metabolism, and survival under stress conditions. E. amylovora AmyR, a functionally conserved ortholog of E. coli YbjN, is a stress and virulence associated protein that regulates the ams operon. Ams proteins are required for amylovoran biosynthesis. AmyR may also regulate the Rcs phosphorelay system, an atypical two-component signal transduction (TCST) system present only in Enterobacteriaceae and positively regulates amylovoran biosynthesis by activating the ams operon transcription.	4.06385e-13
NZ_CP013416.1\|WP_059750378.1\|1891585_1892731_-\|DUF2827-family-protein	gnl\|CDD\|371305	pfam10933, DUF2827, Protein of unknown function (DUF2827). This is a family of uncharacterized proteins found in Burkholderia.	1.68872e-152
NZ_CP013416.1\|WP_017329029.1\|1886262_1886580_-\|non-heme-iron-oxygenase-ferredoxin-subunit	gnl\|CDD\|239604	cd03528, Rieske_RO_ferredoxin, Rieske non-heme iron oxygenase (RO) family, Rieske ferredoxin component; composed of the Rieske ferredoxin component of some three-component RO systems including biphenyl dioxygenase (BPDO) and carbazole 1,9a-dioxygenase (CARDO). The RO family comprise a large class of aromatic ring-hydroxylating dioxygenases found predominantly in microorganisms. These enzymes enable microorganisms to tolerate and even exclusively utilize aromatic compounds for growth. ROs consist of two or three components: reductase, oxygenase, and ferredoxin (in some cases) components. The ferredoxin component contains either a plant-type or Rieske-type [2Fe-2S] cluster. The Rieske ferredoxin component in this family carries an electron from the RO reductase component to the terminal RO oxygenase component. BPDO degrades biphenyls and polychlorinated biphenyls. BPDO ferredoxin (BphF) has structural features consistent with a minimal and perhaps archetypical Rieske protein in that the insertions that give other Rieske proteins unique structural features are missing. CARDO catalyzes dihydroxylation at the C1 and C9a positions of carbazole. Rieske ferredoxins are found as subunits of membrane oxidase complexes, cis-dihydrodiol-forming aromatic dioxygenases, bacterial assimilatory nitrite reductases, and arsenite oxidase. Rieske ferredoxins are also found as soluble electron carriers in bacterial dioxygenase and monooxygenase complexes.	2.37287e-38
NZ_CP013416.1\|WP_080409925.1\|1889288_1890227_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	1.276e-60
NZ_CP013416.1\|WP_059748767.1\|1907893_1908589_-\|hypothetical-protein	gnl\|CDD\|274008	TIGR02168, Chromosome_partition_protein_Smc, chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].	0.000352293
NZ_CP013416.1\|WP_059748976.1\|1905925_1906783_-\|peptidylprolyl-isomerase	gnl\|CDD\|376360	pfam00639, Rotamase, PPIC-type PPIASE domain. Rotamases increase the rate of protein folding by catalyzing the interconversion of cis-proline and trans-proline.	8.0816e-23
NZ_CP013416.1\|WP_059750382.1\|1887017_1888097_+\|porin	gnl\|CDD\|238208	cd00342, gram_neg_porins, Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane. Individual 16-strand anti-parallel beta-barrels form a central pore, and trimerizes thru mainly hydrophobic interactions at the interface. Trimers are stabilized by hytrophillic clamping of Loop L2. Loop 3 bends into the pore, creating an elliptical constriction of about 7 x 11A, large enough to allow passage of a glucose molecule without steric hindrance. Removal of the C-terminal residue (usuallly F) destabilizes the trimer and removal of the 16th beta-sheet abolishes trimerization. Unlike typical membrane proteins, porins lack long hydrophobic stretches. Short turns are found at the smooth, periplasmic end, longer irregular loops are found at the rough, extracellular end. C-terminal residue forms salt bridge with N-terminus.	5.87404e-78
NZ_CP013416.1\|WP_059750469.1\|1888161_1888782_-\|CDP-diacylglycerol--serine-O-phosphatidyltransferase	gnl\|CDD\|224104	COG1183, PssA, Phosphatidylserine synthase [Lipid metabolism].	5.28242e-34
NZ_CP013416.1\|WP_059750383.1\|1884833_1885904_-\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	gnl\|CDD\|226985	COG4638, HcaE, Phenylpropionate dioxygenase and related ring-hydroxylating dioxygenases, large terminal subunit [Inorganic ion transport and metabolism / General function prediction only].	4.49924e-43
NZ_CP013416.1\|WP_080409806.1\|1901273_1902857_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	6.4821e-15

>NZ_CP013416.1|WP_059750378.1|1891585_1892731_-|DUF2827-family-protein
MRIGISVLTHAGQNIWENGLGQNVFHLARLLRALPFVEDVLLLNCGDQSCLPGDVEAAGAGFRLIAPRDATDLIDVAIEMAGGLDVCWLDHLRAQGKKVVYHCCGQPYTALIEPTIFGAGGYFSRSERCDEIWTLPRDRGFHRMLESLYRCPVYDVPYLWAPEFLERRAASLRNDHGIEFGYRAQPRKDYTFRALRVAVLEPNISVTKVCSIPMLICDSAFRTNEDAVAELHLLNTIQMKDHPTFVHLANSLDLTKNGKVRFEQRHDFAGYMSQFGDAVVTHQWQHDQNTLYLDVLYGGYPLIHNSQWLGAAGYYYPDSDIPGGACRLIEASRNHDENLDSYRRSATQFLGALNPLHAANLAAYARSLLRLTSVRDRGATC
>NZ_CP013416.1|WP_059750379.1|1890467_1891592_-|DUF2827-domain-containing-protein
MLNGRRLKVGVTIFVRAGQQSLWENGIFQNCFFLTMLLAKSPLVETVCLVNGGDGSVEDAGEFLADAPARVIDLQTARTQLDVIIELSAQLDPQWVRDFQSHGGRVVGMRVANDYAIDVERMIFGRPHGMLVSGAEYDVIWTLPAFEKTCAAYYEAALRAPVRTVQHIWSPLLVERAVGRNAPARPFGYTPGRARWRLAILEPNLCMVKTSHVSMLLADVAYRQSPDFIDVLRVYNTFHLKNDPLFVGFATSLDLVRHGLASFEARFPTYEIMGQHADAIISHHWENAQNYLYYEALHGGYPLIHNSTLLGGCGYRYADFDPQDGALALRQAFAGHDAQLDDYRRTARELLKTLDPHAERNVEQYSAALAELYP
>NZ_CP013416.1|WP_080409925.1|1889288_1890227_-|IclR-family-transcriptional-regulator
MSGATKPPAAKARPSRRAAAEHDAPEPVAAGDDEPAGGASSYLVPGLERGLRILAEFSAREPVLGAPELSKRIGIPRTTTFRLLQTLEALGFLERVNGDRHFRLGVGVLRLGFEYLNSLELTDLGAPVLERLRDTTGLSTHLLIRDRRDVVFVAKAQSHASMFGSVKVHVGTRLPAHATVHGHVLMGDLTRDALRQLYPEKRLEQFTERTPGTVDELYERMRHYARLGYAVSEAAFEAGISAVTAPVRDHSGSIVAAITATVPRSEIGEAGEKERLVEAVCGAAVDLSQRLNYRPLESDPTFAHARHKVAMF
>NZ_CP013416.1|WP_059750381.1|1888947_1889250_+|DUF1330-domain-containing-protein
MAVYLLAQLRFTQRDAYDRYQARFRDVFRRFDGRLLAADDAPVALEGEWDRDKVVLMAFPDEASARRFVESPEYQEISRDRHAGADTLALLVRGIPAPDA
>NZ_CP013416.1|WP_059750469.1|1888161_1888782_-|CDP-diacylglycerol--serine-O-phosphatidyltransferase
MTKPVRRFSMIREFHLADWFTLGNAVCGTSAIFSIISYIATEDVLHVYYAAGLIVAALIFDILDGRIARWRQKSSVLGRELDSLADVISFGVAPAVIGYGCGMRGMVDRFLLVYFVACGVSRLARYNVTAEALSQETGKVTYFEGTPIPTSIVIVLMLAVATYCGGIGPTMWLGEVALHGAVFHPLTLVFGLSGSLMISRIRIPKP
>NZ_CP013416.1|WP_059750382.1|1887017_1888097_+|porin
MVKQAVAAAVVGFGVASGAWAQSSVTLYGSTDAGIAYVNNVGGHAKWAMIQGNTQPDRWGLKGKEDLGGGLSAIFQLENGFYTNNGQFATANTIWNRAAWVGIDSSRYGTLTLGRQTPLSFDYLDPLSTAYLAASWYAFHPGNIDGLAATGNVPYNNAVKYRSPSFAGFSAAAVMALGNTTNFSTGKSVGVALNYANGPFKASAVYSSEHDRSILIGQTGIANFQGQNTANGYLASKVENIGAGASYQFGDFLVHGLYTRTKMQSNGHSDTFQSYDAGVNYRTSPFNTIAGGAATSTLSGRRWTQLELGDIYALSKRTQLYANVLVEHASGGAKAAFFTAGVSSTANQVVVLAGIHHSF
>NZ_CP013416.1|WP_017329029.1|1886262_1886580_-|non-heme-iron-oxygenase-ferredoxin-subunit
MSEQWICAGHAGALSEDTPIEFKRTDGVEIGIYRVGDEVYALENVCPHAYALLTQGFVDDGTVECPLHEAVFDIRTGQCLKGPGGRALKQYAVRLAGEEIQIKVE
>NZ_CP013416.1|WP_059612508.1|1885947_1886259_-|hypothetical-protein
MKEATVNFNPFLKPWVAPQPNNVAGKGQIEIPGQVENRIWQTRKAEPTQYENDLGDALERVFEAGATELDDVVAGLNRIGFRTPDGAPWTAERFRAEMAALAE
>NZ_CP013416.1|WP_059750383.1|1884833_1885904_-|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha
MTFPAQPASQHDPVRDYLDRGIKNYWYPVAPSWQVSNAPVGLTRLNEQIVLWRDQDGHVHALEDRCPHRGARLSLGWNLGGNLACWYHGVEVDGSGTVNRVPAVSNCPLEGTKCVKSYPVREQAGAIFLWFGDDAHAEPAPLNLPEELVAGEYAHFLCMSNWKCNYQYAIDNVMDPMHGAYLHATSHSMAEGDKQADMRVRKTETGLVFEKTGQRDVNFDWVELGETGCLWMRLAIPYKQKFGPGGNFGIIGFATPVDNDHCQVYFWRTRKVSGWQRDVWRFMYRNRLEGLHWDVLEQDRYVLESLAPNARDHEYLYQHDVGITRVRRMLRQRAQEHLSALDAHRAAHAASESAHG
>NZ_CP013416.1|WP_059750384.1|1884070_1884841_-|SDR-family-oxidoreductase
MADQAPVVSLAGRRVLVTGGARGLGAAFVKALVAAGAQVAFGDVLADEGRALAAQLAAQGHAAHFFALDLADPASVHAFVAQGAAALGGIDGLINNAAITNSGGKLSTELDVATWDAVMNVNVRGLWLASNAALPYLAQSGRGAIVNLASDTALWGAPKLLAYVASKGAVIAVTHAQAREFGAHGVTVNAIAPGLTEVEATAYVPAERHAYYQQGRALTRAQVPDDVTGPVLFLLSDAARFVTGQLLPVNGGFVMN
>NZ_CP013416.1|WP_080409806.1|1901273_1902857_-|tetratricopeptide-repeat-protein
MEGRKELPAPSITPACIADVSPVRAGPGGFAPGVPTRADALSNRAWQLLNGGDFEQSAACARQAVSIAPGSGFVRLILGVALNQVGLRREALDELARAAVLAPRDPQIRYNLAVALHESGQQARAMDEYRACLERDPVCVDALWNYGELLRLREHFDEALDCFDRLVRLESRLRDKAAHRMAVCCAHLGQDDRAQALFEKQIAEDDDPLTHWEYAHFLLGRGRFTDAWPHYARRFDAGEKVGLKGMRFPYPSWCGQFEAGSTLIVSCEQGAGDEILFAAFLPSLLQRARSADMRVVVVCRPALVRLFRESFPSARVLGGMVTQEPDLCTIVKQSSIIRHIRIGDLPLWLDKPEPAAYLKPAPDDQRDARRLIASSRAGDGCTHIGIVWSANPLSSASNRRARNVPSELLNAWLKDIDGVRFYSLMPAEHCAVLAGVPDLHVTDLAFFLTDFSRTAAAMQCLDEIVSVCTSSANLSGALGLKTHVLLQKHADWRWCGDTAWYRDVVTYRQETRADWGNCLQALSANWR
>NZ_CP013416.1|WP_059661000.1|1903465_1903945_-|hypothetical-protein
MELTQLGSHVAQFGFAEKQKHAQALMYGMANISEYVSRGICYDAAAFVRYLLQGPAFITPNMLIDTSAQNWRPRFNFEAGNQWDGRGSIPAGTAIGFSRDGNVFHAAIAIGGTRIRAVNGGRLGNGWLVPVDLARVLAPGDDGTFLYDRTNIRVHLSRL
>NZ_CP013416.1|WP_059748762.1|1903998_1904199_-|hypothetical-protein
MTVVLILVVLAIVVLFGFAAHVDALTGRIGRQPARAQLERLRREVALQRAALRRRPDSAGWFRNMI
>NZ_CP013416.1|WP_059748763.1|1904212_1904677_-|hypothetical-protein
MIVESGICSRALVVACALFASAPARAQTADVPQPWISYAQLAGRQFQAWLEVDGDAADRLHRYLEDRVLHASADAPPPAIVVRAWIGASGAVTRVEFAALGDPNADAALRQLLTAGPLAEPPPPDMRQPLRVRLRLTPNPDAPVAASGAAAAAP
>NZ_CP013416.1|WP_059748975.1|1904715_1905084_-|hypothetical-protein
MGEWRRWSVAWGCALLAGAVHAQAGRPAAAGSQPGSAAKPVCVDAEVDGKRALSYDCLSAQLKPKATPQAGASQTAAEGLATAPSNRLGTFNLSTERNRFGTNWGKSATPQRPVQPVAVPPK
>NZ_CP013416.1|WP_059748976.1|1905925_1906783_-|peptidylprolyl-isomerase
MGGLLLSVPLMAAAQDDVIANAAQASVTQSDIAALLKAAGDEGRARLAADPAAMDQVVRATLAQKAVLAEAKAKGWDKQADVQSVIEQARRDIIARSYLASVNAPPADYPSDAEIQSAYEKNRAAFTVPRALRVAQIYVAVAPDADAAAVDKARKQAADLANRARGGDFAALAKANSQDAASAANGGDLGFVPETMLLPAVRQAADALKTGQVSAPIRTATGFHVVKLIDTRPAAPRPLADVKERLRTMLRAQRTQQNAQAYLAKLGGDAPINEDALKKALAAAR
>NZ_CP013416.1|WP_059748765.1|1906800_1907268_-|hypothetical-protein
MTGAGRIGAALRALLTRGRPAQRGPVAVGDAPAAWADYAQRVAQRLAAALDGTDAAASRVRAQLERDAARREDDEDDEDGDAPPALRLKAWLDRRGNIERIESAPAFAPDVAADLRAALVGRRVGAPPPRGMTQPVVVRVRVAVQDSSQTGQERS
>NZ_CP013416.1|WP_059748766.1|1907264_1907831_-|YbjN-domain-containing-protein
MLDSKMEASGDRPAQDALIDAIGVDALADVFRNAGYRVTATEQNGAVQLMSASQGVGFAVRFGNAAPPQGEAAGASIARYLDYTLGCVLQVQGDLPAQLVADWNRTKRFARLASHGPFLALEMDVIVAGGVTVRYLRSTIELWDRMVQEFLLHLRNRPAFAEQEAAARAGSDPETDDAGQGRAEAAAQ
>NZ_CP013416.1|WP_059748767.1|1907893_1908589_-|hypothetical-protein
MKTTQHAIVAAGLAGALLLAAGGAGAQGIEDKLRSQLRSTVQELRQLQNGQAQLQADKTAAERQRDDALAQLKAAQAQLAAAKGQSGGEAAAKRALAQERAAREQDAQALAKYKASYEDLLAVSRARDAQHTQQQGEIRARDTQLQTCEAHNAELYRVGREILDAYEHVGIGTLFASRQPFAAAARVKYDDLAQRYGDALYAGKYDPAARAANAANAASATAAASAPAGAR
>NZ_CP013416.1|WP_059748768.1|1908601_1910407_-|hypothetical-protein
MIRKSNERWSGHRRGAMPARLTRVGAAALALGVSCAHAQSLDAQAVAGKAAPTESVVINLINLLVKRGVLTQQNANELISEARTEAAQAKAARTTGGARTALAGVAMPPTQPGDVAVPYVPQVVREQIRDQVKQEVIAQAKAENWAQPNTFPDWVSRIKLDGDLRVRDEYHFYGSGNANNVTNFAAINQGGGFDINPNTNTTQLPTQNTTQNRNNLLRYRARLGVTATLSDELTAGLQLASGNDNGPVSTTATAGGGFGKKNIWLNKAYFAYRPTSWLNLTAGRFDNPFFKSDLVFSDDLMMDGIAANLRHALPWNPDVTLFGTLGVFPIQYTSENFPSNSTDKAGSDTKWLFGAQFGADWKINAQNRLKGAVAYYDFQNMRGTLSSPCALYLGATSCSTDNQALAFMQGGNTLLALRNIVQNPNLAPGMTPQPQLFGLAYNYRLLDLKAQWDTVVADRFKLRLDGEFVRNLAYNENKAFSAASLPVNNYESTSVNATRADYRSGPNGFLAKATLGEPEPRAKGQWNFSIAYKYLQPDAVLDAFNDSDFHLGGTNARGYVIGAAYAVARDAWVSARYLSAKEVYGPPVSIDVLQLELNARF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013416_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013416_2

2194520-2194615

Orphan

Consensus_repeat	Method
CGACACGCCGCCGTTGATCGTGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013416_2

>merge|NZ_CP013416|2|2194520-2194615|CRISPRCasFinder
CGACACGCCGCCGTTGATCGTGCCCGAGTTGGTAAACGTATTGCCCTGCCCGGGCGTGCCGTTCGAGCCGAACGACACGCGGCCGTTGATCGTGCC

>NZ_CP013416|2|2|2194520-2194615|CRISPRCasFinder
CGACACGCCGCCGTTGATCGTGCC	CGAGTTGGTAAACGTATTGCCCTGCCCGGGCGTGCCGTTCGAGCCGAA
CGACACGCGGCCGTTGATCGTGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013416.1\|WP_059748966.1\|2202258_2202615_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013416.1\|WP_059748958.1\|2184484_2185378_-\|PenA-family-class-A-beta-lactamase	unknown	unknown	gnl\|CDD\|185339
NZ_CP013416.1\|WP_059748952.1\|2178533_2179394_-\|isocitrate-lyase/phosphoenolpyruvate-mutase-family-protein	unknown	unknown	gnl\|CDD\|379346
NZ_CP013416.1\|WP_059748965.1\|2201863_2202253_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013416.1\|WP_059748967.1\|2202766_2203486_-\|response-regulator	unknown	unknown	gnl\|CDD\|236738
NZ_CP013416.1\|WP_059748959.1\|2185492_2186383_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176176
NZ_CP013416.1\|WP_059749002.1\|2187248_2189468_-\|amylo-alpha-1,6-glucosidase	unknown	unknown	gnl\|CDD\|225942
NZ_CP013416.1\|WP_059748969.1\|2205353_2205899_+\|lysozyme	unknown	unknown	gnl\|CDD\|381619
NZ_CP013416.1\|WP_059748957.1\|2182361_2183732_+\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|182388
NZ_CP013416.1\|WP_080409814.1\|2201347_2201731_+\|cytochrome-c	unknown	unknown	gnl\|CDD\|365823
NZ_CP013416.1\|WP_059748955.1\|2181018_2181609_+\|DUF1016-family-protein	unknown	unknown	gnl\|CDD\|380007
NZ_CP013416.1\|WP_059748964.1\|2199672_2200803_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|236724
NZ_CP013416.1\|WP_059748953.1\|2179518_2180379_-\|MurR/RpiR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224651
NZ_CP013416.1\|WP_059748956.1\|2181702_2182365_+\|response-regulator	unknown	unknown	gnl\|CDD\|182612
NZ_CP013416.1\|WP_059748962.1\|2195970_2197005_-\|rod-shape-determining-protein	unknown	unknown	gnl\|CDD\|237564
NZ_CP013416.1\|WP_059748963.1\|2197261_2199640_+\|BamA/TamA-family-outer-membrane-protein	unknown	unknown	gnl\|CDD\|132844
NZ_CP013416.1\|WP_059748968.1\|2203823_2205275_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271184
NZ_CP013416.1\|WP_059748960.1\|2186890_2187142_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013416.1\|WP_059748954.1\|2180434_2180788_-\|NirD/YgiW/YdeI-family-stress-tolerance-protein	unknown	unknown	gnl\|CDD\|225653
NZ_CP013416.1\|WP_059749003.1\|2206110_2206368_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP013416.1\|WP_059748958.1\|2184484_2185378_-\|PenA-family-class-A-beta-lactamase	gnl\|CDD\|185339	PRK15442, PRK15442, beta-lactamase TEM; Provisional.	3.17037e-74
NZ_CP013416.1\|WP_059748952.1\|2178533_2179394_-\|isocitrate-lyase/phosphoenolpyruvate-mutase-family-protein	gnl\|CDD\|379346	pfam13714, PEP_mutase, Phosphoenolpyruvate phosphomutase. This domain includes the enzyme Phosphoenolpyruvate phosphomutase (EC:5.4.2.9). This protein has been characterized as catalyzing the formation of a carbon-phosphorus bond by converting phosphoenolpyruvate (PEP) to phosphonopyruvate (P-Pyr). This enzyme has a TIM barrel fold.	1.29895e-86
NZ_CP013416.1\|WP_059748967.1\|2202766_2203486_-\|response-regulator	gnl\|CDD\|236738	PRK10701, PRK10701, DNA-binding transcriptional regulator RstA; Provisional.	5.5241e-82
NZ_CP013416.1\|WP_059748959.1\|2185492_2186383_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176176	cd08487, PBP2_BlaA, The C-terminal substrate-binding domain of LysR-type trnascriptional regulator BlaA which involved in control of the beta-lactamase gene expression; contains the type 2 periplasmic binding fold. This CD represents the C-terminal substrate binding domain of LysR-type transcriptional regulator, BlaA, that involved in control of the expression of beta-lactamase genes, blaA and blaB. Beta-lactamases are responsible for bacterial resistance to beta-lactam antibiotics such as penicillins. The blaA gene is located just upstream of blaB in the opposite direction and regulates the expression of the blaB. BlaA also negatively auto-regulates the expression of its own gene, blaA. BlaA (a constitutive class A penicllinase) belongs to the LysR family of transcriptional regulators, whereas BlaB (an inducible class C cephalosporinase or AmpC) can be referred to as a penicillin binding protein but it does not act as a beta-lactamase. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	7.0585e-117
NZ_CP013416.1\|WP_059748956.1\|2181702_2182365_+\|response-regulator	gnl\|CDD\|182612	PRK10643, PRK10643, two-component system response regulator PmrA.	6.35477e-83
NZ_CP013416.1\|WP_059748969.1\|2205353_2205899_+\|lysozyme	gnl\|CDD\|381619	cd16900, endolysin_R21-like, endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.	2.86835e-50
NZ_CP013416.1\|WP_059748963.1\|2197261_2199640_+\|BamA/TamA-family-outer-membrane-protein	gnl\|CDD\|132844	cd07205, Pat_PNPLA6_PNPLA7_NTE1_like, Patatin-like phospholipase domain containing protein 6, protein 7, and fungal NTE1. Patatin-like phospholipase domain containing protein 6 (PNPLA6) and protein 7 (PNPLA7) are included in this family. PNPLA6 is commonly known as Neuropathy Target Esterase (NTE). NTE has at least two functional domains: the N-terminal domain putatively regulatory domain and the C-terminal catalytic domain which shows esterase activity. NTE shows phospholipase activity for lysophosphatidylcholine (LPC) and phosphatidylcholine (PC). Exposure of NTE to organophosphates leads to organophosphate-induced delayed neurotoxicity (OPIDN). OPIDN is a progressive neurological condition that is characterized by weakness, paralysis, pain, and paresthesia. PNPLA7 is an insulin-regulated phospholipase that is homologus to Neuropathy Target Esterase (NTE or PNPLA6) and is also known as NTE-related esterase (NRE). Human NRE is predominantly expressed in prostate, white adipose, and pancreatic tissue. NRE hydrolyzes sn-1 esters in lysophosphatidylcholine and lysophosphatidic acid, but shows no lipase activity with substrates like triacylglycerols (TG), cholesteryl esters, retinyl esters (RE), phosphatidylcholine (PC), or monoacylglycerol (MG). This family includes subfamily of PNPLA6 (NTE) and PNPLA7 (NRE)-like phospholipases.	1.72077e-58
NZ_CP013416.1\|WP_080409814.1\|2201347_2201731_+\|cytochrome-c	gnl\|CDD\|365823	pfam00034, Cytochrom_C, Cytochrome c. The Pfam entry does not include all Prosite members. The cytochrome 556 and cytochrome c' families are not included. All these are now in a new clan together. The C-terminus of DUF989, pfam06181, has now been merged into this family.	3.85715e-08
NZ_CP013416.1\|WP_059748955.1\|2181018_2181609_+\|DUF1016-family-protein	gnl\|CDD\|380007	pfam17761, DUF1016_N, DUF1016 N-terminal domain. This family may include an HTH domain.	2.57569e-54
NZ_CP013416.1\|WP_059748964.1\|2199672_2200803_-\|sensor-histidine-kinase	gnl\|CDD\|236724	PRK10604, PRK10604, sensor protein RstB; Provisional.	8.30248e-70
NZ_CP013416.1\|WP_059748953.1\|2179518_2180379_-\|MurR/RpiR-family-transcriptional-regulator	gnl\|CDD\|224651	COG1737, RpiR, Transcriptional regulators [Transcription].	4.37016e-48
NZ_CP013416.1\|WP_059749002.1\|2187248_2189468_-\|amylo-alpha-1,6-glucosidase	gnl\|CDD\|225942	COG3408, GDB1, Glycogen debranching enzyme [Carbohydrate transport and metabolism].	2.305e-119
NZ_CP013416.1\|WP_059748962.1\|2195970_2197005_-\|rod-shape-determining-protein	gnl\|CDD\|237564	PRK13930, PRK13930, rod shape-determining protein MreB; Provisional.	1.07864e-159
NZ_CP013416.1\|WP_059748957.1\|2182361_2183732_+\|HAMP-domain-containing-protein	gnl\|CDD\|182388	PRK10337, PRK10337, sensor protein QseC; Provisional.	5.96627e-65
NZ_CP013416.1\|WP_059748968.1\|2203823_2205275_+\|site-specific-integrase	gnl\|CDD\|271184	cd01184, INT_C_like_1, Uncharacterized site-specific tyrosine recombinase, C-terminal catalytic domain. Tyrosine recombinase (integrase) belongs to a DNA breaking-rejoining enzyme superfamily. The catalytic domain containing six conserved active site residues. The recombination reaction involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	1.5524e-48
NZ_CP013416.1\|WP_059748954.1\|2180434_2180788_-\|NirD/YgiW/YdeI-family-stress-tolerance-protein	gnl\|CDD\|225653	COG3111, COG3111, Periplasmic protein with OB-fold [Function unknown].	2.40711e-23

>NZ_CP013416.1|WP_059749002.1|2187248_2189468_-|amylo-alpha-1,6-glucosidase
MPNHADETTTRAPQVAPVPPTQASGPAFIAPEAGPQADARNNQYVLKAGDAFVVSDALGDVSGHDDGLFVDDMRVLSKWRLTFGGRAPSLLSGATSADNASFTAHLTNRPLPPLGGRETPEGVIHIERMRVLANNVLYEALTLTNYGASEAEVPLSLSFAADFKDMFEARGTHRARRGTIAQPRIDAGAVRLRYDGLDRVERAVTVNFSPAPDALSVDRADYRLTIAAQACVSIYLTVEATVGAARGETPGCGRAALRTALVAVHRAMRARRATMARVRTGNPLFNAWLDRSLADLGLLTTQLDTGPYPYAGIPWFSTPFGRDAVITSLQMLWLQPSLARGVLRFLAAHQARETSAFRDAEPGKIMHEFRKSEMAATGEVPFALYYGGVDTTPLFVVLAGAYVEHTGDDALIDELWPALERAIQWVSDKCDRNPYGLLDYQRTSERGLANQGWKDSHDSVFHADGRFPDGPIALVEVQAYACAAFDAMSACSQRRGHAADATRYALRARALREQVETLFWMPDANFYGIALDGHGELCRVLASNAGHLLAFGLPDPARGAAVADALGSTLFQTGWGVRTLAAGQPRFNPMAYHNGSVWPHDNALAARGLARYGDKAAVLNLLRALFEAAVSFEMRLPELFCGFPRRRGEPPTAYPVACLPQAWAAGAPFMMLQACLGVSVDAARHEVRVERPALPEGVDWLRIDDLRVGDDSVSLTFRRVDGQVVAAAEPGRVKVVAVL
>NZ_CP013416.1|WP_059748960.1|2186890_2187142_-|hypothetical-protein
MTTDKRPDDGEQKLEHLEAAVNHLHESIESQSIAVGAAKGILFSLIETLGALIGDPDLPEHARSGYEALRDKARDLRGSLDKH
>NZ_CP013416.1|WP_059748959.1|2185492_2186383_+|LysR-family-transcriptional-regulator
MTKLRPHLPLNALRAFESSARHLNFTRAGLELSVTQAAVSQQVRALEERLGCALFTRLPRGLGLTDEGRALLPVLSDAFSRIETVLKQFDGGRFHEVLSIGVVGTFALGWLMPRLKRFGDVNPFIELRLRTNNNVVDLAAEGLDFAIRFGVGNWPATRNERLLDAPLTALCAPEIAARVAQPGDLANETQLRSYRTDEWLGWFEAAQLEPWPVNGPVFDSSRLMVEAAMQGAGVALAPACMFTRELQLGLLARPFDIDVQAGGYWLTSLKSKPLTPAMTLFRDWIASEAAGAAPVQ
>NZ_CP013416.1|WP_059748958.1|2184484_2185378_-|PenA-family-class-A-beta-lactamase
MTYSSQRRTLLLAAATAPLALTLSACASPRANASSVGAATSLAELERAAGGRLGVHALDTATGRRVQHRADERFPFCSTFKAILIAAVLAESVARPALFTQRVTYRQADLLEWSPVTEKHVDTGMTVGELCEATAQYSDNAAANLLMKLLGGPAAVTAFARSIGDETFRLDRWEPELNTALPGDARDTTTPAAMAASLRALALGDALPAPQRAQYAQWLLGNKTGDKRIRAGVPTGWQVGDKTGTGDYGTINDIGVLWPPARGPIVLTVYYTQARPDAKRKDDVIAAATRIAIAALG
>NZ_CP013416.1|WP_059748957.1|2182361_2183732_+|HAMP-domain-containing-protein
MTSLRRALMRWRGASLRRRLLFWLLPAACVIGLLASAGTYWGALRELDDLLDDQMRSMTKQIVVGPNGELSFSSDARGKHRFKVDDPDAVLLQVWRNGTLVYSTERDLTLPPPAQAGIASVDVGGQSWRTYVTERGGTTIRVAQARHARWEAIAGIAVHLLWPVLSMLPVLAIGLWFGIGAGLRPLRLIAAGLKRRNANNLEPVDVASMPNEVRPLAEAINDLLARLDRSFTLQRHFIADAAHELRTPIMGLSIQSQLLRRAATPDERERILAQIHAGTTRLGHLAEQLLTLARIEPDAQTAAFAPVDLAALCRAVVADRARVADAHRVDLGVIGASPVTVAGNADTLRVLLNNLVDNAIRYAGDGACIDVSARVDGATPVLEVSDDGPGIPEAERADVWERFYRGAGAQAATSSGSGLGLSIVKRIAEQHRATVTLGTSAGGRGLTVTVRFNAPA
>NZ_CP013416.1|WP_059748956.1|2181702_2182365_+|response-regulator
MRVLLVEDDPLIGSGLEHGLKQEGFAVDWVKDGDAASLALRATGYGLLLLDLGLPNRDGLSVLAALRRRDENLPAIVITARDGLSERIAGLDSGADDYLVKPFALEELLARIRAVNRRHAGRAQTTLAVGPLRLDPVKHLVWLDDAEVTLSPKEFVLLHELMREPGAVISREQFEERLYSWGEEIESNAVQVHIHNLRKKLGHEMIRTVRGVGYRIGDAA
>NZ_CP013416.1|WP_059748955.1|2181018_2181609_+|DUF1016-family-protein
MTDTLSAGPWGDDYRSWLTDLKQRVEHARQRAAASANRELVTLYWQIGRDILERQQLQGWGAKVIDQLARDLKDAFPDMRGFSPRNLKYMRALAQAWPAPKFVQQAVAQLPWSHVVTLLDKLKDPATRDWYAGKSLEHGCREKNRLVAEYALRGMANPMGVAEYQLLRQIPASLESGLPSIDRIEAELGPDLPAAE
>NZ_CP013416.1|WP_059748954.1|2180434_2180788_-|NirD/YgiW/YdeI-family-stress-tolerance-protein
MKQLARILTIALAALPAAVYAQYTGPSTLTTTTVKELLANGKDDQHVQLQGRIVKHVGGEDYEFADATGTIRVEIDDKLWAGGQPVGDKSEVKLTGEFERKWLGRVKVDADRIDVVR
>NZ_CP013416.1|WP_059748953.1|2179518_2180379_-|MurR/RpiR-family-transcriptional-regulator
MAANFDELASRIRAQFSELSPQFQAGAAFLLDHPDEVAVSSMRKVAQRAQVQPASLVRLAQQFGFPGWNELRDLCVARVRTRPEPLTQRARSLVRPDAKASLAHDLLAAQQHNLAATAAQNAQALAEAAKLIRKASHVHVAGFRSCYPVAFGLVYGYRLFRPTVSLLAGVAGSLEMELRSIAKHSATVIVSFAPYSAEATRVAQAARAQGSRIVAITDSAVSPIALHADAQLIFTHDSPSFFPSLIAAHALAEALVAQLLALEGGDAIAALERAEAELHAKGAYVV
>NZ_CP013416.1|WP_059748952.1|2178533_2179394_-|isocitrate-lyase/phosphoenolpyruvate-mutase-family-protein
MTHPDLQSRHAHAFRALHAQPGAFILPNPWDAGTARLLAMAGFQALATTSAGYAYARGLPDNAVGRDAMLAHIAEIVAAGGLPVSADLENGFGDAPDTVAETIRLAAGAGAVGGSIEDATGRPDAPIYPHDAAVERIAAAVAAARALPFPFTLTARCENYLHGRRDLADTIARLVAYRDAGADVLYAPGLTDPDEIAELTRAVDAPVNVVMGLQGVSLSVDALAALGVKRVSVGSALARAALGAFLRGATEMMRDGTFSFANAAIPSRQLDRWFAAENNLPLSFEN
>NZ_CP013416.1|WP_059748962.1|2195970_2197005_-|rod-shape-determining-protein
MSTPLFGKLFAHPVAIDPGTATTRIYTHDRGVVLNQPSVICFRKPGGAVARQTLEAVGERAKALLGREPIHLEAVRPLQHGVIADAHAAEQMIRHFIDMSRTRSRFGRRVEVALCVPSSATAVERHALSEAALAAGAASVTLVDEALAAAFGAGLPVTDAIGSLVVDIGGGTTEVAVVALGGVVYREAIRIGGEQFDSAIISHVRALYGVQLGEQTAEHVKKTIGTASAGVPRETMRVVGRSAVDGLPRTIELSNHDVADALAAPLNAVVSAVKRTLENAPPELVTDIADCGIVLTGGGSLLANLGKRLRDETGLAVRVADDPLTCAVRGAAAAMGRVPMRAAA
>NZ_CP013416.1|WP_059748963.1|2197261_2199640_+|BamA/TamA-family-outer-membrane-protein
MTAPDSYRWRGVRRLSPMLAALWCCAAIAQPMPAAGAAAAPDAAALPNTAHACHPDGGPAGRPAVGLVLSGGGARGYAHLGVLKVLEENRIPIDCIAATSMGAVVGGLYASGMPAAEMQKRLSETNLADVAFDATERADLPQSRREDERLYANGATLGFSGKGVKAPTGIVQGNRLQALLADWTAAVPINQPFDQLPIPYRAIATDLQTGQMVVLDHGSLPLAIRASMAMPGLFAPAEINDRALVDGGLVRNLPVDSARQMGADVVIAVDIGSQLRPLDALASPADVMQQMVGILIRQNVASQRKQLTSRDVLLTPELGTLAFTDFQKANEAIAAGAAAATAALPHLKRYALTPEQYAAYRAAHTQPQPPAIRITDIEIRTSGGVPKRVVRDALHVKPGDTYDPKAVSGDLLSLTTGGSFESVTQQVVSHGDENRLVIDAREKYWGPNFLLFGLGMSSSSTDQGGFRLHVGYRRPWLTESGLEFRTDATVGSDLDAVHVELRQPLSVKYGDYIAPYAEYQRHYANLYDETGDVKVTQYMIQTARAGIDFGVPIGRLGDFRIGLAYTHSHGSPTYNLPDFFSDTPGGLLFSSYSADALSARARLVIDQLDDPMFPRKGYFAEFRAERSLMSRNGASAANLDDRITDAPYTELYGKLMVAQQYGRHSISAGVEGGKSIGGTNLINAFNFTLGGFQHLAAYAADQLNGDSLVYGQMTYMNQLATFSSSPVKALFIGASAEVGNVWSGGAGIGGGALKQSYTFFTSLTTAFGPLYMGVALAPGGRRNFYLQLGRTY
>NZ_CP013416.1|WP_059748964.1|2199672_2200803_-|sensor-histidine-kinase
MIKRPAAHPDAPHLSPLRYVRWRWMNFRRAWTDTRADRIPSWSRLYVRTYLHLLGLVLLTALMPALALCVVLSPRLVWHAFDALPGDVWLVLAFVLAAPALAAYRWMRPVWSDLVMVRERAIDFTGGRFNTRARESHSVIIGPLARTLNALAMRMERLIAAQRDLTNGISHELRTPLARVRFALEILREPGSAAEYESALDSIAQDVTELDELIDMSLTYARLEYSSLQSNLEPTAPAAWLEHQVKDAALLYPEKTIETRIAIAADVRVEMDRRLMSYAMRNLLRNASKYARSRIVVGIAIDHGNIGVYVEDDGPGVPESERERIFEAFVRLDRRTGGYGLGLAITRQVLQAHNGRIMVVDPAELGGARFEISWPI
>NZ_CP013416.1|WP_080409814.1|2201347_2201731_+|cytochrome-c
MKARELFIASLVALVLTQPSLSFSQNINGKNLYIQRCAMCHGADIKGTGPLAKKSNPATPDLTTAAFKKRLSDYPGVIVSSIILRPNGDLIPRTLRENGVKLAPHSWTVQDFRDLNKYMSDVISQSR
>NZ_CP013416.1|WP_059748965.1|2201863_2202253_-|hypothetical-protein
MSIRRTVALSVAAALAALSCFIGCAVIVSTLLHVETLTQLDRLVSFGYLSFADSLEISDAGGPADFFFGGIGLVLLGSLLLTKVPSVERIARGVACALFLFLASCLVYACLHSRVGEVPDYLRSAPTAR
>NZ_CP013416.1|WP_059748966.1|2202258_2202615_-|hypothetical-protein
MKLKEATIAMVVVLVACYIGAGAPPLDLLIKPSVVLNGLALKSGTWHYSNREDYAVPASEILASRFYTLIIAALCAACGIAVGRVKVTWKRLACFVAVAVALQFVFYYAQMRAFYLPW
>NZ_CP013416.1|WP_059748967.1|2202766_2203486_-|response-regulator
MSFRILLVEDDTRLSTLIAGYLRKNDYEVDTVLHGDAAVPAILSIRPDLVILDVNLPGKDGFEICREARKQYDGVIIMVTARDEPFDELLGLEFGADDYVHKPVEPRILLARIKAQLRRAPARVTDILAPQPERYTFGKFSIDRTDRTVMLPDGSAPDLTSAEFDLLWALVCHAGEVVSRDDLMLQLRGVEFDGLDRTIDGRISKLRRKLRDDASNPQRIKTIRSKGYQFSKHAWGEDE
>NZ_CP013416.1|WP_059748968.1|2203823_2205275_+|site-specific-integrase
MSTHLFKRGTRYYFRRRVPQDLIQRLGKKEYTIALNTSDRSVAVTLCHGYDATYDIIFRDEREALRKGETKAGYWDALPREQLENEEARDAEAWYQESEDMRAEAIAQFVELRLMARLQEMGLRRVGQDVVAQEAAAAIEAARESSSTALMNGPDARNLLTLFEIWKKKRNPTQKPIDDMKRTVDRFVKYVGDLPVPAIRKAHVVQFRNAMEDAGAKPTAIPSALARLHTLFNVAGGEAWITSNPAKGVTVETKKQNAKTRRPPFDTGTLNRIFSSRVYTDHFRPDAGAGDAAYWLPLLGLFTGARVEEMAQLAPSDVFQEEYHTGDGGRSTCWVMTFKNDEDAGQGVKNFSSIRRIPVHPELISRGFIDYTRTKEGSARIFPELRPDRYGVESTYWAQWFIRYLRAECAPSNPKMVFHSFRHTFKDVCRECGIDKSVRDALQGHSEGDSAGNYGGEFYPLRPLVEAMEKYVVHGVTLPPTSK
>NZ_CP013416.1|WP_059748969.1|2205353_2205899_+|lysozyme
MRQINRAIVARVAGAAGLAAALFTAQFEGHSNKVYLDPVGIPTVCDGHARTGPDGKPLRIGQTYSDDVCSYLLGKDISEADKAVQRLVKVPLSEGERIAYTDFAFNAGAANLAASTLLKKVNAGDHVGACRELPKWTCAAVEKGKGDASGMCATKDRTKKQLPGLVKRRDAAMTACLADLG
>NZ_CP013416.1|WP_059749003.1|2206110_2206368_-|hypothetical-protein
MRYSPPSAADLRKLKDSLDKTSEEMAELFALAGGQQWRKYTGGESPRVMGEDRLFYAAARLALTDDEIQRVYSKMREIGADIAPE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP013416_1	1.1\|1897816\|51\|NZ_CP013416\|CRISPRCasFinder	1897816-1897866	51	NZ_CP013416.1	1897399-1897449	0	1.0
NZ_CP013416_1	1.1\|1897816\|51\|NZ_CP013416\|CRISPRCasFinder	1897816-1897866	51	NZ_CP013416.1	1899109-1899159	0	1.0
NZ_CP013416_1	1.1\|1897816\|51\|NZ_CP013416\|CRISPRCasFinder	1897816-1897866	51	NZ_CP013416.1	1896031-1896081	2	0.961
NZ_CP013416_1	1.1\|1897816\|51\|NZ_CP013416\|CRISPRCasFinder	1897816-1897866	51	NZ_CP013416.1	1897057-1897107	2	0.961

1. spacer 1.1|1897816|51|NZ_CP013416|CRISPRCasFinder matches to position: 1897399-1897449, mismatch: 0, identity: 1.0

attcacgctggtcgacagcgacaccacgtcagtcgattcctgcgtcgacag	CRISPR spacer
attcacgctggtcgacagcgacaccacgtcagtcgattcctgcgtcgacag	Protospacer
***************************************************

2. spacer 1.1|1897816|51|NZ_CP013416|CRISPRCasFinder matches to position: 1899109-1899159, mismatch: 0, identity: 1.0

attcacgctggtcgacagcgacaccacgtcagtcgattcctgcgtcgacag	CRISPR spacer
attcacgctggtcgacagcgacaccacgtcagtcgattcctgcgtcgacag	Protospacer
***************************************************

3. spacer 1.1|1897816|51|NZ_CP013416|CRISPRCasFinder matches to position: 1896031-1896081, mismatch: 2, identity: 0.961

attcacgctggtcgacagcgacaccacgtcagtcgattcctgcgtcgacag	CRISPR spacer
attcacgctggtcgacagcgacaccacatcggtcgattcctgcgtcgacag	Protospacer
***************************.**.********************

4. spacer 1.1|1897816|51|NZ_CP013416|CRISPRCasFinder matches to position: 1897057-1897107, mismatch: 2, identity: 0.961

attcacgctggtcgacagcgacaccacgtcagtcgattcctgcgtcgacag	CRISPR spacer
attcacgctggtcgacagcgacaccacatcggtcgattcctgcgtcgacag	Protospacer
***************************.**.********************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

797235 : 846668

Burkholderia_phage(57.78%)

terminase,capsid,head,holin,protease,tRNA,integrase,portal,tail

attL 805162:805189|attR 848518:848545

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059759339.1\|797235_798276_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.4e-92	52.6
WP_155122541.1\|798274_799630_+	aminoacetone oxidase family FAD-binding enzyme	NA	NA	NA	NA
WP_004190342.1\|799705_799918_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_059759344.1\|800081_800528_+	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	2.2e-21	47.3
WP_059759346.1\|800601_802479_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	7.1e-66	36.7
WP_080410192.1\|802567_804979_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	4.9e-35	32.0
805162:805189	attL	NA	NA	NA	NA
WP_059759351.1\|805214_806396_-\|integrase	site-specific integrase	Q774Z5	Bordetella_phage	1.4e-131	59.2
WP_071733003.1\|806371_806581_-	excisionase	Q774Z6	Bordetella_phage	3.7e-24	76.8
WP_155122485.1\|806621_806768_+	hypothetical protein	NA	NA	NA	NA
WP_059627415.1\|807194_807434_-	hypothetical protein	A9YWV3	Burkholderia_phage	6.8e-22	67.9
WP_080410193.1\|808576_809608_-	DNA cytosine methyltransferase	A0A2I7QIW2	Vibrio_phage	8.8e-50	60.0
WP_059759359.1\|809625_810483_-	hypothetical protein	A0A2H4J418	uncultured_Caudovirales_phage	1.2e-68	48.0
WP_155122486.1\|810634_811300_+	hypothetical protein	NA	NA	NA	NA
WP_059759481.1\|811531_812014_+	hypothetical protein	Q6JII1	Burkholderia_virus	1.8e-34	52.7
WP_059759362.1\|812288_812585_-	hypothetical protein	NA	NA	NA	NA
WP_155122487.1\|812784_813306_-	hypothetical protein	NA	NA	NA	NA
WP_155122488.1\|813341_813635_+	hypothetical protein	NA	NA	NA	NA
WP_059759372.1\|814415_814754_+	hypothetical protein	A4JX41	Burkholderia_virus	1.6e-45	83.0
WP_059759375.1\|814801_815002_+	hypothetical protein	NA	NA	NA	NA
WP_059759378.1\|815375_815843_-	helix-turn-helix transcriptional regulator	Q3HQY7	Burkholderia_phage	1.3e-69	84.5
WP_059759381.1\|815901_816108_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_059490741.1\|816303_816558_-	hypothetical protein	Q8W6P6	Burkholderia_virus	5.2e-20	59.5
WP_059490742.1\|816714_817092_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_059759384.1\|817088_817277_+	hypothetical protein	NA	NA	NA	NA
WP_155122489.1\|817372_817546_+	hypothetical protein	Q3HQZ4	Burkholderia_phage	8.4e-06	77.8
WP_059759387.1\|817556_818411_+	hypothetical protein	C7BGF1	Burkholderia_phage	7.5e-71	56.2
WP_080410202.1\|819010_819508_+	hypothetical protein	Q8W6P0	Burkholderia_virus	4.1e-61	70.6
WP_088502546.1\|819708_820068_+	DUF1064 domain-containing protein	Q8W6N9	Burkholderia_virus	1.5e-28	62.2
WP_060015136.1\|820067_820400_+	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_059759394.1\|820396_820840_+	DUF1364 family protein	Q3HR02	Burkholderia_phage	1.9e-73	86.4
WP_080410196.1\|820836_821175_+	hypothetical protein	Q3HR03	Burkholderia_phage	8.3e-50	85.7
WP_059759398.1\|821171_821420_+	hypothetical protein	Q3HR04	Burkholderia_phage	4.3e-27	65.9
WP_059759486.1\|821465_821885_+	hypothetical protein	NA	NA	NA	NA
WP_155122490.1\|821947_822697_-	hypothetical protein	NA	NA	NA	NA
WP_059759405.1\|822897_823110_-	hypothetical protein	NA	NA	NA	NA
WP_080410197.1\|823260_823659_+	HNH endonuclease	Q3HR06	Burkholderia_phage	4.1e-56	80.5
WP_059490752.1\|823754_824234_+\|terminase	terminase small subunit	Q3HQS6	Burkholderia_phage	1.3e-61	85.5
WP_059759408.1\|824233_825946_+\|terminase	terminase large subunit	Q3HQS7	Burkholderia_phage	0.0e+00	94.4
WP_059759411.1\|825953_827249_+\|portal	phage portal protein	Q3HQS8	Burkholderia_phage	2.6e-208	84.0
WP_059759413.1\|827226_828066_+\|protease	Clp protease ClpP	Q3HQS9	Burkholderia_phage	6.5e-128	85.7
WP_059759416.1\|828070_829348_+\|capsid	phage major capsid protein	Q3HQT0	Burkholderia_phage	1.5e-195	81.1
WP_059759419.1\|829592_829934_+\|head,tail	phage gp6-like head-tail connector protein	Q3HQT2	Burkholderia_phage	6.4e-42	80.5
WP_059490926.1\|829936_830266_+\|head	phage head closure protein	Q8W6U2	Burkholderia_virus	7.9e-45	78.7
WP_059714961.1\|830258_830681_+	HK97 gp10 family phage protein	C7BGH3	Burkholderia_phage	6.1e-58	85.5
WP_059714959.1\|830677_831022_+	DUF3168 domain-containing protein	Q3HQT5	Burkholderia_phage	1.1e-41	77.2
WP_059759422.1\|831077_831533_+	hypothetical protein	Q3HQT6	Burkholderia_phage	1.1e-68	87.3
WP_059759425.1\|831560_832028_+\|tail	phage tail protein	C7BGC7	Burkholderia_phage	5.4e-47	65.5
WP_059759428.1\|832024_832309_+	DUF4035 domain-containing protein	Q3HQT8	Burkholderia_phage	8.3e-35	78.7
WP_059759432.1\|832321_836425_+\|tail	phage tail tape measure protein	C7BGC8	Burkholderia_phage	0.0e+00	71.2
WP_059759489.1\|836424_836763_+\|tail	phage tail protein	Q3HQU0	Burkholderia_phage	4.6e-48	79.5
WP_069240742.1\|836771_838082_+\|tail	tail fiber domain-containing protein	A0A0A1I5W1	Burkholderia_phage	8.9e-15	53.9
WP_059761334.1\|838166_838850_+\|tail	phage minor tail protein L	Q6JIL5	Burkholderia_virus	2.6e-114	82.8
WP_059761333.1\|838898_839651_+	C40 family peptidase	Q3HQU3	Burkholderia_phage	1.1e-121	79.4
WP_059761332.1\|839647_840229_+\|tail	tail assembly protein	Q8W6T1	Burkholderia_virus	4.6e-80	81.3
WP_080410293.1\|843524_843839_+	hypothetical protein	Q3HQU6	Burkholderia_phage	7.2e-48	88.2
WP_059761331.1\|843838_844558_+	hypothetical protein	A4JX18	Burkholderia_virus	1.9e-99	73.6
WP_059761330.1\|844613_844898_+\|holin	holin	C7BGD7	Burkholderia_phage	1.9e-39	90.4
WP_059761329.1\|844900_845320_+	glycoside hydrolase family protein	A0A1Q1PW74	Pseudoalteromonas_phage	1.2e-21	43.5
WP_059761328.1\|845316_845808_+	DUF2514 family protein	Q6J1Q4	Burkholderia_virus	1.1e-39	63.9
WP_059761327.1\|845864_846668_+	hypothetical protein	Q3HQV2	Burkholderia_phage	5.4e-47	41.0
848518:848545	attR	NA	NA	NA	NA

DBSCAN-SWA_2

2203823 : 2259754

Ralstonia_phage(35.48%)

terminase,transposase,capsid,head,protease,integrase,tail

attL 2200498:2200512|attR 2212890:2212904

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2200498:2200512	attL	NA	NA	NA	NA
WP_059748968.1\|2203823_2205275_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_059748969.1\|2205353_2205899_+	lysozyme	A0A0A1I5L5	Burkholderia_phage	4.1e-30	45.3
WP_059749003.1\|2206110_2206368_-	hypothetical protein	NA	NA	NA	NA
WP_059748971.1\|2206613_2206823_-	hypothetical protein	NA	NA	NA	NA
WP_080409817.1\|2206921_2207611_-	hypothetical protein	Q3HQV2	Burkholderia_phage	2.6e-66	55.6
WP_059748973.1\|2207832_2210142_-	DNA-dependent RNA polymerase	A0A2R2ZGE5	Ralstonia_phage	6.3e-80	32.4
WP_059748974.1\|2211253_2211445_-	hypothetical protein	NA	NA	NA	NA
WP_069240679.1\|2211623_2213189_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	4.4e-69	34.4
2212890:2212904	attR	NA	NA	NA	NA
WP_034190888.1\|2213220_2213571_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	2.5e-17	39.4
WP_063801159.1\|2213546_2214023_-\|transposase	transposase	NA	NA	NA	NA
WP_146750691.1\|2214376_2214724_-	hypothetical protein	A0A291LAS9	Bordetella_phage	9.2e-36	64.6
WP_059748695.1\|2215002_2215227_-	hypothetical protein	NA	NA	NA	NA
WP_059748694.1\|2215350_2215941_-	DNA polymerase III subunit beta	A0A1L7DQD4	Ralstonia_phage	1.1e-25	41.8
WP_059748693.1\|2215950_2216742_-	RNase H superfamily protein	A0A2P0VPF6	Ralstonia_phage	2.3e-98	65.8
WP_088510496.1\|2216738_2217113_-	hypothetical protein	A0A1L7DQG2	Ralstonia_phage	1.9e-23	58.3
WP_059748692.1\|2217128_2217638_-	HNH endonuclease	A0A1V0DYL4	Citrobacter_phage	6.7e-35	48.5
WP_059748698.1\|2217606_2218323_-	hypothetical protein	A0A068Q5R1	Ralstonia_phage	1.4e-67	55.7
WP_059748691.1\|2218541_2219372_-	hypothetical protein	A0A068Q6Y4	Ralstonia_phage	4.4e-68	54.1
WP_059748697.1\|2219392_2221732_-	DNA polymerase A family protein	A0A068Q7T8	Ralstonia_phage	4.6e-296	65.1
WP_059748690.1\|2221778_2222333_-	hypothetical protein	A0A2D1GNL9	Pseudomonas_phage	1.7e-39	50.0
WP_059748689.1\|2222329_2223283_-	ATP-dependent DNA ligase	A0A2D2W2E5	Stenotrophomonas_phage	2.0e-64	47.3
WP_059748688.1\|2223574_2223871_-	hypothetical protein	NA	NA	NA	NA
WP_155122517.1\|2223867_2224008_-	hypothetical protein	NA	NA	NA	NA
WP_059748687.1\|2224004_2225300_-	AAA family ATPase	A0A068Q6G7	Ralstonia_phage	3.4e-152	60.2
WP_059748686.1\|2225315_2225702_-	hypothetical protein	A0A0X8WNX5	Ralstonia_phage	2.2e-30	60.8
WP_059748685.1\|2225698_2226256_-	DNA primase	A0A077KVN4	Ralstonia_phage	2.9e-47	55.6
WP_059748684.1\|2226534_2226741_-	transmembrane Fragile-X-F family protein	NA	NA	NA	NA
WP_059748683.1\|2226737_2227025_-	hypothetical protein	NA	NA	NA	NA
WP_155122518.1\|2227034_2227202_-	hypothetical protein	NA	NA	NA	NA
WP_059748682.1\|2227198_2227585_-	hypothetical protein	NA	NA	NA	NA
WP_059748696.1\|2227949_2228204_-	hypothetical protein	B5BTU9	Ralstonia_phage	8.0e-21	68.6
WP_059748679.1\|2229752_2229986_-	hypothetical protein	NA	NA	NA	NA
WP_080409797.1\|2230670_2231840_+	helix-turn-helix transcriptional regulator	L7P7S1	Pseudomonas_phage	3.9e-22	32.4
WP_155122519.1\|2232094_2232520_+	hypothetical protein	NA	NA	NA	NA
WP_155122520.1\|2233634_2234042_+	TerS protein	A0A0F7L441	uncultured_marine_virus	8.8e-30	54.1
WP_059748676.1\|2234038_2235628_+\|terminase	terminase large subunit	F1C585	Cronobacter_phage	7.9e-183	64.1
WP_080409801.1\|2235590_2236229_+	peptidase U35	A0A0R6PGI7	Moraxella_phage	1.5e-31	48.7
WP_059748675.1\|2236242_2237577_+\|capsid	phage major capsid protein	S4TNE3	Salmonella_phage	1.4e-79	41.4
WP_155122521.1\|2237636_2237813_+	hypothetical protein	NA	NA	NA	NA
WP_059748673.1\|2239145_2239436_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_080409800.1\|2239468_2239807_+\|head	phage head closure protein	NA	NA	NA	NA
WP_059748672.1\|2239799_2240156_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_004526590.1\|2240155_2240593_+	hypothetical protein	NA	NA	NA	NA
WP_059748671.1\|2240741_2241077_+	hypothetical protein	NA	NA	NA	NA
WP_155122522.1\|2241097_2241445_+	hypothetical protein	NA	NA	NA	NA
WP_080409750.1\|2241407_2241851_+	hypothetical protein	NA	NA	NA	NA
WP_059748670.1\|2241834_2244648_+\|tail	phage tail protein	C7BGC8	Burkholderia_phage	2.4e-09	25.2
WP_059748669.1\|2244644_2244989_+\|tail	phage tail protein	Q8W6T5	Burkholderia_virus	1.2e-16	42.6
WP_155122523.1\|2244992_2246300_+	hypothetical protein	A0A0A1I5W1	Burkholderia_phage	8.9e-15	53.9
WP_080409840.1\|2246290_2246971_+\|tail	phage minor tail protein L	A4JX13	Burkholderia_virus	8.0e-60	53.1
WP_080409839.1\|2246967_2247699_+	C40 family peptidase	Q8W6T2	Burkholderia_virus	2.4e-78	58.0
WP_155122543.1\|2247717_2248278_+\|tail	tail assembly protein	Q6JIL3	Burkholderia_virus	1.5e-48	54.5
WP_059749345.1\|2248274_2251676_+	host specificity protein J	Q3HQU5	Burkholderia_phage	0.0e+00	57.1
WP_059749344.1\|2252715_2252985_+	hypothetical protein	NA	NA	NA	NA
WP_059749343.1\|2252984_2253305_+	hypothetical protein	NA	NA	NA	NA
WP_059749341.1\|2253648_2254563_+	glutaminase	NA	NA	NA	NA
WP_155122524.1\|2254699_2255317_-	hypothetical protein	NA	NA	NA	NA
WP_155122525.1\|2255624_2256023_-	hypothetical protein	NA	NA	NA	NA
WP_155122526.1\|2256177_2256330_+	hypothetical protein	NA	NA	NA	NA
WP_059749357.1\|2256349_2257801_-	hypothetical protein	NA	NA	NA	NA
WP_080409841.1\|2258127_2258772_-	response regulator transcription factor	NA	NA	NA	NA
WP_059749338.1\|2258815_2259754_-\|protease	serine protease	NA	NA	NA	NA

DBSCAN-SWA_3

2303809 : 2366410

Planktothrix_phage(33.33%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059749309.1\|2303809_2304829_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_059749308.1\|2305114_2305609_+	vanillate O-demethylase oxidoreductase VanB	NA	NA	NA	NA
WP_059749307.1\|2305694_2306240_+	hypothetical protein	NA	NA	NA	NA
WP_059749306.1\|2306992_2307595_+	hypothetical protein	NA	NA	NA	NA
WP_059749350.1\|2308703_2309624_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_059749349.1\|2309693_2310062_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_059749303.1\|2310158_2310632_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_059749302.1\|2310687_2311515_+	hypothetical protein	NA	NA	NA	NA
WP_080409835.1\|2311527_2311920_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.7e-07	38.0
WP_010089867.1\|2312002_2312704_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.3e-16	30.0
WP_059609647.1\|2312703_2313477_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.9e-13	29.2
WP_059665207.1\|2313473_2314745_-	high-affinity branched-chain amino acid ABC transporter permease LivM	NA	NA	NA	NA
WP_059609649.1\|2314756_2315683_-	high-affinity branched-chain amino acid ABC transporter permease LivH	NA	NA	NA	NA
WP_059749348.1\|2315853_2316975_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_063801125.1\|2317836_2318442_+	hypothetical protein	NA	NA	NA	NA
WP_059749299.1\|2318441_2319041_+	hypothetical protein	NA	NA	NA	NA
WP_059749298.1\|2319057_2319597_+	hypothetical protein	NA	NA	NA	NA
WP_059749297.1\|2319895_2320525_+	hypothetical protein	NA	NA	NA	NA
WP_059749295.1\|2322324_2322834_-	OmpA family protein	NA	NA	NA	NA
WP_059749294.1\|2322921_2324190_-	diguanylate cyclase	NA	NA	NA	NA
WP_059749293.1\|2324186_2324888_-	YfiR family protein	NA	NA	NA	NA
WP_059749292.1\|2325341_2326517_+	class C beta-lactamase	NA	NA	NA	NA
WP_059749291.1\|2326565_2327279_+	hypothetical protein	NA	NA	NA	NA
WP_059749290.1\|2327404_2327983_-	hypothetical protein	NA	NA	NA	NA
WP_080486051.1\|2328487_2329510_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	4.5e-46	35.6
WP_080486059.1\|2329942_2331178_+\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	5.5e-99	63.3
WP_059753563.1\|2331469_2332711_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_155122527.1\|2332826_2333264_-	hypothetical protein	NA	NA	NA	NA
WP_088510600.1\|2333257_2333872_-	N-acetylmuramoyl-L-alanine amidase	NA	NA	NA	NA
WP_080410051.1\|2333872_2334355_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_059753558.1\|2334821_2335580_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_059753556.1\|2335686_2336559_-	amidohydrolase family protein	NA	NA	NA	NA
WP_042588448.1\|2336589_2337531_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_059753659.1\|2337571_2338609_-	ABC transporter permease	NA	NA	NA	NA
WP_059753552.1\|2338630_2340187_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	5.4e-19	30.3
WP_059753548.1\|2340222_2340999_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_059753544.1\|2341038_2342316_-	L-fuconate dehydratase	NA	NA	NA	NA
WP_059718882.1\|2342362_2343205_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_059753540.1\|2343245_2344010_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_059753536.1\|2344603_2344894_+	DUF3331 domain-containing protein	NA	NA	NA	NA
WP_059753656.1\|2345032_2346028_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_059753533.1\|2346243_2346546_+	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_059753530.1\|2346709_2347897_-	DUF971 domain-containing protein	NA	NA	NA	NA
WP_059753527.1\|2347919_2348843_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_059753523.1\|2348858_2349353_-	4-hydroxybenzoyl-CoA thioesterase	NA	NA	NA	NA
WP_042588458.1\|2349355_2350321_-	L-carnitine dehydrogenase	NA	NA	NA	NA
WP_059753520.1\|2350400_2351330_-	3-keto-5-aminohexanoate cleavage protein	NA	NA	NA	NA
WP_059753652.1\|2351397_2352351_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_059753517.1\|2353024_2353981_+	hypothetical protein	NA	NA	NA	NA
WP_059753513.1\|2354035_2355070_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_059753510.1\|2355310_2356255_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_059753507.1\|2356766_2358479_+	peptidase	NA	NA	NA	NA
WP_059753504.1\|2358559_2359801_+	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_042588463.1\|2359936_2360302_+	YbjQ family protein	NA	NA	NA	NA
WP_059753500.1\|2360346_2361219_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_059753649.1\|2361350_2361983_+	FMN-dependent NADH-azoreductase	NA	NA	NA	NA
WP_059753496.1\|2362476_2363619_-	porin	NA	NA	NA	NA
WP_059753492.1\|2363865_2364837_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_059753489.1\|2364874_2366410_-\|holin	choline-sulfatase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP013414

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP013415

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP013416

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection