CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP013443	Burkholderia cepacia strain MSMB1184WGS chromosome 1, complete sequence	0 crisprs	csa3,cas3,DEDDh,RT,Cas14u_CAS-V,DinG,PD-DExK	0	0	5
NZ_CP013444	Burkholderia cepacia strain MSMB1184WGS chromosome 2, complete sequence	2 crisprs	cas3,csa3,DinG,Cas14u_CAS-V,PD-DExK	3	4	4
NZ_CP013442	Burkholderia cepacia strain MSMB1184WGS chromosome 3, complete sequence	1 crisprs	NA	2	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013444_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013444_1

568974-569255

Orphan

Consensus_repeat	Method
GGANGACGTACCCGAGGA	CRT

6 spacers

The CRISPR arrays of NZ_CP013444_1

>merge|NZ_CP013444|1|568974-569255|CRT
GCCTGAGGTGCCCGAGGACGTGCCTGAGGACGTACCGGAAGACGTACCCGAGGACGTACCCGAGGACGTGCCGGAAGATGTGCCGGAAGATGTGCCGGAGGACGTACCCGAGGACGTGCCGGAGGACGTACCCGAAGACGTGCCGGAGGACGTACCCGAAGACGTGCCGGAAGACGTGCCGGAGGACGTACCCGAGGACGTACCCGAGGATGTGCCCGAGGACGTACCGGAAGACGTACCCGAGGATGTGCCGGAGGACGTACCCGAGGACGTACCCGAGGA

>NZ_CP013444|1|1|568974-569255|CRT
GCCTGAGGTGCCCGAGGA	CGTGCCTGAGGACGTACC
GGAAGACGTACCCGAGGA	CGTACCCGAGGACGTGCCGGAAGATGTGCCGGAAGATGTGCC
GGAGGACGTACCCGAGGA	CGTGCCGGAGGACGTACCCGAAGACGTGCC
GGAGGACGTACCCGAAGA	CGTGCCGGAAGACGTGCC
GGAGGACGTACCCGAGGA	CGTACCCGAGGATGTGCCCGAGGACGTACC
GGAAGACGTACCCGAGGA	TGTGCCGGAGGACGTACC
CGAGGACGTACCCGAGGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013444.1\|WP_069274024.1\|573378_574026_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP013444.1\|WP_059958811.1\|564485_564923_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013444.1\|WP_069274020.1\|569894_570293_+\|4-carboxymuconolactone-decarboxylase	unknown	unknown	gnl\|CDD\|131478
NZ_CP013444.1\|WP_060135314.1\|556301_556748_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013444.1\|WP_060135311.1\|556935_557409_+\|DUF1795-domain-containing-protein	unknown	unknown	gnl\|CDD\|370123
NZ_CP013444.1\|WP_069270935.1\|574038_576045_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372641
NZ_CP013444.1\|WP_069274026.1\|576967_577924_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP013444.1\|WP_069274022.1\|571344_572946_-\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224983
NZ_CP013444.1\|WP_069274028.1\|578728_579703_+\|pyridoxamine-5'-phosphate-oxidase	unknown	unknown	gnl\|CDD\|274926
NZ_CP013444.1\|WP_069274018.1\|564941_565739_-\|histone-acetyltransferase	unknown	unknown	unknown
NZ_CP013444.1\|WP_069274023.1\|572942_573290_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|235628
NZ_CP013444.1\|WP_155123184.1\|563964_564348_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319898
NZ_CP013444.1\|WP_155123182.1\|562531_563158_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013444.1\|WP_155123183.1\|563248_563875_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319898
NZ_CP013444.1\|WP_069274027.1\|578050_578695_+\|glutathione-S-transferase-family-protein	unknown	unknown	gnl\|CDD\|198315
NZ_CP013444.1\|WP_069274025.1\|576507_576780_+\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	unknown	unknown	gnl\|CDD\|376852
NZ_CP013444.1\|WP_069274019.1\|566311_567595_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013444.1\|WP_069270928.1\|557424_561666_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225750
NZ_CP013444.1\|WP_069274021.1\|570329_571316_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|184875
NZ_CP013444.1\|WP_080485718.1\|561665_562181_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP013444.1\|WP_069274024.1\|573378_574026_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	3.25989e-09
NZ_CP013444.1\|WP_155123183.1\|563248_563875_+\|hypothetical-protein	gnl\|CDD\|319898	cd06587, VOC, vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). Type I extradiol dioxygenases catalyze the incorporation of both atoms of molecular oxygen into aromatic substrates, which results in the cleavage of aromatic rings. They are key enzymes in the degradation of aromatic compounds. Type I extradiol dioxygenases include class I and class II enzymes. Class I and II enzymes show sequence similarity; the two-domain class II enzymes evolved from a class I enzyme through gene duplication. Glyoxylase I catalyzes the glutathione-dependent inactivation of toxic methylglyoxal, requiring zinc or nickel ions for activity. The antibiotic resistance proteins in this family use a variety of mechanisms to block the function of antibiotics. Bleomycin resistance protein (BLMA) sequesters bleomycin's activity by directly binding to it. Whereas, three types of fosfomycin resistance proteins employ different mechanisms to render fosfomycin inactive by modifying the fosfomycin molecule. Although the proteins in this superfamily are functionally distinct, their structures are similar. The difference among the three dimensional structures of the three types of proteins in this superfamily is interesting from an evolutionary perspective. Both glyoxalase I and BLMA show domain swapping between subunits. However, there is no domain swapping for type 1 extradiol dioxygenases.	0.00012838
NZ_CP013444.1\|WP_069274026.1\|576967_577924_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.6548e-69
NZ_CP013444.1\|WP_069270935.1\|574038_576045_-\|hypothetical-protein	gnl\|CDD\|372641	pfam13589, HATPase_c_3, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase. This family represents, additionally, the structurally related ATPase domains of histidine kinase, DNA gyrase B and HSP90.	7.45851e-15
NZ_CP013444.1\|WP_069274022.1\|571344_572946_-\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224983	COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism].	3.7487e-131
NZ_CP013444.1\|WP_069274028.1\|578728_579703_+\|pyridoxamine-5'-phosphate-oxidase	gnl\|CDD\|274926	TIGR04025, hypothetical_protein, PPOX class probable FMN-dependent enzyme, DR_2398 family. Members of the PPOX family (see pfam01243) may contain either FMN or F420 as cofactor. This subfamily consists of proteins mostly from species that lack the capability to synthesize F420, and therefore most likely all bind FMN.	2.13786e-17
NZ_CP013444.1\|WP_069274023.1\|572942_573290_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|235628	PRK05855, PRK05855, SDR family oxidoreductase.	2.45069e-16
NZ_CP013444.1\|WP_155123184.1\|563964_564348_+\|hypothetical-protein	gnl\|CDD\|319898	cd06587, VOC, vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). Type I extradiol dioxygenases catalyze the incorporation of both atoms of molecular oxygen into aromatic substrates, which results in the cleavage of aromatic rings. They are key enzymes in the degradation of aromatic compounds. Type I extradiol dioxygenases include class I and class II enzymes. Class I and II enzymes show sequence similarity; the two-domain class II enzymes evolved from a class I enzyme through gene duplication. Glyoxylase I catalyzes the glutathione-dependent inactivation of toxic methylglyoxal, requiring zinc or nickel ions for activity. The antibiotic resistance proteins in this family use a variety of mechanisms to block the function of antibiotics. Bleomycin resistance protein (BLMA) sequesters bleomycin's activity by directly binding to it. Whereas, three types of fosfomycin resistance proteins employ different mechanisms to render fosfomycin inactive by modifying the fosfomycin molecule. Although the proteins in this superfamily are functionally distinct, their structures are similar. The difference among the three dimensional structures of the three types of proteins in this superfamily is interesting from an evolutionary perspective. Both glyoxalase I and BLMA show domain swapping between subunits. However, there is no domain swapping for type 1 extradiol dioxygenases.	0.000222877
NZ_CP013444.1\|WP_069274020.1\|569894_570293_+\|4-carboxymuconolactone-decarboxylase	gnl\|CDD\|131478	TIGR02425, putative_gamma-carboxymuconolactone_decarboxylase, 4-carboxymuconolactone decarboxylase. Members of this family are 4-carboxymuconolactone decarboxylase, which catalyzes the third step in the catabolism of protocatechuate (and therefore the fourth step in the catabolism of para-hydroxybenzoate, of 3-hydroxybenzoate, of vanillate, etc.). Most members of this family are encoded within protocatechuate catabolism operons. This protein is sometimes found as a fusion protein with other enzymes of the pathway, as in Rhodococcus opacus, Streptomyces avermitilis, and Caulobacter crescentus. [Energy metabolism, Other].	5.35532e-38
NZ_CP013444.1\|WP_069274027.1\|578050_578695_+\|glutathione-S-transferase-family-protein	gnl\|CDD\|198315	cd03206, GST_C_7, C-terminal, alpha helical domain of an unknown subfamily 7 of Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.	1.15223e-48
NZ_CP013444.1\|WP_060135311.1\|556935_557409_+\|DUF1795-domain-containing-protein	gnl\|CDD\|370123	pfam08786, DcrB, DcrB. DcrB is a bacterial protein required for phages C1 and C6 adsorption. It may be involved in the opening or formation of diffusion channels in the outer membrane. Structurally, it consist of an antiparallel beta sheet with some alpha helical regions.	4.51107e-44
NZ_CP013444.1\|WP_069270928.1\|557424_561666_+\|hypothetical-protein	gnl\|CDD\|225750	COG3209, RhsA, Rhs family protein [Cell envelope biogenesis, outer membrane].	8.50766e-36
NZ_CP013444.1\|WP_069274021.1\|570329_571316_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|184875	PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional.	2.74187e-25
NZ_CP013444.1\|WP_069274025.1\|576507_576780_+\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	gnl\|CDD\|376852	pfam02604, PhdYeFM_antitox, Antitoxin Phd_YefM, type II toxin-antitoxin system. Members of this family act as antitoxins in type II toxin-antitoxin systems. When bound to their toxin partners, they can bind DNA via the N-terminus and repress the expression of operons containing genes encoding the toxin and the antitoxin. This domain complexes with Txe toxins containing pfam06769, Fic/DOC toxins containing pfam02661 and YafO toxins containing pfam13957.	4.52018e-10

>NZ_CP013444.1|WP_069274019.1|566311_567595_-|hypothetical-protein
MNSTLEGISAVQDRPPHSATPLRAGLLGIAAGLFALWITRGQPALDGATRAVIASLAIIGTIALHEIFISRVYLRPSAGLSRQAVRPLGIARVATRLGALASIYAGIGVVYWLLPEYHGTFYRPFWSLLRSLAPYVIVAAPFYFAWMDRHQRETDDAYLLWGRFLFRREPPASWKPVREMLAGWGVKAFFLPLMTVYLSKDADHLTASLANAMHAPATIATFVFMYDLSFTMDLMFGTVGYLCTFRILDSHVRTVEPTTLGWVAALMCYQPFWSLFSNNYIRYEGTLFWDNWLLCAPAIRVAWGAVIILLLLTYALCTISFGLRFSNLTNRGIITSGPYRFTKHPAYITKNLSYWMVSVPFVEPLGWQVGLMHCAGLVAVNLIYYTRAKTEERHLMRDPDYRAYAEWIAQHGLFARIRRVFGQQQAG
>NZ_CP013444.1|WP_069274018.1|564941_565739_-|histone-acetyltransferase
MRIDVQHSQHDIDDELDSLYARLHQPGHRLHGLPAVALGRSGLIVRHREADGEYFLYVEDPATRQLAGYTVFNRLPEIPRRADRYLRAPHSKFRASFQRKGLATTLYRWGLDAGLCLISGARQSVGAARLWTMLAREYRHGFVDIEGRELRYLGECVSDDVHGALHTRRLLLGTGWTMGEFAEVVGMTDGPAIAHDRSVRTSARWPEWPVRVPPNGDAPDARSIVPGASTIVAKQSGAASRRQAGPGHDCRAFQTESPIRLRKDT
>NZ_CP013444.1|WP_059958811.1|564485_564923_+|hypothetical-protein
MPLLLLRNFDCAREVLQYATDHGPKALVTHDPARQPDRGYFTVVDGHYYGVFASATGPVAFRDAQQWMLCENQVLTEMKLLPDGRKRFVVTIRNERVLDVVYQPSGIVVDNWSDDERMIDFFAWLRDGMSSGALGQFVSFYTLSA
>NZ_CP013444.1|WP_155123184.1|563964_564348_+|hypothetical-protein
MRADIFVPTVSVDEQVRFYVKELRLFVVSQDYGMGEILLRHIDCPSFCLQLQPNRSPSGDWPIFCMTTEDCRSEFARLSVVAFQKGGLVPDAGAGAQPYEYPLGQTISLRDASGNLFLITEWHPSAL
>NZ_CP013444.1|WP_155123183.1|563248_563875_+|hypothetical-protein
MALLLLRSFDRTTEILRNEVDGRSQALAASDSAQLLSRGYFTSADGRLDTCRRVGQRVDAVIAAQAATADAAVRLEARVPAMSGAELKNIVFVPSKSTEESVEFYVNELALFEVADDLGRGNVFLRYIRSEDFYLMLSLELGVREGDAPIFSVWVDDCFGEYNRLKGFDFKSGAEILSNPGFVEWPLGKFLKIRDPAGNVFDLSEWYV
>NZ_CP013444.1|WP_155123182.1|562531_563158_+|hypothetical-protein
MDARFYVVQYRQGEFGCPHFLSGAVNRDEWEWSMYVGDPFSVAVEHDYIYQLADSKDSVDFDFYGSQTNFVSEQFLQVCDAMKVRYRAIPLRITCDGKDVGDKRYSIFLPAERAALLDRSSSEFLEDRDMESGEIAENNLFPGTPMYSWIKRFVPRDDCTSALFRSVEIMELVCNEKFKEAAERAVLKGIEFIPIDSNYIYDPWGEAS
>NZ_CP013444.1|WP_080485718.1|561665_562181_+|hypothetical-protein
MLLDSVKIDVDFNGIVIFSYPDLMNFFADPVVNGQNILSDFTQTDLGDKVVDGGVVLPIINIDDGGYLVRFFEGDPESSVRRRVVFSDSGYVLKIDGDLYIADAAVFWDWGEYLGWTKVAIPRGYYSVKIEGVQHISDDGSVGSIGYDVIVNRVEDLPKRTAQIRQDSRVS
>NZ_CP013444.1|WP_069270928.1|557424_561666_+|hypothetical-protein
MFEAARVTDPIEHTSALAGFLIGAVIGVALIAAVAFATFTCGFGVALLAGLVAGVGAGAILSLGEAIGKMFSSPSGAIVTGSANVFINGKPAAYATLSGTACDKHNPVPLVAQGSTNVFINGRPAARKDDKITCGAAIGDGSHDTFIHGGTETYLPVDDEVPPWLRTTVDWAFALAGLVGGLAGLVKAAGGLSRAVLPCAAKFIGGFVLGEAVGRYVAGPAINRAIGGMFGNPVDVTTGRKILLAESETDYVIPAPLPVAIRRFYSSGLDHVGTLGRGWVLPWDLRLQARDGRLWYTDAQGRESGFPLVRNGQSSFSESEQRYLTCTPDGRYVLHDVGETYYDFGRLDPDTDRIAWVRRIEDQAGQWTQFERDSQGRVREILTCGGIQAVLDYEAVHGRLATVTLVHGDERRLAVAYGYDDNGQMASVTDANGAVVRRFAYADGLMTSHTNALGFVSSYKWAAIGGQPRVVATQTSEGEHWTFEYDLDARESRVRHLDGRSARWRYDAQFQVVECTDLDGAQYRIEYNDAGRPIAFMLPGERKVALEYDDAGRIVAETDPLGRTTRTRYDGNSLRPVEITAPDGGVWQAEYDRQGRLLLSRDPLGRINRYEYPDGLTSQPAAHVDARGGRKALAWNRLGQLVAYTDCSGKTTRSEFDAFGLPVATENALGQRVSYAMRPTGEPVRIAYPDGSEESFEYDAAGLVVRHVGLGGRIRQSIRNARGQLREAIDPAGRRLVYRYDAEGRLFELLNDHARYAFAYDAGGRLLSETRPDGVKRRFAYDDAGGLRELTIVGAADDANRRDAQAVRVLRFERDLMGNLTAQHTPTDVTRYERDAGDRLLAVERTPTDAGVALGIEPDAVRFEYDKGGRLIAEHGVNGTVGYALDELDNVSTLSLPHEQTLQMLRYGSGHVHQIRCGDQVVSDFERDDLHREILRTQGRLVERSGYDLLGRKLWQAAGLSPETTGRMRGQLWRNYGYDAAGELTEMSDSLRGSTQYSYDPAGRLMRQYRTADRHLEEFAWDAAGNLLDDGQRRSRGYVEGNRLRMWQDLRFAYDAFGNLATKQQGPNRTQRFGYDGQDRLIAVRTEDASGVVEARFEYDPLGRRTAKTETCFDHRGVELRAERKRFVWEGLRLAQEIRETGVSSYVYSPDAPYTPAARVDAVIADAVAAVAIDEAKHAARVYHFHTDLVGAPLEVTDEAGEVAWAGRYSAWGKVDAGDRQLAAPRIEQPLRYAGQYADDSTGLHYNTFRFYDPDVGRFVNQDPIGLGGGNNLYAYVPNPVSWIDPLGWMPWPWNPNGMGHHLIPRGKANSIGLDALGTERNTPTFFPDPYEAGMHEELHRAIKGDVGKLQGPWTGTAEELFEATSKGLDSVSHIKGDLRIPATGEVLATNVTPKQAHAKLVDWFKSKKGGGC
>NZ_CP013444.1|WP_060135311.1|556935_557409_+|DUF1795-domain-containing-protein
MTDPDNRIRIHEGSITLPDGFEDRTTNLFVPADPANQPNLSVARDWLKDGETLAPYVDRQLALLKSRLQGHKLIARQAERLGPDDHRALAGERIDASHRNGTRVVFQRQAAFIVAPGRVLIFTASSARAFNDELDASWRTWLDGYRPADETGEAGLA
>NZ_CP013444.1|WP_060135314.1|556301_556748_+|hypothetical-protein
MTQSTMTLWQAIDALALQVPFSKAKVEHALSTRLTATDEEGNDVFQFFKSTPVTLTDGVVIKNVDLRVKRQGAHPGFMVLELGGPCVGLDAVRARYSHLEITDVPRGRSLEEATTHSAQLPWGQLSFGFEERNPACLATVSFKPKKQD
>NZ_CP013444.1|WP_069274020.1|569894_570293_+|4-carboxymuconolactone-decarboxylase
MSEQDREYGKARRIDVMGEAFVERAMRDLDGFSRPLQNWLNEHAWGSTWQRGGIDLKTRSLCTCAMLAALGRSTELKGHIRGALNNGASLVEIREVLLHSALYAGAPAAVEAFRSAREVISDLGLSVPDSED
>NZ_CP013444.1|WP_069274021.1|570329_571316_-|alpha/beta-fold-hydrolase
MTPTLHLIQQALIAVAAVCAALAAFTWYIAHRVTRAFPPEGRFVDVGGDRIHYVEYGNGPPIVFVHGLAGQLRNFAYLPLQQLAERHRVILLDRPGAGRSLRGAASQANVFAQARTVAAFIDALKLDKPVLVGHSLGGAIALAVGLNHADRVSRLALIAPLSHLEAEPPGPFRPLLIPSKLVRRFVSWTFAIPLTILTGRKAVRQVFAPEDVPRDFPVKGGGLLGLRPRSFYATASDLIAVPVDLPAMERRYADLALPVDVLYGRADPILNWREHGDALAKKSARVRLKVVEGGHMLPVTIPGATAEWLAEVAAAPLEAHAPVAQAGR
>NZ_CP013444.1|WP_069274022.1|571344_572946_-|NAD(P)/FAD-dependent-oxidoreductase
MTTTTTDRRDAPPAFDRHASAGGTRRDGADLDVLIVGAGLSGIGAAYHLKQRCPYASVAIVEARDAIGGTWDLFRYPGVRSDSDMFTLGYSFRPWHSDKAISDGQTILDYIRDTARTYGIDKTIRYGQKVVAADWDSNRARWTVRVERGGGSDAPAETLALTCRFLFMCSGYYDYDAGYLPDWAGMDTFEGKLVHPQHWPKDLSYANRRVVVIGSGATAVTLVPSMAADAQHVTMLQRSPTYIVSLPARDRIANALRRVLPSRLAHRLVRVKNVLLTIYLYNVSRRKPEQTKKFIIRAASKQLGPGFDVAKHLTPRYMPWDQRVCLVPNGDLFKSIRAGRASIVTDEIERFTPTGLKLKSGQQLDADVIVTATGLKVKMLGGARVTVDGRAVDLPQTVSYKGMMYSDVPNLASSFGYTNASWTLKAELIARYVCRLLNHMRANDYDTCVPRLGAGELGDVPAVNLSSGYIQRAAGILPKQGHRKPWKFHQNYVRDLASLKFSALADSAMHFERRAKPDACAASVPQPALDTRA
>NZ_CP013444.1|WP_069274023.1|572942_573290_-|SDR-family-NAD(P)-dependent-oxidoreductase
MNGFSGKVAAITGAGSGMGRSLAVELARRGCEVALADVDETGLAGTAAACAQHGVRVSTRRLDVADARRLDRIARLLGAGYQRLMLRHVRRARTRNLQRAHAPAARPTTPTKDPV
>NZ_CP013444.1|WP_069274024.1|573378_574026_+|TetR/AcrR-family-transcriptional-regulator
MSNSGMEKALETEKRGRSYGGVAPEVRAAERRDALIGAATRVFGTVGFRKATVRSICQEAKLNDRYFYAAFDSIEDLLRCTYLHHAQQLHDAVARAVAERGGDLRESVDAGLAAFFAFLRDPCAARVLLLEVMGVSADTDMTYQRMLIDFGKLIMAIGGRGEAVAGPERTEQRLIGLALVGAMTNVGAAWLLTEYRDPEAQMVASCRKVLLGTLG
>NZ_CP013444.1|WP_069270935.1|574038_576045_-|hypothetical-protein
MATEEYPVEVQSDFLEKMTRAKPISALSELVWNAFDADAKNVDISFEYNDLDTLDTIIVKDDGEGIPRAEAAGFFRSLGGSWKKSRTQTSGGRFLHGQEGRGRFKAFALGSDAEWAVVYKRDGKFWSYTIRMSALDIRHVRISDETKAKDATDTGVTLTIRNALKDFRTFTTEDGREELTEVFALYLADYEDTKIVLDGRAIDPGSAITDKKSFPLSDIEIDGKAYWARLQVVEWKSAGNRALYLCNQQRFPLVQVDRRFHIGQFQFSGYLHSPYFDQAQMEGTVDLAEMQPAVLSTIAEAQQTIKDHFRSRAAKEARTVVEEWKDEEVYPFSGDPATAVEKVERQVFDIVAVNIARHLPDFRTTQSKTKAFQLRMLRQAIERSPEDLQVILDEVLRLPKRQQEELAQLLRNTSLSSIIGAAKVVSDRLKFLSGLEAVLFDPEPKKRLKERTQLHRIIADNCWLFGEEFALSVDDQSLTMALVEHKKLLGSEVVIDEPVKHISQMRGIIDLMLSRATKQHRANQLTHLVVELKAPKVKIGSDEVTQIQGYAFSVMSDPRFDKVGVTWNFWVISDTLDRYTEHLVQDETGVILSKPNVNIYAKTWAQVLDENRARLKFFQDHLNVQVDREASLQYLQERYAAYLEGVFEESNDATAPVAEEDTAGTTSE
>NZ_CP013444.1|WP_069274025.1|576507_576780_+|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin
MKFPTRVKPISYLKSHAAEIVKDISESREPMLITQNGEAKLVVMDVKSYEEREVTLALLKLLALGNREIEQGHFRAVEDVFTELDEDGER
>NZ_CP013444.1|WP_069274026.1|576967_577924_-|LysR-family-transcriptional-regulator
MADLRDVNLNRLAIFVAVVDAGSLTAAAERLGLAKTVVSTHMQRLESEVGANLLVRTTRRLSVTDAGRAFYDACRDIVRAAESALDAVSSDAGPLRGTLRVSVPIDYGALVVAPAVVALRDRHPGLDVELVANDRVVDLVADNLDVAIRIGRLADSNYRAVQLGTYEKWLVASPAFVARWGLPRDPAALAALPFVMLSTLPRPHTFELESARGGKASVRCTAHVVSNTATACRAIVLAGGGFGLLTDFSTADDVAAGRLVRLLPAWRSAPAGIHAVYPSTRLPSPKVRAFVDAMREKIGAAPVRATRGRSTKSKRASG
>NZ_CP013444.1|WP_069274027.1|578050_578695_+|glutathione-S-transferase-family-protein
MPVAEKPSVPIRVYSFLLSGHAHRVRLFLSLLGLPSETVDVDLAAGEQRRPAFLALNPLGQVPVIDDGGTVIADSNAILVYLAKRYGDAHWLPDDPASAAVVQRWLSYAAGPIAAGPAAARLVTVFGAPLDHEQAKRIAVRLFDAIDAEFAKQPFAAGAQPTIADIAAYSYIAHAPEGGVSLEPYPHVRAWLARVEALPGFVAMPTTRAGLLAA
>NZ_CP013444.1|WP_069274028.1|578728_579703_+|pyridoxamine-5'-phosphate-oxidase
MTAPTVAPPGWELDVSPFHAGELAVQQRAGVADAASAVGLRGIRRFMPDQHRTFFAQLPFFVLGGIDANGQPWATLRAGAPGFVTSPDPRTLRIAGDTLPGDPLDGAWQPGAPLGGLGIEFDTRRRNRVNGVVRAVDGDALTIAVEQSFGNCAKYIQSRTPVFDPRGDAAPPRLERSARLSDADRALLARADTFFVASANTAADAGAARGADVSHRGGMPGFVRVDDAHTLTTPDFSGNRFFNTLGNLQQDPRAGLLFVDFDNGDLLYVAARAEIVWDGPLVASFDGAQRVVRYRVQEVRRGVAVLPFRWSAVERAPQFRVRLA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013444_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013444_2

3158182-3158387

Orphan

Consensus_repeat	Method
GCGCCGCCGCCGAGGGCGCCGCCGAT	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP013444_2

>merge|NZ_CP013444|2|3158182-3158387|CRISPRCasFinder
GCGCCGCCGCCGACCGCCGCACCCAGCAGGCCGCCCGTGCGGCCGCCCATCGCATTGCCTGCCGCCGTGCCAGCGCCGCCGCCGAGGGCGCCGCCGATGATCGCGCCGGTACGCTCGCGACGGTTCGACGTCACCGCGCCACCCGCGCCGCCGCCGATGGCGCCGCCGATCACCGAGCCCGTGCTGCCGCCGAGCGCACCGCCGAC

>NZ_CP013444|2|1|3158182-3158387|CRISPRCasFinder
GCGCCGCCGCCGACCGCCGCACCCAG	CAGGCCGCCCGTGCGGCCGCCCATCGCATTGCCTGCCGCCGTGCCA
GCGCCGCCGCCGAGGGCGCCGCCGAT	GATCGCGCCGGTACGCTCGCGACGGTTCGACGTC
ACCGCGCCACCCGCGCCGCCGCCGAT	GGCGCCGCCGATCACCGAGCCC
GTGCTGCCGCCGAGCGCACCGCCGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013444.1\|WP_069274994.1\|3166208_3166745_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224427
NZ_CP013444.1\|WP_069274992.1\|3164362_3164833_-\|DUF2269-domain-containing-protein	unknown	unknown	gnl\|CDD\|370783
NZ_CP013444.1\|WP_069274991.1\|3163596_3164220_-\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|198289
NZ_CP013444.1\|WP_069274990.1\|3162139_3163540_+\|serine-hydrolase	unknown	unknown	gnl\|CDD\|224594
NZ_CP013444.1\|WP_069274985.1\|3151456_3152281_+\|heme-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|184132
NZ_CP013444.1\|WP_069274982.1\|3145554_3147819_+\|TonB-dependent-hemoglobin/transferrin/lactoferrin-family-receptor	unknown	unknown	gnl\|CDD\|273808
NZ_CP013444.1\|WP_155123285.1\|3155788_3156709_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013444.1\|WP_059823609.1\|3168963_3169557_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP013444.1\|WP_069274984.1\|3149875_3150964_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223682
NZ_CP013444.1\|WP_069274983.1\|3147868_3148957_+\|heme-ABC-transporter	unknown	unknown	gnl\|CDD\|226243
NZ_CP013444.1\|WP_069274987.1\|3152764_3153376_-\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NZ_CP013444.1\|WP_155774712.1\|3164829_3166092_-\|NAD(P)H-binding-protein	unknown	unknown	gnl\|CDD\|187579
NZ_CP013444.1\|WP_059523261.1\|3156813_3157650_-\|(S)-ureidoglycine-aminohydrolase	unknown	unknown	gnl\|CDD\|183011
NZ_CP013444.1\|WP_069274996.1\|3168315_3168894_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013444.1\|WP_069274995.1\|3166906_3168109_+\|trans-2-enoyl-CoA-reductase-family-protein	unknown	unknown	gnl\|CDD\|237460
NZ_CP013444.1\|WP_069275231.1\|3153384_3155496_-\|PBP1A-family-penicillin-binding-protein	unknown	unknown	gnl\|CDD\|273955
NZ_CP013444.1\|WP_059634790.1\|3151023_3151410_+\|glyoxalase	unknown	unknown	gnl\|CDD\|319944
NZ_CP013444.1\|WP_069274986.1\|3152349_3152727_+\|lactoylglutathione-lyase	unknown	unknown	gnl\|CDD\|366361
NZ_CP013444.1\|WP_069274989.1\|3160030_3160450_-\|HIT-family-protein	unknown	unknown	gnl\|CDD\|238608
NZ_CP013444.1\|WP_069275232.1\|3160908_3161883_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP013444.1\|WP_069274994.1\|3166208_3166745_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	9.42339e-41
NZ_CP013444.1\|WP_069274992.1\|3164362_3164833_-\|DUF2269-domain-containing-protein	gnl\|CDD\|370783	pfam10027, DUF2269, Predicted integral membrane protein (DUF2269). Members of this family of bacterial hypothetical integral membrane proteins have no known function.	2.3765e-57
NZ_CP013444.1\|WP_069274991.1\|3163596_3164220_-\|glutathione-S-transferase	gnl\|CDD\|198289	cd03180, GST_C_2, C-terminal, alpha helical domain of an unknown subfamily 2 of Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.	4.81591e-50
NZ_CP013444.1\|WP_069274990.1\|3162139_3163540_+\|serine-hydrolase	gnl\|CDD\|224594	COG1680, AmpC, Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms].	1.40361e-38
NZ_CP013444.1\|WP_069274985.1\|3151456_3152281_+\|heme-ABC-transporter-ATP-binding-protein	gnl\|CDD\|184132	PRK13547, hmuV, heme ABC transporter ATP-binding protein.	6.17776e-163
NZ_CP013444.1\|WP_069274982.1\|3145554_3147819_+\|TonB-dependent-hemoglobin/transferrin/lactoferrin-family-receptor	gnl\|CDD\|273808	TIGR01786, hemoglobin-haptoglobin-binding_protein, TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein. This model represents a family of TonB-dependent outer membrane receptor/transporters acting on iron-containing proteins such as hemoglobin, transferrin and lactoferrin. Two subfamily models with a narrower scope are contained within this model, the heme/hemoglobin receptor family protein model (TIGR01785) and the transferrin/lactoferrin receptor family model (TIGR01776). Accessions which score above trusted to this model while not scoring above trusted to the more specific models are most likely to be hemoglobin transporters. Nearly all of the species containing trusted hits to this model have access to hemoglobin, transferrin or lactoferrin or related proteins in their biological niche. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	1.63891e-116
NZ_CP013444.1\|WP_059823609.1\|3168963_3169557_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	5.18808e-15
NZ_CP013444.1\|WP_069274984.1\|3149875_3150964_+\|iron-ABC-transporter-permease	gnl\|CDD\|223682	COG0609, FepD, ABC-type Fe3+-siderophore transport system, permease component [Inorganic ion transport and metabolism].	6.62688e-80
NZ_CP013444.1\|WP_069274983.1\|3147868_3148957_+\|heme-ABC-transporter	gnl\|CDD\|226243	COG3720, HemS, Putative heme degradation protein [Inorganic ion transport and metabolism].	6.45225e-140
NZ_CP013444.1\|WP_069274987.1\|3152764_3153376_-\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	3.90656e-64
NZ_CP013444.1\|WP_155774712.1\|3164829_3166092_-\|NAD(P)H-binding-protein	gnl\|CDD\|187579	cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like, atypical (a) SDRs. This subgroup of extended SDR-like proteins are atypical SDRs. They have a glycine-rich NAD(P)-binding motif similar to the typical SDRs, GXXGXXG, and have the YXXXK active site motif (though not the other residues of the SDR tetrad). Members identified include NDUFA9 (mitochondrial) and putative nucleoside-diphosphate-sugar epimerase. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.56577e-55
NZ_CP013444.1\|WP_059523261.1\|3156813_3157650_-\|(S)-ureidoglycine-aminohydrolase	gnl\|CDD\|183011	PRK11171, PRK11171, (S)-ureidoglycine aminohydrolase.	0
NZ_CP013444.1\|WP_069274995.1\|3166906_3168109_+\|trans-2-enoyl-CoA-reductase-family-protein	gnl\|CDD\|237460	PRK13656, PRK13656, enoyl-[acyl-carrier-protein] reductase FabV.	0
NZ_CP013444.1\|WP_069275231.1\|3153384_3155496_-\|PBP1A-family-penicillin-binding-protein	gnl\|CDD\|273955	TIGR02074, Includes:_Penicillin-insensitive_transglycosylase, penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NZ_CP013444.1\|WP_059634790.1\|3151023_3151410_+\|glyoxalase	gnl\|CDD\|319944	cd08356, VOC_CChe_VCA0619_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. uncharacterized subfamily of vicinal oxygen chelate (VOC) family contains Vibrio cholerae VCA0619 and similar proteins. The VOC superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	2.35775e-44
NZ_CP013444.1\|WP_069274986.1\|3152349_3152727_+\|lactoylglutathione-lyase	gnl\|CDD\|366361	pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily.	8.88111e-05
NZ_CP013444.1\|WP_069274989.1\|3160030_3160450_-\|HIT-family-protein	gnl\|CDD\|238608	cd01277, HINT_subgroup, HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides. This subgroup includes members from all three forms of cellular life. Although the biochemical function has not been characterised for many of the members of this subgroup, the proteins from Yeast have been shown to be involved in secretion, peroxisome formation and gene expression.	1.03436e-47

>NZ_CP013444.1|WP_059523261.1|3156813_3157650_-|(S)-ureidoglycine-aminohydrolase
MSKTTYYAPHGGHPPQTDLLTDRAMFTEAYAVIPKGVMRDIVTSWLPFWTNTRLWVIARPLSGFAETFSQYIVEVNPGGGSDKPEQDKNAEAVLFVVEGEAELTLQGTKHVLKPGGYAFIPPGADWTLHNVSDAAVRFHWVRKHYQAVDGIPLPEAFVTNEQDVEPIPMPGTDGAWVTTRFVDMSDMRHDMHVNIVTFQPGGVIPFAETHVMEHGLYVLEGKAVYRLNQDWVEVEAGDFMWLRAFCPQACYSGGPGRFRYLLYKDVNRHMNLTLNPAR
>NZ_CP013444.1|WP_155123285.1|3155788_3156709_+|hypothetical-protein
MNIDALAQLLIAPAVLAVPLKYAFDFFDGVRKERRGVKGLAFVCWYGPQRRPLNLPGWIRFVASKIRNCFQSRGNRPTHGVLSTNKAIGFIFNSGQVPLKADDLFKSKPLRLVLSGSGELNDVSMRFESDQTADIRLTGERTFLRRPKNHSKERAIAFSYMAPGHGVAVEIEYSARGPVSFSLSGPVNGMRRSIQQQVLFEVDIESSQHRLRQRRSAVVRLWVGGLLMVAAITMAAIDVLFKGDHFLPTRDWTYWLSMVALAVGESMALMAWDHFRQPKKIPAALRYWDTAKNEPVNPVDQRTAVQ
>NZ_CP013444.1|WP_069275231.1|3153384_3155496_-|PBP1A-family-penicillin-binding-protein
MTDPPASPPPAPPRRRRAWRTLAGALLGLTLACAGIGAWTIHRIWTQLPSVEHLAVYRPALPLRIFSRDGDLLAEYGVERREFVPLERIPPLMRHALLAAEDAKFYQHGAVDVGGLARATFANVVTGQPGQGGSTITMQVARNFYLTRDKVLSRKLAEILMAAKLEREYSKDKLLELYMNEIYLGERAYGFAAAANVYFGKPLDALNAGEAAVLAGLPKAPSAFNPVVNPARATARRNYVLGRMHALGQLDDATYRTAVDAPIALATTPPPGIVAAPYVAERARRMMVERFHDDAYTLGLDVTTTISMRDQRAAEAALARGLRRQPAARDAKPALEGALVSLDAATGDMLALVGGADFNRNVFDHALQAYRQPGSSFKPFVYSAALEKGYFPGVLVDDTQRTLTHAETGARPWRPRNFGNRYEGFIPVRRGLVRSKNLVAVSLMQATDAHYVQQHAVHFGFDAQRNPASLPLALGAGAVTPLELASAYSVFANGGTRMEPRLILSVKQRHGGAMYEASPAAGTRVISARNAFMMDSMLRDVVKAGTARGALALRRDDAAGKTGTSNGSKDVWFAGYSSGIVAVAWLGYDTPRPMGRATGATLALPVWLDYMKTAVDGRTPVDATPPQDVALVDGDFVYAEYTRGTCTADVPPFVRSDFACAAVPAPAGASAVAGHDAAAGVAMPAAVDAAERERVLDLFRTDD
>NZ_CP013444.1|WP_069274987.1|3152764_3153376_-|trimeric-intracellular-cation-channel-family-protein
MHTLYLIAIVAEAMSGALMGMRRGMDRFGLALVGAVTALGGGTVRDVLLGHYPLGWIAHPEYLVITLVAATVASWAARRLARMKTLFVTVDAIGLAAFTIIGCDIGASTGAAPIIVVLAGAITGVCGGMLRDLLCNEMPLILREELYASVAFVTGALYVGMQYLGIGADVATAVALVAGFSMRMLAVRLGWKMRTFGAADVER
>NZ_CP013444.1|WP_069274986.1|3152349_3152727_+|lactoylglutathione-lyase
MPLPMTRVLLYVHDVASIKSFYLRYFDLPVVEEIDGEWAVLDAGNIELALHLAGPAFRRAAAPEPPHATRVKLVFSITSGIDAHRDRLARDGVAVRDVKRFDGFPYRLLDGLDPEGNVFQVMQPD
>NZ_CP013444.1|WP_069274985.1|3151456_3152281_+|heme-ABC-transporter-ATP-binding-protein
MLTAHHLDVARRHNAILRDLSLSIEPGRVTALLGRNGAGKSTLLKTFAGELTGRGSAAGTRVTGDITLNGEPLARIDAPRLACLRAVLPQAAQPAFPFSVDEIVLLGRYPHARRSGATSHRDRDIAWRALERAGADALVGRDVTTLSGGELARVQFARVLAQLWPDDGGDDAAQPRYLLLDEPTAALDLAHQHRLLDTVRSVAREWRLGVLAIVHDPNLAARHADTIAMLADGTIVAHGTPRDVMTPAHVAQCYGFSVKMVETGDGAPPVMVPA
>NZ_CP013444.1|WP_059634790.1|3151023_3151410_+|glyoxalase
MSSLASTINALRPFVPSRDFDTSKRFYVELGFTLTFDGDAIAELHFGRHSILLQDFYEPAHANNSMLQMVVSDLDAWWRHIDALRLTERYAVNAPIEPKMQPWGRRVAFLFDPAGVLWHISEAAPGAV
>NZ_CP013444.1|WP_069274984.1|3149875_3150964_+|iron-ABC-transporter-permease
MPAHASPFPAPSPASRSGAARIGTSRRFAPFALAALAVLVCAMSVVALCVGAYRIPLTQAWAALTGDAAAQQARAVLLDIRAPRVALALLVGSGFGAAGAAMQALFRNPLADPGLVGVSSGAALGATTMIVLGPALFAAHVSAAALPVAAFAGALAVAALVYRLAASRGRLALPLLLLAGIAINALAGAAIGLLTFVADDAQLRSLTFWSLGSLGGAQWSALAAVAPCVAIGCVLLARERDALNALQLGETEALHLGVPVQRLKRRVLVAVALAVGALVSCAGIIGFIGLVAPHCVRLACGPDQRVVLPGAALLGALLTLAADLAARTVAAPAEVPLGVLTALLGAPFFLALLWKSRGALGG
>NZ_CP013444.1|WP_069274983.1|3147868_3148957_+|heme-ABC-transporter
MMQSALPGQPATPARAAAALRDAFLKLKTERQLRNRDVAQALGVSEGEALAAFVGEHVVRLDARFPAMFEEMPRLGRVMALTRNDTAVHEKDGEYAQMSHDGPVGLALGDIDLRIFYRHWVSAFAVRDETAHGPLKSLQFFDAQGHAIHKVYLRAHSDHAAYDAFVERWRAPSQEPGLEVAPAAPKTPERADTEIDVTGFRAAWDAMTDTHQFFGITQRFGVSRMQALRLADPQYAYPVGTRALRHALERAAGSGQPIMVFVGNAGMIQIHTGPVANVREVGAWINVLDPGFNLHVREDLIAAAWVVKKPTSDGIVTSLELFDRQGDHVALLFGERKPGKVERDDWRALVAGLPPAEHGDAR
>NZ_CP013444.1|WP_069274982.1|3145554_3147819_+|TonB-dependent-hemoglobin/transferrin/lactoferrin-family-receptor
MHCYTLARRPICAALFGAFGLSAATAHADSSPQGATPPATMLAAATRGDAALLDPVTVTANRTATAASRTAASVSVITDADLEEQQAANIKDALRYEPGITVRRTAYRPGSAALGGGRDGDSSINIRGLEGNRVLLMEDGIRLPNAFSFGPLEAGRGDYADLDTLKRIEILRGPASALYGSDGLTGAVNFITKDPHDLLSIYNKPYYLSFRPSYDSADRSIGATVSAAGGNDRIQGMLIADGRRGHEVDTRGSNNSASTLRTTSNPQDVYSESLLGKLVLTPTTRDTIRFTAETVQRRVSTDVLSAINAPTTLGLTTYDRLERNRFSVDYDFRDDAFRWFQTAHVQFYYQGAKQDQYAFETRGKQPSRSRDNQYQERTFGGSAFAESGFATGPFAHKLLYGVDGSVSRVTNMRDGTVPGVGEAFPNKAFPDTDYTLFGAFLQDQIGYGRLLVTPGLRFDTYRLSPTENDPLFTGKAVSTSANELSPRVAVLYEITPAVIPYVQYAHGFRAPTPDQVNSSFSNPVYGYTSIGNPNLKPETSDTFEAGLRGKAGTGYGVVRYSAAAFTGRYRNFISRTTIAGSGRPADPFVFQYVNFADARIHGLEGRAEWVMPNGITLKTAMAFTKGSTQNDGAASQPLNTVNPFSAVFGVRYEPTERWFVQTDLLFQAAKRDKDIDKSDCSNKACFSPPSSFVVDLRGGYRFNKHVSATIGIRNLFDRKYWNWSDVRGIAADSQVLDAYTSSGRTVAVSMKVDF
>NZ_CP013444.1|WP_069274989.1|3160030_3160450_-|HIT-family-protein
MAYDTHNPFAKILRGELPCVKVAEDDTTLAIMDLMPQADGHVLVIPKEPAAQIFDLSGDAAAAGIRMTQRVAAAVRAALEPDGVFIGQFNGAAAGQTVPHVHFHVIPRWEGVALKLHARDVADAATLEALAQRIRARFV
>NZ_CP013444.1|WP_069275232.1|3160908_3161883_+|hypothetical-protein
MPTNGDLNPYGIAFVPRGVPNWSTLKPGDVVVSNFNAASNAQGTGTTIVKLSPGKTPATFFQGSNLGLTTALAVLRSGFVLVGNVPAPDGKTVVPPGSLLVIGPQGNLVTQLASAALLDGPWDMTVIDRGRRVTAFVSNVLNGTVARIDLMFDNSDGVTMLPGSRIIASGYVNRTDPNALVVGPTGLAYDPNIDVLYVASTGDNAVFAIQNAASTNRNGGVGRMIYFDAAHLHGPLALALAPNGHLVTANGDAVNADPLQPSEIVEFTVDGRFVAQMQVDTVPGAAFGLAFGLGSQRQPQFAAVDDNTNTATVWTLRPNGNNQQ
>NZ_CP013444.1|WP_069274990.1|3162139_3163540_+|serine-hydrolase
MTTPFKPLLRRAAALALIAAIGYAGYMLSRLAPVATGYAAKALCSGVYVSGRPAASVIDVDIMAGVHPLLKLVHPSVDPARHLARATFAGFAGREADFRPGLGCTLAIGPSPGALPAALPDPAPPPAAPAAAPAPDDGVDAHKLQAALDRAFDEPDPARPRRTRAVVVMWRGQVIAERYAPGFTADTPLPGWSMTKTVTAALVGTLVAQHKLSPDTSALLPEWRGSGDPRAAITLDELLRMTSGLQFNEDYDDPLSDVALMLFTQPDTARFASAKPLAAAPGTQWSYSSGTSAIVARVMREALGGTETDYLAFPQHTLFAPLGMGSAVFEPDASGTLVSASYMYASARDWARFGQLLLQDGVWDGQRLLPAGWVRYLTRATPQSSRQEYGAQLWVKVPEPFNDRGPHAVAMPADAFHAVGHEGQFVSVVPSRQLVVVRLGLSRPEAAWNHEAFLARVLDAVPARSE
>NZ_CP013444.1|WP_069274991.1|3163596_3164220_-|glutathione-S-transferase
MLHILGKIPSINVRKVLWLCTELNLPFEQEDWGAGFRTTNDPAYLALNPNALVPVIKDDDFVLWESNTIIRYLANRYGGDALYPAEPQARARVDQWIDWQASDMNRSWVFAFQGLVRKSPDHQDPAGIAQSIAGWTKHMQVLNAQLDKTGAYVAGNTFTLADIPIGLSVNRWFGTPFEHPELPAVTRYVERLAARPGFEAYGGSKNP
>NZ_CP013444.1|WP_069274992.1|3164362_3164833_-|DUF2269-domain-containing-protein
MNTYLVVKALHILSSVLLVGTGFGTAFYLFFANRTQSVPAIAAVSRLVVRADWWFTTPAVIFQPASGLWLAHTAGWPWHTPWLVASLGLYLLAGACWLPVVWLQLELASMAKRAHANGDAALPERYWRYAKRWELLGYPAFFAMLSVYFLMVLKPM
>NZ_CP013444.1|WP_155774712.1|3164829_3166092_-|NAD(P)H-binding-protein
MNILVCGANGFIGRALCAQLDADGHRVLRGVHAGRRAAGPGEIAIDYARDVRPEHWRARLDGIDAVVNAVGILADRRGATLDAVHRAAPCALFDACCGAGVRRIVQISALGVERGDTAYFASKLAADAYLQTLPIDFRIVRPALVYGTDGASARFFRMLASLPVQVLPAGGRQRLRPVHVDDLAEVVARLIERPAAGDRIVDVVGNDEVEYREMLAIYRRAMGFPPAMRVSVPGALCGAAAALSGRMPGAMFTRDTWTMLRAGNTGELAASSAALGRPPRGLRAFIGAQAVALRHEALAAWRRPLLTGSLAIVWIWTAIASAFVHPLPASLALLAHVHLTGISALAALYAACALDFVFGIATVAAPSRRLWAAQAALIVAYSAVIAVTMPALLAEPFGPVLKNVPILAILLILFAEEERS
>NZ_CP013444.1|WP_069274994.1|3166208_3166745_-|MarR-family-transcriptional-regulator
MELTPIAERFILHWGEMGSRWGVNRTVSQIHALLYLAGRPVAADEIAETLNVARSNVSTSLKELQAWRLAKVVHVLGDRRDHFETSTDIWELFKLIVEGRRQREIEPTLTVLRDCLTNPEIANESRETEQRIRDTLQFVETLTTWSDEMLRLKPDTLMKALGIGAKISQTVRRKPSSK
>NZ_CP013444.1|WP_069274995.1|3166906_3168109_+|trans-2-enoyl-CoA-reductase-family-protein
MIIKPRVRGFICVTTHPVGCEANVKEQIDYVTSHGPIANGPKKVLVIGASTGYGLAARISAAFGAGADTLGVFFERAGSETKPGTAGWYNSAAFEKFAAEKGVYARSINGDAFSDKVKQVTIDTIKQDLGKVDLVVYSLAAPRRTHPKTGETISSTLKPIGKTVTFRGLDTDKEVIRDVTLEPATQEEIDGTVAVMGGEDWQMWIDALDEAGVLADGAKTTAFTYLGEQITHDIYWNGSIGEAKKDLDKKVLSIRDKLAAHGGDARVSVLKAVVTQASSAIPMMPLYLSLLFRTMKETGTHEGCIEQVYGLFKDSLYGATPHVDEEGRLRADYKELDPQVQAKVVAQWNHVTNDNLYELTDFAGYKTEFLRLFGFEIAGVDYDADVNPDVKIPGIIEVSA
>NZ_CP013444.1|WP_069274996.1|3168315_3168894_-|hypothetical-protein
MKRRHLAVAVTGLLIALPIAAFAFVKPLRVVAPALVPGVTCPDADICIDDAAKLGEARQLYGAGYARAAAVTGQFHAAPRVVFCATQACADAFGLGRRAAEAVGNAGVVVAPRGWQTYFLAHELIHHRQAEVLGNLAVATKPRWLIEGMAYSLSDDPRHPLAEPFESWRAQFDAWHAALGARDLWDAARDVR
>NZ_CP013444.1|WP_059823609.1|3168963_3169557_-|class-I-SAM-dependent-methyltransferase
MDRITIDTYDTAAQAFADEWQDQPAPTDMYALLMRHFAPGGRTADIGCGAGRDVAWLNANGFPAAGYDASPGLLEQARTRYPHLRFLNAALPALDGIDDASFDNILCETVIMHLPPEEIGDACGRLLAILKPGGVLYLSWRVSEGESRRDASGRLYASFDAALVTAAMRNATVVSDTETVNQSSGKRVHRLIVQRAS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP013444_1	1.4\|569136\|18\|NZ_CP013444\|CRT	569136-569153	18	NZ_CP013444.1	570679-570696	1	0.944
NZ_CP013444_1	1.5\|569172\|30\|NZ_CP013444\|CRT	569172-569201	30	NZ_CP013444.1	569244-569273	1	0.967
NZ_CP013444_1	1.6\|569220\|18\|NZ_CP013444\|CRT	569220-569237	18	NZ_CP013444.1	569256-569273	1	0.944

1. spacer 1.4|569136|18|NZ_CP013444|CRT matches to position: 570679-570696, mismatch: 1, identity: 0.944

cgtgccggaagacgtgcc	CRISPR spacer
cgcgccggaagacgtgcc	Protospacer
**.***************

2. spacer 1.5|569172|30|NZ_CP013444|CRT matches to position: 569244-569273, mismatch: 1, identity: 0.967

cgtacccgaggatgtgcccgaggacgtacc	CRISPR spacer
cgtacccgaggatgtgccagaggacgtacc	Protospacer
****************** ***********

3. spacer 1.6|569220|18|NZ_CP013444|CRT matches to position: 569256-569273, mismatch: 1, identity: 0.944

tgtgccggaggacgtacc	CRISPR spacer
tgtgccagaggacgtacc	Protospacer
******.***********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP013444_2	2.3\|3158340\|22\|NZ_CP013444\|CRISPRCasFinder	3158340-3158361	22	CP047036	Rhodobacter sphaeroides strain DSM 158 plasmid pDx, complete sequence	28933-28954	2	0.909
NZ_CP013444_2	2.3\|3158340\|22\|NZ_CP013444\|CRISPRCasFinder	3158340-3158361	22	NZ_CP047042	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pDx, complete sequence	28906-28927	2	0.909
NZ_CP013444_2	2.3\|3158340\|22\|NZ_CP013444\|CRISPRCasFinder	3158340-3158361	22	NZ_CP047900	Pseudarthrobacter sp. YJ56 plasmid unnamed2, complete sequence	72688-72709	2	0.909
NZ_CP013444_2	2.3\|3158340\|22\|NZ_CP013444\|CRISPRCasFinder	3158340-3158361	22	NZ_CP051473	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10DE, complete sequence	36889-36910	2	0.909
NZ_CP013444_2	2.3\|3158340\|22\|NZ_CP013444\|CRISPRCasFinder	3158340-3158361	22	NZ_CP051473	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10DE, complete sequence	146015-146036	2	0.909
NZ_CP013444_2	2.3\|3158340\|22\|NZ_CP013444\|CRISPRCasFinder	3158340-3158361	22	NZ_CP030276	Rhodobacter sphaeroides 2.4.1 plasmid pDE, complete sequence	36896-36917	2	0.909
NZ_CP013444_2	2.3\|3158340\|22\|NZ_CP013444\|CRISPRCasFinder	3158340-3158361	22	NZ_CP030276	Rhodobacter sphaeroides 2.4.1 plasmid pDE, complete sequence	146039-146060	2	0.909
NZ_CP013444_2	2.3\|3158340\|22\|NZ_CP013444\|CRISPRCasFinder	3158340-3158361	22	NZ_CP015289	Rhodobacter sphaeroides strain MBTLJ-20 plasmid a, complete sequence	80206-80227	2	0.909
NZ_CP013444_2	2.3\|3158340\|22\|NZ_CP013444\|CRISPRCasFinder	3158340-3158361	22	NZ_CP015289	Rhodobacter sphaeroides strain MBTLJ-20 plasmid a, complete sequence	124016-124037	2	0.909
NZ_CP013444_2	2.3\|3158340\|22\|NZ_CP013444\|CRISPRCasFinder	3158340-3158361	22	NZ_CP022195	Yangia pacifica strain YSBP01 plasmid unnamed5, complete sequence	21990-22011	2	0.909
NZ_CP013444_2	2.3\|3158340\|22\|NZ_CP013444\|CRISPRCasFinder	3158340-3158361	22	NC_013858	Azospirillum sp. B510 plasmid pAB510d, complete sequence	498979-499000	2	0.909
NZ_CP013444_2	2.3\|3158340\|22\|NZ_CP013444\|CRISPRCasFinder	3158340-3158361	22	NZ_CP015212	Rhodobacter sphaeroides strain MBTLJ-13 plasmid a, complete sequence	36199-36220	2	0.909
NZ_CP013444_2	2.3\|3158340\|22\|NZ_CP013444\|CRISPRCasFinder	3158340-3158361	22	NZ_CP015212	Rhodobacter sphaeroides strain MBTLJ-13 plasmid a, complete sequence	145343-145364	2	0.909
NZ_CP013444_2	2.3\|3158340\|22\|NZ_CP013444\|CRISPRCasFinder	3158340-3158361	22	NZ_CP025513	Neorhizobium sp. SOG26 plasmid unnamed2, complete sequence	515843-515864	3	0.864
NZ_CP013444_1	1.5\|569172\|30\|NZ_CP013444\|CRT	569172-569201	30	ASHF01000034	Streptomyces sp. GBA 94-10 plasmid pGBA1, complete sequence, whole genome shotgun sequence	37619-37648	5	0.833
NZ_CP013444_1	1.3\|569088\|30\|NZ_CP013444\|CRT	569088-569117	30	NZ_CP035496	Xylanimonas allomyrinae strain 2JSPR-7 plasmid unnamed1, complete sequence	1342-1371	7	0.767
NZ_CP013444_1	1.3\|569088\|30\|NZ_CP013444\|CRT	569088-569117	30	KT755656	Paenibacillus phage Tripp, complete genome	44084-44113	7	0.767
NZ_CP013444_1	1.5\|569172\|30\|NZ_CP013444\|CRT	569172-569201	30	NZ_CP023549	Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence	100870-100899	7	0.767
NZ_CP013444_1	1.5\|569172\|30\|NZ_CP013444\|CRT	569172-569201	30	MT118288	Pseudomonas phage Epa4, complete genome	1928-1957	7	0.767
NZ_CP013444_1	1.5\|569172\|30\|NZ_CP013444\|CRT	569172-569201	30	MH590592	Mycobacterium phage Ryadel, complete genome	16012-16041	7	0.767
NZ_CP013444_1	1.5\|569172\|30\|NZ_CP013444\|CRT	569172-569201	30	NC_022971	Pseudomonas phage phiIBB-PAA2, complete genome	21093-21122	7	0.767
NZ_CP013444_1	1.5\|569172\|30\|NZ_CP013444\|CRT	569172-569201	30	LN610578	Pseudomonas phage vB_PaeP_C2-10_Ab22, complete genome	20895-20924	7	0.767
NZ_CP013444_1	1.5\|569172\|30\|NZ_CP013444\|CRT	569172-569201	30	NC_018582	Gordonia sp. KTR9 plasmid pGKT1, complete sequence	46318-46347	8	0.733
NZ_CP013444_1	1.5\|569172\|30\|NZ_CP013444\|CRT	569172-569201	30	NZ_CP014514	Frondihabitans sp. PAMC 28766 strain SR6 plasmid 1, complete sequence	124583-124612	8	0.733
NZ_CP013444_1	1.5\|569172\|30\|NZ_CP013444\|CRT	569172-569201	30	MN428055	Gordonia phage Mcklovin, complete genome	4758-4787	8	0.733
NZ_CP013444_2	2.2\|3158280\|34\|NZ_CP013444\|CRISPRCasFinder	3158280-3158313	34	CP003955	Rhodococcus opacus PD630 plasmid 6, complete sequence	15739-15772	8	0.765

1. spacer 2.3|3158340|22|NZ_CP013444|CRISPRCasFinder matches to CP047036 (Rhodobacter sphaeroides strain DSM 158 plasmid pDx, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

2. spacer 2.3|3158340|22|NZ_CP013444|CRISPRCasFinder matches to NZ_CP047042 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pDx, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

3. spacer 2.3|3158340|22|NZ_CP013444|CRISPRCasFinder matches to NZ_CP047900 (Pseudarthrobacter sp. YJ56 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
ggcgccgccgatcgccgagccg	Protospacer
*************.*******

4. spacer 2.3|3158340|22|NZ_CP013444|CRISPRCasFinder matches to NZ_CP051473 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10DE, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

5. spacer 2.3|3158340|22|NZ_CP013444|CRISPRCasFinder matches to NZ_CP051473 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10DE, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

6. spacer 2.3|3158340|22|NZ_CP013444|CRISPRCasFinder matches to NZ_CP030276 (Rhodobacter sphaeroides 2.4.1 plasmid pDE, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

7. spacer 2.3|3158340|22|NZ_CP013444|CRISPRCasFinder matches to NZ_CP030276 (Rhodobacter sphaeroides 2.4.1 plasmid pDE, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

8. spacer 2.3|3158340|22|NZ_CP013444|CRISPRCasFinder matches to NZ_CP015289 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid a, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

9. spacer 2.3|3158340|22|NZ_CP013444|CRISPRCasFinder matches to NZ_CP015289 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid a, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

10. spacer 2.3|3158340|22|NZ_CP013444|CRISPRCasFinder matches to NZ_CP022195 (Yangia pacifica strain YSBP01 plasmid unnamed5, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
ggcgccgccgctcaccgagccg	Protospacer
********** **********

11. spacer 2.3|3158340|22|NZ_CP013444|CRISPRCasFinder matches to NC_013858 (Azospirillum sp. B510 plasmid pAB510d, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
ggcgccgccgatcaccgtgccg	Protospacer
***************** ***

12. spacer 2.3|3158340|22|NZ_CP013444|CRISPRCasFinder matches to NZ_CP015212 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid a, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

13. spacer 2.3|3158340|22|NZ_CP013444|CRISPRCasFinder matches to NZ_CP015212 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid a, complete sequence) position: , mismatch: 2, identity: 0.909

ggcgccgccgatcaccgagccc	CRISPR spacer
cgcgccgccgagcaccgagccc	Protospacer
 ********** **********

14. spacer 2.3|3158340|22|NZ_CP013444|CRISPRCasFinder matches to NZ_CP025513 (Neorhizobium sp. SOG26 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.864

ggcgccgccgatcaccgagccc	CRISPR spacer
ggcgccgccgatcaccgagttg	Protospacer
*******************..

15. spacer 1.5|569172|30|NZ_CP013444|CRT matches to ASHF01000034 (Streptomyces sp. GBA 94-10 plasmid pGBA1, complete sequence, whole genome shotgun sequence) position: , mismatch: 5, identity: 0.833

cgtacccgaggatgtgcccgaggacgtacc	CRISPR spacer
cgtactcgcggatgtgcccgaggacgtcgt	Protospacer
*****.** ******************  .

16. spacer 1.3|569088|30|NZ_CP013444|CRT matches to NZ_CP035496 (Xylanimonas allomyrinae strain 2JSPR-7 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

cgtgccggaggacgtacccgaagacgtgcc	CRISPR spacer
ggtgatccaggacggacccgaagacgtgcg	Protospacer
 *** .  ****** **************

17. spacer 1.3|569088|30|NZ_CP013444|CRT matches to KT755656 (Paenibacillus phage Tripp, complete genome) position: , mismatch: 7, identity: 0.767

cgtgccggaggacgtacccgaagacgtgcc	CRISPR spacer
cgaaaaggaggacgtagccgaagaagtgcg	Protospacer
** .  ********** ******* ****

18. spacer 1.5|569172|30|NZ_CP013444|CRT matches to NZ_CP023549 (Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

cgtacccgaggatgtgcccgaggacgtacc	CRISPR spacer
gctgcgcgaggatctgcccgaggacgcact	Protospacer
  *.* ******* ************.**.

19. spacer 1.5|569172|30|NZ_CP013444|CRT matches to MT118288 (Pseudomonas phage Epa4, complete genome) position: , mismatch: 7, identity: 0.767

cgtacccgaggatgtgcccgaggacgtacc	CRISPR spacer
cttcaccgaggaagagcccgaggacgtatt	Protospacer
* *  ******* * *************..

20. spacer 1.5|569172|30|NZ_CP013444|CRT matches to MH590592 (Mycobacterium phage Ryadel, complete genome) position: , mismatch: 7, identity: 0.767

cgtacccgaggatgtgcccgaggacgtacc	CRISPR spacer
cggacccgaggaggtgcccgaggcccgcgc	Protospacer
** ********* ********** *    *

21. spacer 1.5|569172|30|NZ_CP013444|CRT matches to NC_022971 (Pseudomonas phage phiIBB-PAA2, complete genome) position: , mismatch: 7, identity: 0.767

cgtacccgaggatgtgcccgaggacgtacc	CRISPR spacer
cttcaccgaggaagagcccgaggacgtatt	Protospacer
* *  ******* * *************..

22. spacer 1.5|569172|30|NZ_CP013444|CRT matches to LN610578 (Pseudomonas phage vB_PaeP_C2-10_Ab22, complete genome) position: , mismatch: 7, identity: 0.767

cgtacccgaggatgtgcccgaggacgtacc	CRISPR spacer
cttcaccgaggaagagcccgaggacgtatt	Protospacer
* *  ******* * *************..

23. spacer 1.5|569172|30|NZ_CP013444|CRT matches to NC_018582 (Gordonia sp. KTR9 plasmid pGKT1, complete sequence) position: , mismatch: 8, identity: 0.733

cgtacccgaggatgtgcccgaggacgtacc	CRISPR spacer
ggtacccaaggatgtgcccgaggttctctt	Protospacer
 ******.*************** . * ..

24. spacer 1.5|569172|30|NZ_CP013444|CRT matches to NZ_CP014514 (Frondihabitans sp. PAMC 28766 strain SR6 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.733

cgtacccgaggatgtgcccgaggacgtacc	CRISPR spacer
ctgcgccgaggaggggcccgaggacgtaga	Protospacer
*    ******* * *************

25. spacer 1.5|569172|30|NZ_CP013444|CRT matches to MN428055 (Gordonia phage Mcklovin, complete genome) position: , mismatch: 8, identity: 0.733

cgtacccgaggatgtgcccgaggacgtacc	CRISPR spacer
ctggtacgaggatgtgcccgacgacgaact	Protospacer
*  .. *************** **** **.

26. spacer 2.2|3158280|34|NZ_CP013444|CRISPRCasFinder matches to CP003955 (Rhodococcus opacus PD630 plasmid 6, complete sequence) position: , mismatch: 8, identity: 0.765

gatcgcgccggtacgctcgcgacggttcgacgtc	CRISPR spacer
gatcgcgccgctacgcccgcgacgcagggacgcg	Protospacer
********** *****.*******    ****.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

680203 : 743372

Ralstonia_phage(20.0%)

plate

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059975721.1\|680203_680635_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_060371273.1\|680647_681310_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_069274070.1\|681306_682653_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_069270968.1\|682710_684099_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_069270969.1\|684360_686826_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.6e-20	23.1
WP_155123187.1\|686866_687856_+	hypothetical protein	NA	NA	NA	NA
WP_155123188.1\|687874_688135_+	hypothetical protein	NA	NA	NA	NA
WP_069274071.1\|688229_689033_+	hypothetical protein	NA	NA	NA	NA
WP_069270972.1\|689065_690226_+	hypothetical protein	NA	NA	NA	NA
WP_069270973.1\|690227_693773_+	type VI secretion protein VasK	NA	NA	NA	NA
WP_069270974.1\|693789_695604_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_059956095.1\|695702_696683_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_069270975.1\|696729_697374_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_155123189.1\|697516_697948_-	hypothetical protein	NA	NA	NA	NA
WP_155123190.1\|697934_698135_+	hypothetical protein	NA	NA	NA	NA
WP_069274072.1\|698242_698674_-	hypothetical protein	NA	NA	NA	NA
WP_059956246.1\|700957_701818_+	hypothetical protein	NA	NA	NA	NA
WP_059532241.1\|702283_702667_+	avidin	NA	NA	NA	NA
WP_080485818.1\|702924_704742_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_069270977.1\|704787_706755_-	glycosyltransferase	M1HVH2	Acanthocystis_turfacea_Chlorella_virus	9.9e-26	26.6
WP_059724016.1\|706757_708095_-	hypothetical protein	NA	NA	NA	NA
WP_080405937.1\|708115_709594_-	multidrug transporter	NA	NA	NA	NA
WP_069275121.1\|710326_710731_+	TIGR02594 family protein	A0A249Y3Q7	Serratia_phage	8.2e-28	41.5
WP_069274073.1\|710759_712196_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_069275122.1\|712212_713787_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_069274074.1\|713818_714910_-	HlyD family secretion protein	NA	NA	NA	NA
WP_069274075.1\|714974_715406_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_069275123.1\|715455_716394_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_069274076.1\|716495_716924_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_069274077.1\|717178_718426_+	DUF521 domain-containing protein	NA	NA	NA	NA
WP_069274078.1\|718418_718925_+	DUF126 domain-containing protein	NA	NA	NA	NA
WP_069274079.1\|719059_720169_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_069274080.1\|720244_722278_+	NADPH-dependent 2,4-dienoyl-CoA reductase	NA	NA	NA	NA
WP_069274081.1\|722305_722710_-	DUF2471 domain-containing protein	NA	NA	NA	NA
WP_060156897.1\|723773_724253_+	DUF2844 domain-containing protein	NA	NA	NA	NA
WP_155123191.1\|724380_725241_+	hypothetical protein	NA	NA	NA	NA
WP_155123192.1\|725260_728503_+	hypothetical protein	NA	NA	NA	NA
WP_069270983.1\|728715_730842_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	1.3e-42	29.1
WP_060156902.1\|730857_732276_+	HlyD family type I secretion periplasmic adaptor subunit	NA	NA	NA	NA
WP_088502086.1\|732394_733723_+	TolC family protein	NA	NA	NA	NA
WP_069274082.1\|733848_734742_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_069274083.1\|734829_735618_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_059481107.1\|735625_736051_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_069270985.1\|736047_738777_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	4.8e-87	31.6
WP_006479553.1\|738914_739400_-	Hcp family type VI secretion system effector	NA	NA	NA	NA
WP_069270986.1\|739492_741241_-	OmpA family protein	NA	NA	NA	NA
WP_069270987.1\|741267_742023_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_069270988.1\|742019_743372_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA

DBSCAN-SWA_2

1608627 : 1641307

Pandoravirus(33.33%)

transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059522072.1\|1608627_1610043_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_059666863.1\|1610058_1611381_+	DotU family type VI secretion system protein	NA	NA	NA	NA
WP_059522070.1\|1611382_1615012_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_081333770.1\|1614993_1615710_+	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_069274390.1\|1615730_1617821_+	serine/threonine protein kinase	S4VYW6	Pandoravirus	8.4e-07	26.7
WP_069275158.1\|1617876_1618923_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_059522067.1\|1618978_1619533_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_059522066.1\|1619525_1621034_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_027791618.1\|1621105_1621597_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_059732615.1\|1621613_1622162_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_069274391.1\|1622166_1624038_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_069274392.1\|1624034_1625123_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_069274393.1\|1625135_1627796_+	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	1.3e-76	30.3
WP_069274394.1\|1627792_1630066_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	9.9e-46	28.9
WP_069274395.1\|1630140_1630764_+	hypothetical protein	NA	NA	NA	NA
WP_155774699.1\|1630830_1631124_-	hypothetical protein	NA	NA	NA	NA
WP_155774700.1\|1631122_1632079_+	hypothetical protein	NA	NA	NA	NA
WP_069274397.1\|1632075_1636656_+	hypothetical protein	NA	NA	NA	NA
WP_059953880.1\|1636652_1637270_+	DUF1851 domain-containing protein	NA	NA	NA	NA
WP_080414766.1\|1637675_1637978_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_069275159.1\|1638179_1639664_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_059918601.1\|1639897_1641307_+\|transposase	ISNCY family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

2244360 : 2313846

Bacillus_virus(16.67%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059816594.1\|2244360_2245305_+\|protease	trypsin-like serine protease	NA	NA	NA	NA
WP_069271433.1\|2245383_2247858_-	c-type cytochrome	NA	NA	NA	NA
WP_059771135.1\|2247847_2248351_-	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_059860380.1\|2248477_2249635_-	NAD(P)-binding protein	NA	NA	NA	NA
WP_059910810.1\|2249923_2250676_+	Asp/Glu racemase	NA	NA	NA	NA
WP_069271434.1\|2250706_2251537_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_069271435.1\|2251569_2252610_+	2,5-dihydroxypyridine 5,6-dioxygenase	NA	NA	NA	NA
WP_060050325.1\|2252626_2253274_+	isochorismatase family protein	NA	NA	NA	NA
WP_069271436.1\|2253407_2255690_+	xanthine dehydrogenase family protein molybdopterin-binding subunit	NA	NA	NA	NA
WP_010099627.1\|2255712_2256156_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_069271437.1\|2256558_2257866_+	MFS transporter	NA	NA	NA	NA
WP_069271438.1\|2258242_2259583_-	APC family permease	NA	NA	NA	NA
WP_069271439.1\|2259713_2260559_-	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
WP_069271440.1\|2260735_2261554_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_069274659.1\|2262691_2263696_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_059527382.1\|2263714_2264539_+	ABC transporter permease	NA	NA	NA	NA
WP_059527385.1\|2264549_2265440_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_069274660.1\|2265453_2266485_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.0e-22	30.7
WP_069271893.1\|2266708_2268094_-	MmgE/PrpD family protein	NA	NA	NA	NA
WP_080485768.1\|2268090_2269083_-	polysaccharide deacetylase	NA	NA	NA	NA
WP_069271446.1\|2268995_2269868_-	polysaccharide deacetylase	NA	NA	NA	NA
WP_080430818.1\|2269875_2270709_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_069271447.1\|2270791_2271595_-	amino acid ABC transporter ATP-binding protein	M1HY76	Paramecium_bursaria_Chlorella_virus	5.3e-10	25.8
WP_069271448.1\|2271591_2272485_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_069271449.1\|2272478_2273912_-	argininosuccinate lyase	NA	NA	NA	NA
WP_069271450.1\|2274037_2274916_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	2.7e-15	27.1
WP_069271451.1\|2277786_2278182_+	hypothetical protein	NA	NA	NA	NA
WP_155123252.1\|2278246_2280556_+	LPS assembly protein LptD	NA	NA	NA	NA
WP_069274661.1\|2281846_2282362_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_069274662.1\|2282424_2283912_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_059526464.1\|2283964_2285179_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_069274663.1\|2285207_2286767_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_069271457.1\|2287689_2288856_+	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
WP_080485769.1\|2289126_2289402_-	DUF883 domain-containing protein	NA	NA	NA	NA
WP_155630859.1\|2290812_2292198_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_155123253.1\|2292725_2292923_+	hypothetical protein	NA	NA	NA	NA
WP_080485770.1\|2293266_2293569_+	hypothetical protein	NA	NA	NA	NA
WP_069271461.1\|2294275_2294578_+	hypothetical protein	NA	NA	NA	NA
WP_080485771.1\|2295818_2296088_+	hypothetical protein	NA	NA	NA	NA
WP_069271462.1\|2296229_2296565_-\|transposase	transposase	NA	NA	NA	NA
WP_080485773.1\|2297636_2298284_+	LysE family transporter	NA	NA	NA	NA
WP_069271464.1\|2298614_2299106_-	hypothetical protein	NA	NA	NA	NA
WP_080485775.1\|2299841_2302154_-	outer membrane protein assembly factor BamA	NA	NA	NA	NA
WP_080485776.1\|2302665_2302923_+\|transposase	transposase	NA	NA	NA	NA
WP_155123255.1\|2302922_2303258_+	hypothetical protein	NA	NA	NA	NA
WP_155123256.1\|2303450_2303741_+\|transposase	transposase	S5WIU1	Leptospira_phage	2.0e-07	49.0
WP_155123303.1\|2303658_2304111_-	lysine decarboxylase	NA	NA	NA	NA
WP_069271467.1\|2304172_2305003_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_069271468.1\|2305013_2306102_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_069271469.1\|2306128_2307172_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	1.7e-24	46.3
WP_069271470.1\|2307179_2308031_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_059807745.1\|2309075_2310098_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-46	36.6
WP_080485777.1\|2310592_2310877_-	hypothetical protein	NA	NA	NA	NA
WP_069271472.1\|2312373_2313846_+\|transposase	ISNCY family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

3351193 : 3361523

Ralstonia_phage(83.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069271779.1\|3351193_3353428_-	DUF3274 domain-containing protein	A0A077K801	Ralstonia_phage	0.0e+00	83.0
WP_059898220.1\|3353424_3354189_-	hypothetical protein	A0A077KEQ4	Ralstonia_phage	1.5e-110	83.3
WP_069275242.1\|3354269_3355082_-	hypothetical protein	A0A077K9W3	Ralstonia_phage	1.9e-100	70.9
WP_080485809.1\|3355162_3355909_-	hypothetical protein	A0A077KEQ4	Ralstonia_phage	8.7e-100	75.2
WP_069271781.1\|3356001_3358665_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	0.0e+00	77.5
WP_080485844.1\|3359141_3360461_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_080485810.1\|3360548_3361523_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	3.2e-41	35.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP013443

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

187360 : 218954

Burkholderia_phage(74.19%)

integrase,plate,transposase,tail,holin

attL 189849:189866|attR 214724:214741

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060092462.1\|187360_188386_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_069272247.1\|188684_189566_-	cytochrome c5 family protein	NA	NA	NA	NA
189849:189866	attL	NA	NA	NA	NA
WP_069272248.1\|189947_191024_-\|integrase	site-specific integrase	A0A1S5NNJ1	Burkholderia_phage	1.1e-172	84.9
WP_080403289.1\|190891_191341_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_080413459.1\|191350_191710_-	hypothetical protein	NA	NA	NA	NA
WP_069269775.1\|191706_194499_-	hypothetical protein	E5E3N5	Burkholderia_phage	0.0e+00	92.5
WP_059586359.1\|194502_194766_-	hypothetical protein	E5E3N6	Burkholderia_phage	1.5e-17	63.9
WP_010095912.1\|194968_195217_-	ogr/Delta-like zinc finger family protein	K4PAZ0	Burkholderia_phage	5.9e-37	91.5
WP_010095910.1\|195341_195557_-	hypothetical protein	E5E3U1	Burkholderia_phage	2.0e-20	81.4
WP_155123057.1\|195683_196139_+	transcriptional regulator	E5E3U2	Burkholderia_phage	5.4e-44	62.9
WP_060106460.1\|196508_196805_+	hypothetical protein	E5E3U3	Burkholderia_phage	2.7e-12	50.5
WP_060106462.1\|196936_198016_-	phage late control D family protein	K4PAY4	Burkholderia_phage	1.3e-133	72.7
WP_059530902.1\|198012_198468_-\|tail	phage tail protein	K4NXK5	Burkholderia_phage	6.8e-39	62.0
WP_069269776.1\|198497_201050_-	hypothetical protein	A4JWS3	Burkholderia_virus	1.7e-150	46.9
WP_010095898.1\|201065_201179_-\|tail	GpE family phage tail protein	A0A089FGX3	Burkholderia_phage	1.8e-09	81.1
WP_059897886.1\|201187_201571_-\|tail	phage tail assembly protein	A4JWS5	Burkholderia_virus	7.8e-28	64.8
WP_010095894.1\|201640_202144_-\|tail	phage major tail tube protein	E5E3U9	Burkholderia_phage	4.8e-70	74.3
WP_069269777.1\|202178_203351_-\|tail	phage tail sheath protein	A4JWS7	Burkholderia_virus	1.0e-187	82.5
WP_069269778.1\|203410_204040_-\|tail	tail assembly chaperone	E5E3V1	Burkholderia_phage	1.1e-90	85.8
WP_060199750.1\|204055_205555_-	hypothetical protein	E5FFH1	Burkholderia_phage	2.1e-129	53.0
WP_060199748.1\|205561_206104_-\|tail	phage tail protein I	E5FFH2	Burkholderia_phage	7.3e-72	72.6
WP_060199746.1\|206096_207011_-\|plate	baseplate assembly protein	E5FFH3	Burkholderia_phage	2.0e-122	73.9
WP_059609406.1\|207007_207370_-\|plate	baseplate assembly protein	K4PAX6	Burkholderia_phage	5.4e-39	66.7
WP_042586752.1\|207366_208050_-\|plate	phage baseplate assembly protein V	E5E3V6	Burkholderia_phage	1.2e-76	67.3
WP_155123058.1\|208054_208462_-	hypothetical protein	NA	NA	NA	NA
WP_069269780.1\|208681_209260_-	hypothetical protein	NA	NA	NA	NA
WP_069269781.1\|209263_210187_-	hypothetical protein	A4JWL8	Burkholderia_virus	5.7e-24	33.6
WP_059717646.1\|210183_210750_-\|tail	phage tail protein I	A4JWL7	Burkholderia_virus	5.9e-40	58.0
WP_069269782.1\|210742_211654_-\|plate	baseplate assembly protein	E5FFH3	Burkholderia_phage	2.2e-73	49.2
WP_069269783.1\|211650_212106_-\|tail	phage tail protein	E5E3V9	Burkholderia_phage	8.9e-31	55.7
WP_010095869.1\|212098_212269_-	hypothetical protein	K4PAX1	Burkholderia_phage	1.4e-10	61.5
WP_060265275.1\|212222_212663_-	protein lysB	K4NXJ2	Burkholderia_phage	1.2e-16	45.9
WP_059955887.1\|212659_213490_-	DUF3380 domain-containing protein	A4JWZ0	Burkholderia_virus	2.5e-95	67.7
WP_045566864.1\|213493_213760_-\|holin	phage holin family protein	E5E3W3	Burkholderia_phage	1.6e-24	66.3
WP_010095861.1\|213761_214106_-	membrane protein	A4JWU2	Burkholderia_virus	6.7e-39	79.6
WP_042586759.1\|214121_214328_-\|tail	tail protein	E5E3W5	Burkholderia_phage	1.1e-20	72.1
WP_069270644.1\|214750_215221_-	DUF523 domain-containing protein	NA	NA	NA	NA
214724:214741	attR	NA	NA	NA	NA
WP_069272249.1\|215410_216985_+	TIGR04222 domain-containing membrane protein	NA	NA	NA	NA
WP_069272250.1\|217283_218954_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.3e-21	35.6

DBSCAN-SWA_2

444086 : 486904

uncultured_Caudovirales_phage(42.86%)

plate,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069272329.1\|444086_444596_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	7.2e-21	49.5
WP_059592487.1\|444760_445042_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_059592488.1\|445045_445363_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A2I6TCA4	Escherichia_phage	6.9e-14	46.9
WP_080485625.1\|445593_445899_-	hypothetical protein	NA	NA	NA	NA
WP_059808466.1\|445972_446314_-	helix-turn-helix transcriptional regulator	Q0H244	Geobacillus_phage	2.8e-05	40.5
WP_155123062.1\|446769_447345_-	hypothetical protein	NA	NA	NA	NA
WP_060138940.1\|447626_449498_-	hypothetical protein	NA	NA	NA	NA
WP_069269831.1\|450150_450702_+	hypothetical protein	NA	NA	NA	NA
WP_069269832.1\|450775_451327_+	hypothetical protein	NA	NA	NA	NA
WP_029226620.1\|451529_451781_+	hypothetical protein	NA	NA	NA	NA
WP_069272331.1\|452164_452368_+	hypothetical protein	NA	NA	NA	NA
WP_069272332.1\|452462_453263_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_069272333.1\|453573_456732_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	2.8e-54	27.8
WP_069269834.1\|461368_461980_+	hypothetical protein	NA	NA	NA	NA
WP_155123136.1\|465162_466506_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_155123137.1\|466460_467102_+	hypothetical protein	A0A2H4JFP5	uncultured_Caudovirales_phage	5.5e-26	64.0
WP_155123063.1\|467016_467532_+	hypothetical protein	NA	NA	NA	NA
WP_155123064.1\|468492_468921_+	hypothetical protein	NA	NA	NA	NA
WP_069272334.1\|468958_469288_+	hypothetical protein	NA	NA	NA	NA
WP_059958899.1\|469346_469586_-	type I addiction module toxin, SymE family	NA	NA	NA	NA
WP_080409491.1\|469659_470001_-	helix-turn-helix transcriptional regulator	Q0H244	Geobacillus_phage	9.7e-06	35.4
WP_155123065.1\|470224_470428_+	hypothetical protein	NA	NA	NA	NA
WP_059808492.1\|470517_470781_+	hypothetical protein	NA	NA	NA	NA
WP_063802372.1\|470849_471035_-	type I addiction module toxin, SymE family	NA	NA	NA	NA
WP_059808498.1\|471086_471269_+	hypothetical protein	NA	NA	NA	NA
WP_155123066.1\|471279_471570_+	hypothetical protein	NA	NA	NA	NA
WP_069272335.1\|471742_473572_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.6e-12	41.7
WP_069269835.1\|473717_474041_+	hypothetical protein	NA	NA	NA	NA
WP_069272336.1\|474089_474680_+	hypothetical protein	NA	NA	NA	NA
WP_071751899.1\|475235_475649_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_069273693.1\|476034_476427_+	hypothetical protein	NA	NA	NA	NA
WP_059740816.1\|476443_476821_+	DUF2750 domain-containing protein	NA	NA	NA	NA
WP_059665895.1\|476878_477661_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_059522310.1\|477657_479004_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_069272337.1\|479107_479719_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_069272338.1\|480093_480738_+	hypothetical protein	NA	NA	NA	NA
WP_027788514.1\|480783_481299_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_006477094.1\|481314_482805_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_006477093.1\|482875_483379_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_006477092.1\|483441_483927_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_059522312.1\|484004_485840_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_059522313.1\|485803_486904_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA

DBSCAN-SWA_3

1978573 : 2042010

Hokovirus(12.5%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060093842.1\|1978573_1979611_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_071733294.1\|1979981_1980311_-	hypothetical protein	NA	NA	NA	NA
WP_059611737.1\|1981170_1981410_-	hypothetical protein	NA	NA	NA	NA
WP_069273010.1\|1981865_1982156_+	glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_069273011.1\|1982190_1982460_+	glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_069273012.1\|1982498_1982765_+	glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_006024227.1\|1982824_1983097_+	glycerol-3-phosphate dehydrogenase subunit C	NA	NA	NA	NA
WP_069273013.1\|1983185_1983380_+	killing trait family protein	NA	NA	NA	NA
WP_081333731.1\|1983382_1983916_+	hypothetical protein	NA	NA	NA	NA
WP_069273014.1\|1983965_1984313_+	hypothetical protein	NA	NA	NA	NA
WP_069273015.1\|1984356_1985457_+	hypothetical protein	NA	NA	NA	NA
WP_059469337.1\|1985453_1985771_+	hypothetical protein	NA	NA	NA	NA
WP_059627204.1\|1985767_1986133_+	hypothetical protein	NA	NA	NA	NA
WP_059761010.1\|1986350_1988270_+	hypothetical protein	NA	NA	NA	NA
WP_059627208.1\|1988323_1988980_+	DUF1906 domain-containing protein	NA	NA	NA	NA
WP_059627203.1\|1989030_1989714_+	DUF1906 domain-containing protein	NA	NA	NA	NA
WP_069273016.1\|1989724_1991296_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_059611721.1\|1991765_1992488_+	response regulator transcription factor	NA	NA	NA	NA
WP_059760896.1\|1992451_1994656_-	response regulator	A0A1V0SGX0	Hokovirus	7.9e-40	31.1
WP_069270214.1\|1994738_1995761_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	2.0e-38	31.8
WP_155123104.1\|1996246_1997426_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.8e-54	40.4
WP_155123105.1\|1997853_1998671_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_069273017.1\|1998878_2000471_-	ABC-F family ATPase	A0A2K9L0W2	Tupanvirus	2.6e-53	26.7
WP_069273018.1\|2000637_2002884_-	AsmA family protein	NA	NA	NA	NA
WP_069273019.1\|2003036_2003735_+	ATP-binding cassette domain-containing protein	A0A1V0SE00	Indivirus	3.6e-07	27.0
WP_021159773.1\|2003731_2004535_+	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_069273020.1\|2004552_2005023_-	hypothetical protein	NA	NA	NA	NA
WP_059521045.1\|2005155_2005707_-	hypothetical protein	NA	NA	NA	NA
WP_069273021.1\|2005868_2006885_-	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_069273022.1\|2007007_2007949_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_042975202.1\|2008176_2009022_+	phosphoserine phosphatase SerB	NA	NA	NA	NA
WP_069273023.1\|2009094_2010291_-	cystathionine beta-lyase	NA	NA	NA	NA
WP_059666564.1\|2010404_2010947_-	hypothetical protein	NA	NA	NA	NA
WP_069273024.1\|2011035_2011962_-	sugar kinase	NA	NA	NA	NA
WP_059521013.1\|2011965_2013327_-	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
WP_069273753.1\|2013613_2015314_+	dihydroxyacetone kinase subunit DhaK	NA	NA	NA	NA
WP_080485655.1\|2015583_2016948_+	insulinase family protein	NA	NA	NA	NA
WP_060226569.1\|2016944_2018291_+	insulinase family protein	NA	NA	NA	NA
WP_080414511.1\|2019418_2019658_+	hypothetical protein	NA	NA	NA	NA
WP_006485265.1\|2020045_2020612_-	polyhydroxyalkanoate synthesis repressor PhaR	NA	NA	NA	NA
WP_006491801.1\|2020732_2021473_-	3-ketoacyl-ACP reductase	NA	NA	NA	NA
WP_069273025.1\|2021592_2022774_-	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_069273026.1\|2022873_2024739_-	class I poly(R)-hydroxyalkanoic acid synthase	NA	NA	NA	NA
WP_069273754.1\|2025102_2025942_-	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_059532849.1\|2025948_2027157_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_021163132.1\|2027198_2028023_+	outer membrane protein assembly factor BamD	NA	NA	NA	NA
WP_069273027.1\|2028091_2030344_-	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	1.1e-76	29.0
WP_006478692.1\|2030399_2030615_-	YdcH family protein	NA	NA	NA	NA
WP_069273028.1\|2031609_2033934_+	RNA-binding transcriptional accessory protein	NA	NA	NA	NA
WP_069273029.1\|2034028_2035948_-	potassium transporter Kup	A7J6G4	Paramecium_bursaria_Chlorella_virus	1.4e-77	32.6
WP_069273030.1\|2036203_2036764_-	phosphoribosyltransferase	NA	NA	NA	NA
WP_059532830.1\|2036814_2038161_-	adenylosuccinate synthase	A0A160ER07	Powai_lake_megavirus	4.5e-70	36.3
WP_059729541.1\|2038274_2039423_-	ATP phosphoribosyltransferase regulatory subunit	NA	NA	NA	NA
WP_011352254.1\|2039523_2039715_-	DUF2065 domain-containing protein	NA	NA	NA	NA
WP_069273031.1\|2039751_2040651_-\|protease	protease modulator HflC	NA	NA	NA	NA
WP_069273032.1\|2040666_2042010_-\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA

DBSCAN-SWA_4

2343061 : 2350172

Burkholderia_phage(33.33%)

integrase

attL 2339213:2339229|attR 2360702:2360718

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2339213:2339229	attL	NA	NA	NA	NA
WP_069273139.1\|2343061_2343853_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.0e-10	27.6
WP_069273767.1\|2343855_2345943_-	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	1.0e-12	33.3
WP_069270302.1\|2346516_2347755_+\|integrase	site-specific integrase	A0A077KET4	Ralstonia_phage	3.8e-108	49.2
WP_069270303.1\|2347834_2348917_-	DUF3396 domain-containing protein	E5E3X8	Burkholderia_phage	1.1e-111	55.0
WP_069270304.1\|2348922_2349654_-	VRR-NUC domain-containing protein	Q8W6S1	Burkholderia_virus	7.1e-62	51.7
WP_069270305.1\|2349650_2350172_-	PAAR domain-containing protein	E5E3Y0	Burkholderia_phage	4.0e-43	54.4
2360702:2360718	attR	NA	NA	NA	NA

DBSCAN-SWA_5

3614060 : 3644081

Staphylococcus_phage(20.0%)

plate,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060092462.1\|3614060_3615086_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_011353531.1\|3615201_3616389_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.7e-121	61.0
WP_059521061.1\|3616653_3617538_+	lipid A biosynthesis lauroyl acyltransferase	A0A1W6JP29	Morganella_phage	7.3e-29	29.5
WP_069273632.1\|3617559_3617862_-	HigA family addiction module antidote protein	NA	NA	NA	NA
WP_155123133.1\|3617899_3618040_-	hypothetical protein	NA	NA	NA	NA
WP_059625899.1\|3618173_3618440_-	Killer protein	NA	NA	NA	NA
WP_069273633.1\|3618808_3619681_+	diaminopimelate epimerase	NA	NA	NA	NA
WP_059731943.1\|3619718_3620447_+	DUF484 family protein	NA	NA	NA	NA
WP_059731944.1\|3620464_3621385_+	tyrosine recombinase XerC	G1JX48	Mycobacterium_phage	8.2e-15	29.2
WP_069273634.1\|3621464_3622673_+	class I SAM-dependent rRNA methyltransferase	NA	NA	NA	NA
WP_069273635.1\|3622874_3623948_+	GTP-binding protein	NA	NA	NA	NA
WP_006477498.1\|3624423_3624840_+	RNA polymerase-binding protein DksA	NA	NA	NA	NA
WP_011353540.1\|3625075_3625612_+\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_042972634.1\|3625622_3626966_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A191ZC11	Erwinia_phage	2.3e-42	28.8
WP_069270612.1\|3627059_3629138_-	hypothetical protein	NA	NA	NA	NA
WP_060154315.1\|3629384_3630503_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_021156278.1\|3630646_3631189_-	response regulator transcription factor	NA	NA	NA	NA
WP_069273636.1\|3631224_3632598_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_069273637.1\|3632686_3632911_-	cysteine-rich CWC family protein	NA	NA	NA	NA
WP_006490510.1\|3633229_3634129_+	acetylglutamate kinase	NA	NA	NA	NA
WP_069273638.1\|3634159_3634918_+	pyrimidine 5'-nucleotidase	NA	NA	NA	NA
WP_069273639.1\|3634884_3635562_+	nucleoid occlusion factor SlmA	NA	NA	NA	NA
WP_069273640.1\|3635603_3638276_-	type VI secretion system ATPase TssH	A0A248SJW6	Salicola_phage	1.1e-72	30.8
WP_155123134.1\|3638352_3638673_+	hypothetical protein	NA	NA	NA	NA
WP_080485683.1\|3638762_3639788_+	TagK domain-containing protein	NA	NA	NA	NA
WP_069270614.1\|3639768_3640629_+	ImpE protein superfamily protein	NA	NA	NA	NA
WP_059538683.1\|3640612_3641134_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_069273641.1\|3641135_3643016_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_059538665.1\|3643019_3644081_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP013442

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013442_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013442_1

422749-422986

Orphan

Consensus_repeat	Method
GCCGATCGCCACCGCGCCGTTGCCG	CRISPRCasFinder

5 spacers

The CRISPR arrays of NZ_CP013442_1

>merge|NZ_CP013442|1|422749-422986|CRISPRCasFinder
GCCGAGTGCGAGCGAGCCCGTGCCCTGCGCGATGTTCGAATTGCCGATCGCCACCGCGCCGTTGCCGTTCGCGGTGTTGTTCGAGCCCGTCGTCACGGCGCCGGTGCCGATCGCCGTGCTCGGATCGCCGATCGCCACCGCGCCGTTGCCGCTCACCGTTTGCCCTTCGCCGAGCGCCACCGCGCCGATGCCGCCGAGCACTCGAGAGTTGTGGCCGCCCGCTATCGAACCGGTGCCG

>NZ_CP013442|1|1|422749-422986|CRISPRCasFinder
GCCGAGTGCGAGCGAGCCCGTGCCC	TGCGCGATGTTCGAATT
GCCGATCGCCACCGCGCCGTTGCCG	TTCGCGGTGTTGTTCGA
GCCCGTCGTCACGGCGCCGGTGCCG	ATCGCCGTGCTCGGATC
GCCGATCGCCACCGCGCCGTTGCCG	CTCACCGTTTGCCCTTC
GCCGAGCGCCACCGCGCCGATGCCG	CCGAGCACTCGAGAGTTGTG
GCCGCCCGCTATCGAACCGGTGCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013442.1\|WP_069269555.1\|428263_429283_+\|depolymerase	unknown	unknown	gnl\|CDD\|313683
NZ_CP013442.1\|WP_069269556.1\|436666_437683_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|227099
NZ_CP013442.1\|WP_069272037.1\|407312_408806_-\|NAD(P)-binding-protein	unknown	unknown	gnl\|CDD\|224152
NZ_CP013442.1\|WP_059627047.1\|417109_417457_-\|H-NS-histone-family-protein	unknown	unknown	gnl\|CDD\|376390
NZ_CP013442.1\|WP_042585674.1\|434390_435677_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340926
NZ_CP013442.1\|WP_069272036.1\|406644_407301_-\|cytochrome-c4	unknown	unknown	gnl\|CDD\|225418
NZ_CP013442.1\|WP_069272171.1\|425825_427970_-\|TonB-dependent-siderophore-receptor	unknown	unknown	gnl\|CDD\|236643
NZ_CP013442.1\|WP_155774626.1\|415133_415874_+\|response-regulator	unknown	unknown	gnl\|CDD\|223816
NZ_CP013442.1\|WP_069272039.1\|410683_413827_-\|multidrug-efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|273335
NZ_CP013442.1\|WP_069272043.1\|424929_425763_+\|response-regulator	unknown	unknown	gnl\|CDD\|381147
NZ_CP013442.1\|WP_069272042.1\|415870_416959_+\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP013442.1\|WP_042585671.1\|429336_429888_-\|glutathione-peroxidase	unknown	unknown	gnl\|CDD\|182585
NZ_CP013442.1\|WP_059804545.1\|435748_436063_+\|H-NS-histone-family-protein	unknown	unknown	gnl\|CDD\|376390
NZ_CP013442.1\|WP_059871138.1\|417545_418214_-\|OmpA-family-protein	unknown	unknown	gnl\|CDD\|143586
NZ_CP013442.1\|WP_069272038.1\|409179_410679_-\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|182103
NZ_CP013442.1\|WP_069272044.1\|430024_432571_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|236645
NZ_CP013442.1\|WP_042585676.1\|436419_436632_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013442.1\|WP_069272035.1\|405920_406610_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013442.1\|WP_069272040.1\|413847_415005_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|169982
NZ_CP013442.1\|WP_042585673.1\|433352_434258_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182990

Protein	Function_ID	Function_description	E-value
NZ_CP013442.1\|WP_069269555.1\|428263_429283_+\|depolymerase	gnl\|CDD\|313683	pfam10503, Esterase_phd, Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.	3.69061e-05
NZ_CP013442.1\|WP_069272037.1\|407312_408806_-\|NAD(P)-binding-protein	gnl\|CDD\|224152	COG1231, COG1231, Monoamine oxidase [Amino acid transport and metabolism].	2.73883e-61
NZ_CP013442.1\|WP_059627047.1\|417109_417457_-\|H-NS-histone-family-protein	gnl\|CDD\|376390	pfam00816, Histone_HNS, H-NS histone family.	3.90709e-14
NZ_CP013442.1\|WP_042585674.1\|434390_435677_+\|MFS-transporter	gnl\|CDD\|340926	cd17368, MFS_CitA, Citrate-proton symporter of the Major Facilitator Superfamily of transporters. Citrate-proton symporter, also called citrate carrier protein or citrate transporter or citrate utilization protein A (CitA), is a proton symporter that functions in the uptake of citrate across the boundary membrane. It allows the utilization of citrate as a sole source of carbon and energy. In Klebsiella pneumoniae, the gene encoding this protein is called citH, instead of citA, which is the case for Escherichia coli and other organisms. CitA belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.53832e-121
NZ_CP013442.1\|WP_069272036.1\|406644_407301_-\|cytochrome-c4	gnl\|CDD\|225418	COG2863, COG2863, Cytochrome c553 [Energy production and conversion].	8.29321e-20
NZ_CP013442.1\|WP_069272171.1\|425825_427970_-\|TonB-dependent-siderophore-receptor	gnl\|CDD\|236643	PRK10044, PRK10044, ferrichrome outer membrane transporter; Provisional.	3.8684e-149
NZ_CP013442.1\|WP_155774626.1\|415133_415874_+\|response-regulator	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	4.59037e-69
NZ_CP013442.1\|WP_069272039.1\|410683_413827_-\|multidrug-efflux-RND-transporter-permease-subunit	gnl\|CDD\|273335	TIGR00915, Probable_aminoglycoside_efflux_pump, The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family. Proteins scoring above the trusted cutoff (1000) form a tight clade within the RND (Resistance-Nodulation-Cell Division) superfamily. Proteins scoring greater than the noise cutoff (100) appear to form a larger clade, cleanly separated from more distant homologs that include cadmium/zinc/cobalt resistance transporters. This family is one of several subfamilies within the scope of pfam00873. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Unknown substrate].	0
NZ_CP013442.1\|WP_069272043.1\|424929_425763_+\|response-regulator	gnl\|CDD\|381147	cd19920, REC_PA4781-like, phosphoacceptor receiver (REC) domain of cyclic di-GMP phosphodiesterase PA4781 and similar domains. Pseudomonas aeruginosa cyclic di-GMP phosphodiesterase PA4781 contains an N-terminal REC domain and a C-terminal catalytic HD-GYP domain, characteristics of RpfG family response regulators. PA4781 is involved in cyclic di-3',5'-GMP (c-di-GMP) hydrolysis/degradation in a two-step reaction via the linear intermediate pGpG to produce GMP. Its unphosphorylated REC domain prevents accessibility of c-di-GMP to the active site. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	1.47126e-51
NZ_CP013442.1\|WP_069272042.1\|415870_416959_+\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	2.40863e-49
NZ_CP013442.1\|WP_059804545.1\|435748_436063_+\|H-NS-histone-family-protein	gnl\|CDD\|376390	pfam00816, Histone_HNS, H-NS histone family.	5.90748e-22
NZ_CP013442.1\|WP_059871138.1\|417545_418214_-\|OmpA-family-protein	gnl\|CDD\|143586	cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA. OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. Well-studied members of this family include the Escherichia coli outer membrane protein OmpA, the Escherichia coli lipoprotein PAL, Neisseria meningitdis RmpM, which interact with the outer membrane, as well as the Escherichia coli motor protein MotB, and the Vibrio flagellar motor proteins PomB and MotY, which interact with the inner membrane.	2.83236e-40
NZ_CP013442.1\|WP_069272038.1\|409179_410679_-\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|182103	PRK09837, PRK09837, Cu(I)/Ag(I) efflux RND transporter outer membrane protein.	1.72364e-105
NZ_CP013442.1\|WP_069272044.1\|430024_432571_-\|EAL-domain-containing-protein	gnl\|CDD\|236645	PRK10060, PRK10060, cyclic di-GMP phosphodiesterase.	4.13311e-124
NZ_CP013442.1\|WP_069269556.1\|436666_437683_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|227099	COG4757, COG4757, Predicted alpha/beta hydrolase [General function prediction only].	1.34734e-40
NZ_CP013442.1\|WP_042585671.1\|429336_429888_-\|glutathione-peroxidase	gnl\|CDD\|182585	PRK10606, btuE, putative glutathione peroxidase; Provisional.	1.01145e-83
NZ_CP013442.1\|WP_069272040.1\|413847_415005_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|169982	PRK09578, PRK09578, MexX/AxyX family multidrug efflux RND transporter periplasmic adaptor subunit.	2.12314e-81
NZ_CP013442.1\|WP_042585673.1\|433352_434258_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|182990	PRK11139, PRK11139, DNA-binding transcriptional activator GcvA; Provisional.	3.40438e-52

>NZ_CP013442.1|WP_059871138.1|417545_418214_-|OmpA-family-protein
MKNLYLVPILSALLLSACTSASGPTFSAYELQPRDGIRTYQVDCHGIFSSQATCMKVATRMCADQPVRAVDSTRPFRDGADPGTLVFQCGAAAGAAASAPVAAEAPAPVQNVNLSSDALFAFGSATLTPAARATLDKLTSQQGDPHFTRVAVTGHTDAIGSDTSNLQLSQQRADAVAGYLRERGLRADTFVVTGRGKADPVASNATAEGRAGNRRVEIVLQR
>NZ_CP013442.1|WP_059627047.1|417109_417457_-|H-NS-histone-family-protein
MSSESLQELLARRAELDARITTQRTARRKDVVEQIVKLIRDYEIDWRMIEARLLNVGSAWTQRRRHAEPRYWDPDTGATWTGRGRRPHWLKGRNPEDFRIRSPGEAAGESTPTDA
>NZ_CP013442.1|WP_069272042.1|415870_416959_+|HAMP-domain-containing-histidine-kinase
MKLEGMSRQIALSMATIAFGVAALLISTSYVFYFLTFRYWPKLCAQLGWVPTGPEWAWLIATTSVGLALAVLMAIRLARRILVPLNSVANGIRRVARGDLDARAVAGDRSLREAALLADNFNALASELQRVTNEQAIWNAAIAHELRTPVTVLRGRLQGLADGVFPSDETQFRRLLTQVEGLGRLIEDLRVVSLADSGHLNLQVHEADLGADVEAVVAVFDDALKAAGQHAVLDLDTRPMRCDPVRIRQALLALLENARRHAVPGAIRIQTRVEQGRCHLSVEDDGPGIPADFAPHVFDAFRRAEGERSGKGTGLGLAVVAAIAHAHSGQATCRPAAGGGTVFELQWPDDPAPARVPERGQA
>NZ_CP013442.1|WP_155774626.1|415133_415874_+|response-regulator
MTPDTPQPPGAAHHAQPLVLIAEDEPEIAEILTAYLARGGLRTVHAADGRRALELHLQLKPDLVLLDVQMPHVDGWKVLTEIRHRGSTPVILLTALDQDLDKLMGLRIGADDYVVKPFNPAEVVARAQAVLRRSMAASHGSEQRVLRVPPLEIDLDHYEAVVQVGQQRHFLTLTLTEFKLLAQLARAPRRVFSRAELMATCLPEGDALERTVDSHVSKLRKKLDDLGVQGVPVSVRGVGYKLWSVE
>NZ_CP013442.1|WP_069272040.1|413847_415005_-|efflux-RND-transporter-periplasmic-adaptor-subunit
MKNEKLCRYGGVYALAAALLAGCGKSDAPAAPPAIPVAAMTVAPAPLKLTEDLPGRVAAVRIAEIRPQVSGIVQRRLFEQGTEVRAGQPLFQINPAPFKADMDTAAAALQRADAALERAKVQTARLKPLVEVDAISRQVYDDSVSQRDQAAADVAQARATLARRQLDLKFATVEAPITGRIDQALVTEGALVASSDSQPMARIQQIDQVYVDVRQPASSLQHLRDTLASQDSYAGTGLPVDVLRDDDTRYDVRGRMLFSGVNVDPGTGDVLLRVLVDNPKRQLLPGMYVRARVPRAHYANAVMVPQQAVVRAGGKPQVWVLDAKNQAHLKPVELGEQTGRSYRIKSGLQAGQKVVVEGMERLIDGAPAAATDWKSPVAAAATAAR
>NZ_CP013442.1|WP_069272039.1|410683_413827_-|multidrug-efflux-RND-transporter-permease-subunit
MSQFFIRRPVFAWVIALFIILTGLIAIPQLPVARYPSVAPPSVTITANYPGATPQTMNDGVLSLIERELSGVKNLLYFESSADTSGSAQITVTFKPGTDPALAQVDVQNKIKSVEPRLPAAVRQNGLIVESASSGFLLFVALKSDSGRFDEGALADYMARNIVEELRRVEGVGRVQMFGSERAMRIWVDPQKLINFGLSMSDLTTAIGQQNVQIAPGSLGALPALSGQRVTVPLTAEGQLTTPEAFAKVVLRANADGSKVVLGDVARVELGSQSYNFVNTESGKPAVIAGVQLAPGANAVKTADAIRARMAELSKSMPSGMTYSIPLDTSPFVKISIEKVLHTLLEAMVLVFLVMYLFLQNVRYTLIPAIVAPVAMLGTFTVMLLTGFSINVLTMFGMVLAIGIIVDDAIVVVENVERLMAEEGLSPRDATSKAMKEITGAIIGVTLVLTAVFLPMAMASGSVGVIYKQFTMSMAVSILFSALLALTLTPALCATMLKPVEPGHHEKRGFFGWFNRRFERLTNWYETRVGRLVGRTGRVMLVFVAISGALVFGFRGLPSSFLPDEDQGYFMTGFLLPSDATAERTRDVVKTLERHIASRPGIESSISIVGYGFSGQGPNAALNYAVLKDWDKRNGATAMDEAMRAQQAMAGVTEGTVMSLLPPAIDELGNSSGFAMRLEDRANQGTAALKAAEAKLLELAAQSKVVTGVYPDSLPAGTSIRLEIDRQKAEALGVSFTTLSDTLSTAMGSTYVNDFPNAGRMQQVIIQADAPARMQIDKVMKLYVRNAAGGMVPLSEMVRPVWTETPLQMVRFKGYPSARISGTAAPGQSSGAAMAEMERLAAQLPPGFAVEWTGQSLQERQSASEAPMLMVLSMIVVFLVLAALYESWSIPLSVMLVVPLGLIGAIGAVLLRGMPNDVFFKVGMITVIGLSSKNAILIVEFAKQLREEGKGLIEAAVQASKLRLRPILMTSLAFGLGVVPLMIATGASAETQHAIGTGVFGGMVTATVLAIFFVPVFFVFVMSIQERVGAWRASRQNVVAVSQETEG
>NZ_CP013442.1|WP_069272038.1|409179_410679_-|efflux-transporter-outer-membrane-subunit
MRLLVLPVAVALALSACSMAPKLVKPEMPVPTAYTTAGAQADTQADTRANAADLGWRTMFGDRRLQRLIELALDNNRDLRLAALNVQAAEAQYGIQRSARLPSIGAGASFTRQRTAANADLNPPIPESIQQQYGVNVGVSAFEIDLFGRVKSLSDAAFARYLATDHGRRAAQISLIGAVADAYFAERLAQEQRALSERTLNDWRQSLELARKLKEARQASGVDIAQAEGQVASAAADLEARSRAVSQARNALRLLVGTDLPKNLPDPLSLEQQPVVTRLPAGLPSDLLVRRPDIQQAEQNLVAANADIGAARAAFFPRLSLTSSIGFLSPGLGSLFNGDHRAWAFSPQVTLPIFQGGRLRSELTLAEVRKSSAVVEYERSIQTAFREVADGLAGSETFDRQIEAQTRVVASAERRTNLSNLRYRAGIEDRLELLDSQRQLYAARQTLLDLRRDEFGNAVALYKALGGGLSDKDVAPAAGANANPASANPQASGGTPTAG
>NZ_CP013442.1|WP_069272037.1|407312_408806_-|NAD(P)-binding-protein
MAKKSSSNRSADPQRRQWLKYAGTSVAAAGIAMGAARANAGAAEAAGSPGDVLEVAIVGAGLAGLTAARDLRYAGCESFVVLEARDRVGGRTLNYDVGNGYVSEVGGQWIGPGQTAVADLARELEVGTFPSYYTGKTVILGGDGRAEIDLEGTFGTDEAIGARLGKLSRDVPSGAPWTSPKAGELDRLSVGDWLATQNIAAEDRIGWNGSIALSGGVMPAKMGLLHFLSMINSADCDYAQLDSIKHSAQETRFVGGSQILSIRMAQQLGDKVRLSSPVRRIVGWDRDVVAVHTDRGVVRARKVIMAIHPALCNQVQFDPPLPEKRRALQRAWPAHSPARKTAMVYRRPFWRDKGLNGHVFQTDGPVFWAYDNSPPGGEIGIINAFVKNAVMPSDLQAAQRMQTEIYAQAWGKEALSPVAYHDRDWGLADPWTITCVSAIPPGFWTAHGDALRAPCGNLIWSGTETANIWAGYMDGAVRSGHQSALHALNALNAQRRA
>NZ_CP013442.1|WP_069272036.1|406644_407301_-|cytochrome-c4
MKKRILFAVAAIVVVLLAIYGPGLVDLYRLQRYVTASAQASQADGGPWPRVTDACMGCHGVNGNSLNQGYPSLAGQPPSYIAEQLHKFADGQRTNPIMGPLAMTMSEAEIKRLSDYYAKQTAAENRFFEPDARLKARGEQLAKEGACAACHGAQLMGQGSFPRLAGQGVDYVLKQLDAFAAGTRSESTGTMQRVAAAMSPEDRKAVAHYLASVRPAKQ
>NZ_CP013442.1|WP_069272035.1|405920_406610_-|hypothetical-protein
MDQRTFVLCLASALLATTTCIYGWKFVKKRNYLLGIEWLIVTVSSTNALIYFATGFEIPGLVSHVLDAFSRGFGMPVIAVAGLMAVTHGYKPSARQDVALFATSFAGTAVLVGAGFMARVLPYFYVAMWALLSIYLAYFVRRLLAAGQLFHAMTTTVALVASQTIACIYDFYPIPGDAHNVVFNFFVLALVTWSYVTVSLYYAYCALERANRKGRVGDVPSARDRHRLA
>NZ_CP013442.1|WP_069272043.1|424929_425763_+|response-regulator
MSSCLSGSMSLRAAPDLSDAHILVVDDRPDELRFLIDILRVARCRISVAFDGLQAYNRAQAISPDLILMDVRMPRMDGFAACRLLASTPSTQAIPIIFLTAVGDLEDRIEGLEIGAVDYIVKPFEPAEVVARIRNHLKRARGIRPLEQLPVLPDHPDASLVRAASEILLRDLRHPPALDDLARLVGTHEKRLSRAFRDNLGQTVFEYLRDTRLRIAHRFLAETSMGIGDIAVEIGFSTAGNFATAFRERFGITPSDWRKQCMQGDMADTAEACQADA
>NZ_CP013442.1|WP_069272171.1|425825_427970_-|TonB-dependent-siderophore-receptor
MEWATSTVRDTFALAAGAISCATLAGNAYAQATQPAITVQAKASSSGLVEMRTATGTKTDTPVAEVPQTINVVTAQQIEMTGATDLNQALSYVPGFSTFGSDSRTDSYAALRGFTPTLYVDGVAAPNTAVIADWRVDPQMIDSVTVLRGPTSGLYGAGDPGAIVDARTKQADGERIREAGVQIGNYARKQFMFDVGDKLAPDKAAAYRFVGVARDGNALTGPNADRRVALAPSFRWRPNADTSLTLSATYLQDRSDISFNFLPARGTVLPNPNGRLSPDVYTGDPAFNAYRKKQWSLGYQVEHTLNSMWTLRQSARWMHLSLDDATVFGNGLAYGSMTRMMRFAGLFQLNYARFDVDNNVQARFGTGPIEHVLLLGLQYNRQTTTDSVWLALARPLNLYHPVHTPVTDAIFSGPTSLGHVDQYTAMNTFGVYAQDQIRWKRWTLTLGGREDRVTMRKDDRAAGMQADADVSAFSGRIGLTYQGGYGLSPYVSHSTSFEPVIGVRMAGGGLPKPTRGTQTEAGLRWQSPAGNLALSAALYQIDQTHVVTPTPVSLDPTGTTSVQTGKVRSRGIELSAVGKVTRELSVVASYVYQDVKNVQANDASLNNWPVAVPLPRQTASLWVDWTWRMGALSGLGIGSGIRYQSATAGAPDNSLKVASHTLYDAALHYEMPHWRFALNVANLFDRRYISGCNSYEACVFGNERTVLASAKYNW
>NZ_CP013442.1|WP_069269555.1|428263_429283_+|depolymerase
MKFHRTLAAAAIGAALCSRAAFAVDPLPALGADPAHTSVSGLSSGAFMAVQYQVAYSDSVVGSGIVAGGPYYCATGKLANTSKCMGMLPGSLPNPAQLLRAAKGFAARGEIDPLAGLQNDRIYVFSGTKDKVVYQRAVDTTVSFFKDAGVPADNLTYVKTIPAGHALITPDFGNNCPITATPYINHCTVDKQSYDQPGALLSFIYGPLNPPADQPAGKIIAFNQREFAGTATGMAQQAYAYVPQACTQGTACRIHVAFHGCKQSASVVGDDFYQKTSYNRWADTNNIVVLYPQVDASKVPNNPQGCWDWFGYTGKDYAVKAGVQMAAVNAMIGRLTSKP
>NZ_CP013442.1|WP_042585671.1|429336_429888_-|glutathione-peroxidase
MTSPLYDIPVNAIDGTPTTLRPFAGKVLLVVNVASKCGLTQQYEGLEALYEDKRARGLEVLAFPANDFKGQEPGTNDEIQAFCSATFGVKFPLFAKISVVGDDQHPLYRALTQAQPQAADDGPFRERLKGYGIEPNPAPDVLWNFEKFLVSRDGKVVARFAPNVGADDPALVAAIDAELASAQ
>NZ_CP013442.1|WP_069272044.1|430024_432571_-|EAL-domain-containing-protein
MYPSTYDVPVARLVARSILSCTPATPVREVARRMFIERCSSIVVMEEGEAVGIWTEQDALAAGDSPQALDRPVGEVMSSPVLTLEADTPLGEAAVRFKRSGVRHFVVVRDGVAIGVLTQTDVVVNQGPEFFLHLKPIESIHVHPPVVVPGHVALHDVVARMRAEKLDAVLVAYDDGEHGILTERDIVRLIAGGGLRGAVGEHASRPLRMLATNQSLYAAHRYMMQQNMRHVGIHDDHGALTGLLCFADVLQSIEHEYANELRSAVRERDEALGLARFNLRMADRVFESALEGIVVTDRHARIERVNQAFTRLTGYTADEVIGRNPGLLSSGRQTPDFYKQLWHSLTTDGHWQGEIWNRRKTGELFLEYLTITSIRDNDDEISHYAAIFSDITQRRQAEERLGYLATHDVLTDLANRALFEERLAHAIAHAKRLGRKVAVMYLDLDRFKLVNDTLGHNAGDEVLKRVAERIVASVRANDTVARMGGDEFALVLEEFDDVRDVGRVARKLLDEVARAIDVGGREIFVTPSIGISIYPDDGTEAEHLILLADQAMYGAKSRGRNVFQFFESKMTSSAMEQLETLGELHRALEQNEFRLFYQPQYDLASGRIVGVEALLRWLHPRKGLVPPGDFIGLAERSALIVPIGRWVLREACRQARRWLDEGFEFGRVSVNVSARQCFTDHFLSDLTTILSETALPAECLQLELLESMAMNTREEIGILLRELATRGISLAIDDFGTGYSSLVYLKDLPVDTLKIDRSFLTDCGSGSTDDAIVRAIVAMGRALGLDVVMEGVETEKQLAFLQEIGCHQVQGFLFARPQPAEQLAGISQGRGDGRAAAGDDGGAALLAG
>NZ_CP013442.1|WP_042585673.1|433352_434258_+|LysR-family-transcriptional-regulator
MRIHPIPPLQCLVFFDAAARHGNFTRAAEELNVTQGAVSKQVVKLESFLGMQLFVRDAKALHLTRAGQTYADRIHDMLISCSEATALVMKEPTPHSITIACASGTAGMFLTPLIAEFSREYPSVAVRILVREGVFNLNPAEFDIGVYYIRDAPPPGMSGIRIIEEEVHAYCAPDYLGRRRVLPLELMSSTLLVAEEQQRQWMSWRDWFHLCDSEITYKPLRTITANSYPVLLQLALRGHGVILGWNHMITPLVESNDLVLASDASASFGGAYQLVWPDDRRDTAAVAHFREWLLKRMPRRR
>NZ_CP013442.1|WP_042585674.1|434390_435677_+|MFS-transporter
METTVGLHGSRRDSTAQERTKAVVAVIVGNGFEWFDFISYGFFSVIIAKLFFPTSDDNLSLLLSVSTIGVGFFMRPVGGIILGGMADKIGRRATLVITISLMTIGTALIAFAPTYKDAGILAPLMIVCARLLQGFSAGGEMGGATGFLRDHVPAERLGYYTSWIQASIGFAIILASVLAVVLVKYLSVDQVESWGWRIPFLIGLCLGPLGIYIRNQAHDSTEDVTRVRERTPVIEIARRWKSKTLIGFGLVIFWTVCSYVLLFYIPTYATKVLHLPASTGFIAVLVGASIVLFVTPIFGHLSDRYGRRRFLMGALVMAIIAAHPLFKLLNASPGLHSLLLFQIVFGLVIACYEGPILAALSDTFPRQIVSTGISISYNLAVITFGGFSAAILTWAIAATQNNLAPAFYVMGTAALSFIATACWSPRKD
>NZ_CP013442.1|WP_059804545.1|435748_436063_+|H-NS-histone-family-protein
MSELYSETYRELQARLKSVSEAAEIARKKEAADAIKAIRQTVCQYGISAEDIFGRAKPNGGRGKRRGSVAPKYRDPETGATWSGRGRPPLWIAGRSRDAFLITR
>NZ_CP013442.1|WP_042585676.1|436419_436632_-|hypothetical-protein
MLLSPHEIAALMVLASTPCQLDGELAEVRALLGHGLVRLDADASAQVRVLLSVQGRDVVSRLASTPAVRG
>NZ_CP013442.1|WP_069269556.1|436666_437683_-|alpha/beta-fold-hydrolase
MNDGDTRIAEPESIALTAADGYPIKGFVWRHRTGEDDGEPRPVVIVNAATSVRCRYYFRFAAYLHRHGYDAIVYDYRGIGESRPAQLARLDATWLDWGERDFEAVLRYALAEFPGQPVDVVAHSIGGFVAGLAPSNHLVRRMFTMGAQYAHWRDYAPRSKLAMLWKWHVVMPVLSAVFGYFPAKRLGWMEDTPKGVALSWSRSRPDFEDTYRRAPIARDDAQRRALVRRFAGMRAQVLAASVTDDPFGTIAAIERLLRYFTRSSVVHLRIPPDAIGVDSIGHFAFFHSRFESTLWPIPLGWLKTGTLAPATPGRIVSERAAPGQADAEPAVEHQIVLL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP013442_1	1.2\|422816\|17\|NZ_CP013442\|CRISPRCasFinder	422816-422832	17	NZ_CP013443.1	3443786-3443802	1	0.941
NZ_CP013442_1	1.2\|422816\|17\|NZ_CP013442\|CRISPRCasFinder	422816-422832	17	NZ_CP013444.1	933816-933832	1	0.941
NZ_CP013442_1	1.2\|422816\|17\|NZ_CP013442\|CRISPRCasFinder	422816-422832	17	NZ_CP013444.1	3128276-3128292	1	0.941
NZ_CP013442_1	1.3\|422858\|17\|NZ_CP013442\|CRISPRCasFinder	422858-422874	17	NZ_CP013442.1	549437-549453	2	0.882

1. spacer 1.2|422816|17|NZ_CP013442|CRISPRCasFinder matches to position: 3443786-3443802, mismatch: 1, identity: 0.941

ttcgcggtgttgttcga	CRISPR spacer
ttcgcggcgttgttcga	Protospacer
*******.*********

2. spacer 1.2|422816|17|NZ_CP013442|CRISPRCasFinder matches to position: 933816-933832, mismatch: 1, identity: 0.941

ttcgcggtgttgttcga	CRISPR spacer
ttcgcggtgttgtccga	Protospacer
*************.***

3. spacer 1.2|422816|17|NZ_CP013442|CRISPRCasFinder matches to position: 3128276-3128292, mismatch: 1, identity: 0.941

ttcgcggtgttgttcga	CRISPR spacer
ttcgcggtggtgttcga	Protospacer
********* *******

4. spacer 1.3|422858|17|NZ_CP013442|CRISPRCasFinder matches to position: 549437-549453, mismatch: 2, identity: 0.882

atcgccgtgctcggatc	CRISPR spacer
atcgtcgtgctcgaatc	Protospacer
****.********.***

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP013444

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP013443

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP013442

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection