CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP013463	Burkholderia ubonensis strain MSMB1471WGS chromosome 1, complete sequence	0 crisprs	cas3,Cas14u_CAS-V,DEDDh,csa3,RT,DinG	0	4
NZ_CP013462	Burkholderia ubonensis strain MSMB1471WGS plasmid pMSMB1471, complete sequence	0 crisprs	NA	0	0
NZ_CP013464	Burkholderia ubonensis strain MSMB1471WGS chromosome 2, complete sequence	2 crisprs	cas3,csa3,DinG,PD-DExK	4	2
NZ_CP013465	Burkholderia ubonensis strain MSMB1471WGS chromosome 3, complete sequence	0 crisprs	Cas14u_CAS-V	0	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

180666 : 209826

Burkholderia_phage(80.0%)

integrase,plate,tail,holin

attL 172734:172753|attR 185290:185309

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
172734:172753	attL	NA	NA	NA	NA
WP_069236708.1\|180666_181743_-\|integrase	site-specific integrase	A0A1S5NNJ1	Burkholderia_phage	6.1e-171	84.3
WP_080340739.1\|181610_182060_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_080436232.1\|182069_182429_-	hypothetical protein	NA	NA	NA	NA
WP_069236709.1\|182425_185218_-	toprim domain-containing protein	E5E3N5	Burkholderia_phage	0.0e+00	92.1
WP_069236710.1\|185221_185485_-	hypothetical protein	E5E3N6	Burkholderia_phage	5.0e-18	65.1
185290:185309	attR	NA	NA	NA	NA
WP_010095912.1\|185688_185937_-	ogr/Delta-like zinc finger family protein	K4PAZ0	Burkholderia_phage	5.9e-37	91.5
WP_010095910.1\|186061_186277_-	hypothetical protein	E5E3U1	Burkholderia_phage	2.0e-20	81.4
WP_155122560.1\|186403_186859_+	transcriptional regulator	E5E3U2	Burkholderia_phage	1.2e-43	62.9
WP_059586364.1\|187230_187527_+	hypothetical protein	E5E3U3	Burkholderia_phage	7.1e-13	50.5
WP_060375305.1\|187658_188744_-	phage late control D family protein	K4PAY4	Burkholderia_phage	3.5e-134	70.5
WP_060308450.1\|188740_189196_-\|tail	phage tail protein	K4NXK5	Burkholderia_phage	6.6e-42	66.7
WP_069236711.1\|189227_191771_-	hypothetical protein	E5E3U6	Burkholderia_phage	2.8e-142	49.0
WP_076481858.1\|191786_191900_-\|tail	GpE family phage tail protein	E5E3U7	Burkholderia_phage	4.0e-09	75.7
WP_060323165.1\|191908_192292_-\|tail	phage tail assembly protein	A4JWS5	Burkholderia_virus	1.3e-27	63.9
WP_080431718.1\|192361_192865_-\|tail	phage major tail tube protein	E5E3U9	Burkholderia_phage	3.1e-69	74.3
WP_060323159.1\|192899_194072_-\|tail	phage tail sheath protein	A4JWS7	Burkholderia_virus	3.5e-188	83.0
WP_069236712.1\|194127_195000_-\|tail	tail fiber assembly protein	E5E3Q6	Burkholderia_phage	6.6e-115	72.5
WP_069236713.1\|195010_196588_-\|tail	phage tail protein	E5FFH1	Burkholderia_phage	3.1e-139	65.1
WP_069236714.1\|196594_197137_-\|tail	phage tail protein I	E5FFH2	Burkholderia_phage	5.6e-72	72.1
WP_060323150.1\|197129_198044_-\|plate	baseplate J/gp47 family protein	E5FFH3	Burkholderia_phage	1.7e-121	73.6
WP_059609406.1\|198040_198403_-	GPW/gp25 family protein	K4PAX6	Burkholderia_phage	5.4e-39	66.7
WP_042586752.1\|198399_199083_-\|plate	phage baseplate assembly protein V	E5E3V6	Burkholderia_phage	1.2e-76	67.3
WP_069237309.1\|199587_200031_-\|tail	phage tail protein	NA	NA	NA	NA
WP_069236715.1\|200033_201089_-	hypothetical protein	A4JWL8	Burkholderia_virus	5.1e-53	43.4
WP_060323140.1\|201085_201652_-\|tail	phage tail protein I	Q6QI98	Burkholderia_phage	1.7e-39	50.3
WP_059476704.1\|201644_202556_-\|plate	baseplate J/gp47 family protein	E5FFH3	Burkholderia_phage	1.5e-74	49.8
WP_060308486.1\|202552_203008_-\|tail	phage tail protein	E5E3V9	Burkholderia_phage	2.4e-31	56.5
WP_080487037.1\|203124_203565_-	protein lysB	K4NXJ2	Burkholderia_phage	3.5e-16	45.9
WP_060323136.1\|203561_204395_-	N-acetylmuramidase family protein	A4JWZ0	Burkholderia_virus	3.2e-95	67.7
WP_010095863.1\|204398_204665_-\|holin	phage holin family protein	K4NX91	Burkholderia_phage	1.2e-24	68.2
WP_010095861.1\|204666_205011_-	membrane protein	A4JWU2	Burkholderia_virus	6.7e-39	79.6
WP_060323133.1\|205026_205233_-\|tail	tail protein X	E5E3W5	Burkholderia_phage	6.4e-21	72.1
WP_069237310.1\|205654_206125_-	DUF523 domain-containing protein	NA	NA	NA	NA
WP_060308613.1\|206316_207858_+	TIGR04222 domain-containing membrane protein	NA	NA	NA	NA
WP_059962402.1\|208155_209826_+	MCP four helix bundle domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	2.1e-21	33.2

DBSCAN-SWA_2

453661 : 495385

uncultured_Caudovirales_phage(50.0%)

protease,transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069236753.1\|453661_454171_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	1.2e-20	48.6
WP_155122617.1\|455043_456168_-	heptosyltransferase	NA	NA	NA	NA
WP_155122618.1\|456173_457403_-	O-antigen ligase family protein	NA	NA	NA	NA
WP_059617973.1\|457542_458406_-	beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase	A0A0P0YM34	Yellowstone_lake_phycodnavirus	8.5e-22	30.3
WP_069236754.1\|458521_459346_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_069236755.1\|459685_459967_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_069236756.1\|460889_463787_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	1.9e-49	26.7
WP_069236757.1\|463790_464339_+	hypothetical protein	NA	NA	NA	NA
WP_059963007.1\|464363_466304_+	TIGR02594 family protein	A0A1U9ZAE8	Proteus_phage	8.3e-09	36.2
WP_060302504.1\|466332_466842_+	hypothetical protein	NA	NA	NA	NA
WP_069236758.1\|466915_467467_+	hypothetical protein	NA	NA	NA	NA
WP_069236759.1\|467669_467930_+	hypothetical protein	NA	NA	NA	NA
WP_059931479.1\|468290_468494_+	hypothetical protein	NA	NA	NA	NA
WP_045566772.1\|468596_469397_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_069236760.1\|469718_472892_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	1.8e-53	27.6
WP_155122563.1\|472929_477567_+	RHS domain-containing protein	A0A2H4JFP5	uncultured_Caudovirales_phage	5.9e-45	49.3
WP_059962993.1\|477568_477952_+	hypothetical protein	NA	NA	NA	NA
WP_080410724.1\|478597_478852_+	hypothetical protein	NA	NA	NA	NA
WP_059958899.1\|478907_479147_-	type I addiction module toxin, SymE family	NA	NA	NA	NA
WP_080410723.1\|479220_479562_-	helix-turn-helix transcriptional regulator	Q0H244	Geobacillus_phage	3.3e-06	41.7
WP_141715289.1\|479785_479989_+	hypothetical protein	NA	NA	NA	NA
WP_059962985.1\|480078_480342_+	hypothetical protein	NA	NA	NA	NA
WP_063802372.1\|480410_480596_-	type I addiction module toxin, SymE family	NA	NA	NA	NA
WP_069236761.1\|480822_481044_+	hypothetical protein	NA	NA	NA	NA
WP_069237315.1\|481138_482536_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_069236762.1\|482932_484762_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.8e-13	43.9
WP_060302519.1\|484924_485248_+	hypothetical protein	NA	NA	NA	NA
WP_059536594.1\|485368_486148_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_059962968.1\|486144_487491_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_059962965.1\|487593_488205_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_141715287.1\|488191_488416_+	hypothetical protein	NA	NA	NA	NA
WP_059962962.1\|488580_489222_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_042582986.1\|489265_489793_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_059536578.1\|489808_491299_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_010096526.1\|491367_491871_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_042582988.1\|491934_492420_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_060323571.1\|492485_494321_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_059962957.1\|494284_495385_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA

DBSCAN-SWA_3

789365 : 802359

Hokovirus(12.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059971004.1\|789365_791318_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	3.5e-148	49.2
WP_059611180.1\|791574_792708_+	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	2.4e-24	37.9
WP_069236809.1\|792712_794575_+	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	1.9e-55	36.9
WP_042583171.1\|794720_795536_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	2.8e-35	30.5
WP_060305116.1\|795577_796264_-	deoxynucleoside kinase	A0A0M3UL55	Enterococcus_phage	1.2e-05	23.7
WP_010091451.1\|796260_796806_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_059971010.1\|796839_798360_-	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	1.4e-24	33.3
WP_059971013.1\|798365_799043_-	HAD-IB family hydrolase	NA	NA	NA	NA
WP_080487052.1\|799054_799993_-	DnaA regulatory inactivator Hda	NA	NA	NA	NA
WP_060305121.1\|800018_801074_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	4.9e-72	45.9
WP_063897314.1\|801168_802359_-	Tet(A)/Tet(B)/Tet(C) family tetracycline efflux MFS transporter	A0A2H4UVM2	Bodo_saltans_virus	6.9e-06	25.0

DBSCAN-SWA_4

901841 : 908839

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069236829.1\|901841_902903_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	5.4e-87	47.0
WP_069236830.1\|902914_903808_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	3.7e-97	58.5
WP_069236831.1\|903792_904344_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	8.8e-49	53.0
WP_069236832.1\|904340_905240_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	2.2e-25	35.7
WP_069237322.1\|905379_906825_+	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	4.7e-57	29.3
WP_069236833.1\|906824_907619_+	ABC transporter permease	NA	NA	NA	NA
WP_069236834.1\|907618_908839_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.5e-11	26.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP013464

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013464_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013464_1

541533-541928

Orphan

Consensus_repeat	Method
GGACGTACCCGANGACGT	CRT

8 spacers

The CRISPR arrays of NZ_CP013464_1

>merge|NZ_CP013464|1|541533-541928|CRT
GGTCGTGCCGAGCGACGTGACGAGGTTGCCGGTCTGCTGAAAGATGCTGCCGAGCGGGGTGGAGCCTGAGGTGCCCGAGGACGTACCGGAAGACGTGCCGGAAGACGTACCCGAGGACGTACCCGAGGACGTACCCGAGGACGTACCCGAGGACGTACCCGAGGATGTGCCGGAGGACGTACCCGAGGATGTGCCGGAGGACGTACCCGAAGACGTACCCGAGGACGTACCCGAGGATGTGCCGGAGGATGTGCCGGAGGACGTACCCGAGGACGTACCCGAGGACGTACCCGAGGACGTACCCGAGGACGTACCCGAGGACGTACCCGAGGATGTGCCGGAGGACGTACCCGAGGACGTACCCGAGGATGTGCCGGAGGACGTACCCGAAGACGT

>NZ_CP013464|1|1|541533-541928|CRT
GGTCGTGCCGAGCGACGT	GACGAGGTTGCCGGTCTGCTGAAAGATGCTGCCGAGCGGGGTGGAGCCTGAGGTGCCCGA
GGACGTACCGGAAGACGT	GCCGGAAGACGTACCCGAGGACGTACCCGA
GGACGTACCCGAGGACGT	ACCCGAGGACGTACCCGAGGATGTGCCGGA
GGACGTACCCGAGGATGT	GCCGGAGGACGTACCCGA
AGACGTACCCGAGGACGT	ACCCGAGGATGTGCCGGAGGATGTGCCGGA
GGACGTACCCGAGGACGT	ACCCGAGGACGTACCCGA
GGACGTACCCGAGGACGT	ACCCGAGGACGTACCCGAGGATGTGCCGGA
GGACGTACCCGAGGACGT	ACCCGAGGATGTGCCGGA
GGACGTACCCGAAGACGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013464.1\|WP_060325471.1\|548380_549025_+\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|198315
NZ_CP013464.1\|WP_060325465.1\|550771_553015_+\|TonB-dependent-siderophore-receptor	unknown	unknown	gnl\|CDD\|273805
NZ_CP013464.1\|WP_059587080.1\|553048_553660_+\|nicotinamide-mononucleotide-transporter	unknown	unknown	gnl\|CDD\|377432
NZ_CP013464.1\|WP_060325484.1\|538921_540205_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224931
NZ_CP013464.1\|WP_069237518.1\|529190_529637_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013464.1\|WP_042587169.1\|542552_542951_+\|carboxymuconolactone-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|131478
NZ_CP013464.1\|WP_141715420.1\|535857_536484_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319924
NZ_CP013464.1\|WP_069237520.1\|530872_535141_+\|RHS-domain-containing-protein	unknown	unknown	gnl\|CDD\|225750
NZ_CP013464.1\|WP_060306803.1\|530383_530857_+\|DUF1795-domain-containing-protein	unknown	unknown	gnl\|CDD\|370123
NZ_CP013464.1\|WP_141715421.1\|535140_535767_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013464.1\|WP_060325469.1\|549058_550036_+\|pyridoxamine-5'-phosphate-oxidase-family-protein	unknown	unknown	gnl\|CDD\|274926
NZ_CP013464.1\|WP_060307990.1\|537094_537532_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013464.1\|WP_059967377.1\|542987_543974_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|366166
NZ_CP013464.1\|WP_141715419.1\|536573_536957_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319898
NZ_CP013464.1\|WP_029226088.1\|550159_550363_+\|DUF2970-domain-containing-protein	unknown	unknown	gnl\|CDD\|378581
NZ_CP013464.1\|WP_059967371.1\|546591_547248_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP013464.1\|WP_060325487.1\|537550_538348_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013464.1\|WP_060325474.1\|547297_548254_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP013464.1\|WP_069237519.1\|529745_530192_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013464.1\|WP_069237522.1\|544002_545604_-\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224983

Protein	Function_ID	Function_description	E-value
NZ_CP013464.1\|WP_060325471.1\|548380_549025_+\|glutathione-S-transferase	gnl\|CDD\|198315	cd03206, GST_C_7, C-terminal, alpha helical domain of an unknown subfamily 7 of Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.	4.30507e-47
NZ_CP013464.1\|WP_059587080.1\|553048_553660_+\|nicotinamide-mononucleotide-transporter	gnl\|CDD\|377432	pfam04973, NMN_transporter, Nicotinamide mononucleotide transporter. Members of this family are integral membrane proteins that are involved in transport of nicotinamide mononucleotide.	2.19382e-48
NZ_CP013464.1\|WP_060325484.1\|538921_540205_-\|hypothetical-protein	gnl\|CDD\|224931	COG2020, STE14, Putative protein-S-isoprenylcysteine methyltransferase [Posttranslational modification, protein turnover, chaperones].	0.00896602
NZ_CP013464.1\|WP_060325465.1\|550771_553015_+\|TonB-dependent-siderophore-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	5.75089e-122
NZ_CP013464.1\|WP_042587169.1\|542552_542951_+\|carboxymuconolactone-decarboxylase-family-protein	gnl\|CDD\|131478	TIGR02425, putative_gamma-carboxymuconolactone_decarboxylase, 4-carboxymuconolactone decarboxylase. Members of this family are 4-carboxymuconolactone decarboxylase, which catalyzes the third step in the catabolism of protocatechuate (and therefore the fourth step in the catabolism of para-hydroxybenzoate, of 3-hydroxybenzoate, of vanillate, etc.). Most members of this family are encoded within protocatechuate catabolism operons. This protein is sometimes found as a fusion protein with other enzymes of the pathway, as in Rhodococcus opacus, Streptomyces avermitilis, and Caulobacter crescentus. [Energy metabolism, Other].	6.66345e-39
NZ_CP013464.1\|WP_141715419.1\|536573_536957_+\|VOC-family-protein	gnl\|CDD\|319898	cd06587, VOC, vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). Type I extradiol dioxygenases catalyze the incorporation of both atoms of molecular oxygen into aromatic substrates, which results in the cleavage of aromatic rings. They are key enzymes in the degradation of aromatic compounds. Type I extradiol dioxygenases include class I and class II enzymes. Class I and II enzymes show sequence similarity; the two-domain class II enzymes evolved from a class I enzyme through gene duplication. Glyoxylase I catalyzes the glutathione-dependent inactivation of toxic methylglyoxal, requiring zinc or nickel ions for activity. The antibiotic resistance proteins in this family use a variety of mechanisms to block the function of antibiotics. Bleomycin resistance protein (BLMA) sequesters bleomycin's activity by directly binding to it. Whereas, three types of fosfomycin resistance proteins employ different mechanisms to render fosfomycin inactive by modifying the fosfomycin molecule. Although the proteins in this superfamily are functionally distinct, their structures are similar. The difference among the three dimensional structures of the three types of proteins in this superfamily is interesting from an evolutionary perspective. Both glyoxalase I and BLMA show domain swapping between subunits. However, there is no domain swapping for type 1 extradiol dioxygenases.	5.44362e-05
NZ_CP013464.1\|WP_069237520.1\|530872_535141_+\|RHS-domain-containing-protein	gnl\|CDD\|225750	COG3209, RhsA, Rhs family protein [Cell envelope biogenesis, outer membrane].	9.60582e-34
NZ_CP013464.1\|WP_060306803.1\|530383_530857_+\|DUF1795-domain-containing-protein	gnl\|CDD\|370123	pfam08786, DcrB, DcrB. DcrB is a bacterial protein required for phages C1 and C6 adsorption. It may be involved in the opening or formation of diffusion channels in the outer membrane. Structurally, it consist of an antiparallel beta sheet with some alpha helical regions.	6.83026e-45
NZ_CP013464.1\|WP_059967371.1\|546591_547248_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.74945e-09
NZ_CP013464.1\|WP_059967377.1\|542987_543974_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|366166	pfam00561, Abhydrolase_1, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	3.28417e-26
NZ_CP013464.1\|WP_141715420.1\|535857_536484_+\|hypothetical-protein	gnl\|CDD\|319924	cd07263, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	0.000154121
NZ_CP013464.1\|WP_029226088.1\|550159_550363_+\|DUF2970-domain-containing-protein	gnl\|CDD\|378581	pfam11174, DUF2970, Protein of unknown function (DUF2970). This short family is conserved in Proteobacteria. The function is not known.	2.98046e-11
NZ_CP013464.1\|WP_060325469.1\|549058_550036_+\|pyridoxamine-5'-phosphate-oxidase-family-protein	gnl\|CDD\|274926	TIGR04025, hypothetical_protein, PPOX class probable FMN-dependent enzyme, DR_2398 family. Members of the PPOX family (see pfam01243) may contain either FMN or F420 as cofactor. This subfamily consists of proteins mostly from species that lack the capability to synthesize F420, and therefore most likely all bind FMN.	7.51191e-20
NZ_CP013464.1\|WP_060325474.1\|547297_548254_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.64987e-69
NZ_CP013464.1\|WP_069237522.1\|544002_545604_-\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224983	COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism].	1.10045e-136

>NZ_CP013464.1|WP_060325484.1|538921_540205_-|hypothetical-protein
MNSTLEGISAVQDRPPRSATPLRAGLLGITAGLFALWITRDPSALDGATRAVIASLAIIGTIALHELFVSRVYLRPSAGLSRQAVRPLGVARVAVRLGALASVYAGIGMLYWLLPEYHGAFYLPFWSLLRALAPYVIVAAPIYFAWMDRHQRETDDAYLLWGRFLFRGEQPASWRPVREMLAGWMVKAFFLPLMTVYLSKDADHLSASLANAMHAPMSLALFVFMYDLSFTMDLMFGTVGYLCTFRVLDSHVRTVEPTTLGWLAALICYQPFWSLISNNYIRYEGSMFWDNWLLSAPAIRVAWGATIIALLLCYALSTISFGLRFSNLTNRGIITSGPYRFTKHPAYITKNLSYWMISVPFVEPLGWQVALAHCAALVAVNLIYFLRAKTEERHLMRDPDYRAYAAWIAEHGLFARIRRVFGQQQAG
>NZ_CP013464.1|WP_060325487.1|537550_538348_-|hypothetical-protein
MRIDVQHCQNSIDDELDTLHARLHQPGHRLHGLPAVALGASGLIVRHREADGEYFLYVEDPVTRQLAGYTVFNRLPEIPRRADRYLRAPHSKFRASFQRKGLATTLYRWGLDAGLCLISGARQSVGAARLWTMLAREYRHGFVDIEGRELRYLGECVSDDVHGALHTRRLLLGTGWTMGEFAEVVGMTDGPAIAHDRAVRTSARWPEWPVRGSPNGDAPDAQSVVPGASTTVAKQSGAGSRRQAGPGHDCRAFQTESPIRLRKDT
>NZ_CP013464.1|WP_060307990.1|537094_537532_+|hypothetical-protein
MPLLFLRNFDCAREVLQYATDHGPKALVTHDPARQPDRGYFTLVDGHFYGVFASATGPVAFRDAQQWMLCENQVLTEMKLLPDGRKRFVVMIRNERVLDVVYQPSGIVVDNWSDDDRMIDFFAWLHDGMSSEAPGQFVSFYTLSA
>NZ_CP013464.1|WP_141715419.1|536573_536957_+|VOC-family-protein
MRADIFVPTVSVDEQVRFYVKELRLFVVSQDYGMGEILLRHIDCPSFCLQLQPNRSPSGDWPIFCMTTEDCRSEFARLSVVAFQKGGLVPDAGAGAQPCEYPLGQTISLRDASGNLFLITEWHPSAL
>NZ_CP013464.1|WP_141715420.1|535857_536484_+|hypothetical-protein
MALLLLRTFDRTTEILRNEVDGCSQALAASDSAQLLSRGYFTNADGRLDTCWRVGQRVDAVIAVQAATADAAVRLGARVPAMSGAELKNIVFVPSKSTEESVDFYVNELALFEVGEDLGRGNVFLRYIRSEDFYLMLSLELGVREGDAPIFSVGVDDCFGEYNRLKGVNFKNGAEILLNPGFVEWALGKFLKMRDPAGNVFDLSEWYM
>NZ_CP013464.1|WP_141715421.1|535140_535767_+|hypothetical-protein
MDARFYVVQYRPGEFGCPHFLSGAVNRDEWEWPMYVGDPFSVAVEHDYVYQLADSKDSVDFDFYGSQTNFVSEQFLQVCDAMKVRYRAIPLRITCDGKDVGDKRYSIFLPAEHVALLDRSSSEFLEDRDMESGEIAENNLFPGTPMYSWIKRFVPRDDCASALFRSVEIMELVCNEKFKEAAERAALKGIEFIPIDGNYIYDPWGEAS
>NZ_CP013464.1|WP_069237520.1|530872_535141_+|RHS-domain-containing-protein
MFEAARVTDPIEHTSALAGFLIGAVIGVALIAAVAFATFTCGFGVALLAGLVAGVGASAILSLGEAIGKMFSSPSGAIVTGAANVFINGKPAAYATLSGTACDKHNPVPLVAQGSTNVFINGRPAARKDDKITCGASIGDGSHDTFIHGGTETYLPVDDEVPPWLRTTVDWAFALAGLVGGLAGLVKAAGGLSRAVLPCAAKFIGGFVLGEAVGRYVAGPAINRAIGGMFGNPVDVTTGRKILLAESETDYVIPAPLPVAIKRFYSSGLDHAGTLGRGWVLPWDLRLQARDGRLWYTDAQGRESGFPLVRNGQSSFSESEQRYLTCTPDGRYVLHDVGETYYDFGRLDPDTDRIAWVRRIEDQAGQWMQFERDSQGRVREILTCGGIQAVLDYEAVHGRLATVTLVHGDERRLAVAYGYDDNGQMASVTDANGAIVRRFAYADGLMTSHTNALGFVSSYKWAAIGGQPRVVATQTSEGEHWTFEYDLDARESRVRHLDGRSARWRYDAQFQVVECTDLDGAQYRIEYNDAGMPIAFMLPGERKVALEYDDAGRIVAETDPLGRTTRTRYDGNSLRPVEITAPDGGVWQAEYDRQGRLVLSRDPLGRTNRYEYPDGLTSQPAAHVDARGGRKALAWNRLGQLVAYTDCSGKTTRSEFDAFGLPVATENALGQRVSYAMRPTGEPVRIAYPDGSEESFEYDAAGLVVRHVGLGGRIRQSIRNARGQLREAIDPAGRRLVYRYDAEGRLFELLNDHARYAFAYDAGGRLLSETRPDGVKRCFSYDDAGGLRELTIVGAADDANRRDAQAVRVLRFERDLMGNLTAQHTPTDVTRYERDAGDRLLAVERTPTDAGVALGIEPDAVSFEYDKGGRLIAEHGVNGTVGYALDELDNVSTLSLPHEQTLQMLRYGSGHVHQIRCGDQVVSDFERDDLHREILRTQGRLIERSGYDLLGRKLWQAAGLSPETTGRMRGQLWRNYGYDAAGELTEMSDSLRGSTQYSYDPAGQLMRQYRTADRHLEEFAWDAAGNLLDDGQRRSRGYVEGNRLRMWQDLRFAYDAFGNLATKQQGPNRTQRFGYDGQDRLIAVRTEDASGAVEARFEYDPLGRRTAKTETYFDHRGVELRAERKRFVWEGLRLAQEIRETGVSSYVYSPDAPYTPAARVDAVIADAVAAVAIDKAKHAARVYHFHTDLVGAPLEVTDEAGEVAWAGRYSAWGKVDAGDRQLAAPRTEQPLRYAGQYADDSTGLHYNTFRFYDPDVGRFVNQDPIGVLGGENLYAFAPNATGWIDPLGWCSTVLGKNMGARTGDGMANHHLIPEELMKHPDFAAMFKRLRSMGFDGDGASNGTFLPGSSGLAKDMGLPGHWSNHSQYTAAIEAELKKLNQQFLAGRLSDTQLALGVGRIQNMAREGLETGKYVIDVITGRLL
>NZ_CP013464.1|WP_060306803.1|530383_530857_+|DUF1795-domain-containing-protein
MTDPDNRIRIHEGSITLPDGFEDRTTNLFVPADPANQPNLSVARDWLKDGETLAPYVDRQLALLKSRLQGHKLIARQAERLGPDDHRALAGERIDASHRNGTRVVFQRQAAFIVAPGRVLIFTASSARAFNDELDALWRAWLDGYRPADETGEAGLA
>NZ_CP013464.1|WP_069237519.1|529745_530192_+|hypothetical-protein
MTRSTMTLWQAIDALAQQVPFSKTKVEHTLSTRLTETDEEGNDVFQFVKSTPVTLTDGVVIKNVDLRVKRQGAHPGFMVLELGGPCVGLDAVRARYSHLEITDVPRGRSLDEATTHSAQLPWGQLSFGFEERNPACLASVSFKPKKQD
>NZ_CP013464.1|WP_069237518.1|529190_529637_+|hypothetical-protein
MTQSTMTLWQAIDALAQQVPFSKARIEQTLPTRLTEIDREGNKVFHFFKSTPVTLSDGVVIENVDLRIKRQGEHPGFMVLRLGGTCVGLDAVRGRYGHLEIVDVPRGRSLDESTTHAAKLPWGELAFGFLERNPGCLAFVAFDPKKQD
>NZ_CP013464.1|WP_042587169.1|542552_542951_+|carboxymuconolactone-decarboxylase-family-protein
MSEQDKEQGKARRIDVMGEAFVERAMRDLDGFSRPLQDWLNEHAWGSTWQRGGIDLKTRSLCTCAMLAALGRGTELKGHVRGALNNGASLVEIREVLLHSALYAGAPAAVEAFRNAREVISELGLTLPDSED
>NZ_CP013464.1|WP_059967377.1|542987_543974_-|alpha/beta-fold-hydrolase
MSHTIHLIQQALIAVAAVCAALAAFTWYIAHRVTRAFRPEGRFVDIGGDRIHYVEYGSGPPIVFVHGLAGQLRNFAYLPLQQLAERHRVILIDRPGAGHSLRGARSQANIFAQARTIAAFIDALQLDKPVLVGHSLGGAISLAVGLNHPEHVSRLALIAPLSHLEAEPPGPFRPLLIPSKLVRRFVSWTFAIPLTILTGRKAVRAVFAPEVVPNDFPVKGGGLLGLRPRSFYATASDLIAVPGDLPAMERRYAELALPVDVLYGRDDRILNWRSHGEALAQKSPRVRLRVVEGGHMLPVTIPDATAEWLAEVAAAPLEAHAPVAQAGR
>NZ_CP013464.1|WP_069237522.1|544002_545604_-|NAD(P)/FAD-dependent-oxidoreductase
MTSTTTDRRAAPPAFDCHASAGGTRRDGADLDVLIVGAGLSGIGAAYHLQRRCPFARVAILEARDAIGGTWDLFRYPGVRSDSDMFTLGYSFRPWHGDKAISDGQTILDYIRDTARTYGIDKTIRYRHKVVGADWDSNRARWTVRVERGGGSDAPAETLVLTCRFLYMCSGYYDYDAGYLPDWPGKDTFGGDLVHPQHWPKNLSYADRRVIVIGSGATAVTLVPSMAAEARHVTMLQRSPTYIVSLPARDRIANALRRVLPARLAHRLVRVKNVLLTMYFYNLARRKPEATKKLIIRAAGKQLGPDFDVATHLTPRYKPWDQRVCLVPNGDLFKAIRAGRASIVTDEIERFTPTGLRLKSGQRLDADVIVTATGLKVKMLGGAQVTVDGRAVDLSQTVSYKGMMYSDVPNLASSFGYTNASWTLKAELIARYVCRLLNHMRAHGYDTCVPRLAPGDLGNVPAVNLSSGYIQRAAGILPKQGEKKPWKFHQNYVLDLASLKFSTLADSAMRFERRAKPDAGAASVPQPALDTRA
>NZ_CP013464.1|WP_059967371.1|546591_547248_+|TetR/AcrR-family-transcriptional-regulator
MSNSGMEKVLKTQKRGRAYGGVAPEVRAAERRDALIRAATRVFGTVGFRKATVRSICREAKLNDRYFYAAFDSTEDLLRCTYLHHAEQLRDAVAQAVAACGGDLDARVDAGLAAFFGFLRDPCAARVLLLEVMGVSLDTDATYQRVLVEFGKLIMAIGGRGEAITGAERTEQWLIGLALVGAMTNVGTAWLLTQYRDPEAQMIASCRKVLLGTLGAAG
>NZ_CP013464.1|WP_060325474.1|547297_548254_-|LysR-family-transcriptional-regulator
MADLRDVNLNRLAVFVAVVEAGSLTAAAERLGLAKTVVSTHMQRLESEVGANLLVRTTRRLAVTDAGRAFYDACRDIMRATESALDAVSSETGPLRGTLRVSAPIDYGAQVVAPAIVALRDAHPALDVELIANDRLVDLVADNIDVAIRIGRLADSNYRAVQLGEYEKWPVASPAFVARWGLPRDPAALAALPFVMLSTLPRPQTFELENARGGKASVRCTAHVVSNTATACRAIALAGGGFGLLTDFSIADDVAAGRLVRLLPGWRSPPAGIHAIFPSTRLPSPKVRAFIEAMREKIGAAPVRATRGRATMSKRASG
>NZ_CP013464.1|WP_060325471.1|548380_549025_+|glutathione-S-transferase
MPVAEKPSVPIRVYSFPLSGHAHRVRLFLSLLGLPFEVVDVDLAAGEQRRPAFLALNPFGQVPVIDDGGVVLSDSNAILVYLAKRYGDAHWLPDDPAGAAAVQRWLSLAAGPIAAGPGAARLVTVFGAPLDHAQAKRVAVRLFDVIDAEFAKQPFAAGARPTIADIAAYTYIAHAPEGGVSLDPYPHLRAWLARVEALPGFVGMPPTRAGLLAA
>NZ_CP013464.1|WP_060325469.1|549058_550036_+|pyridoxamine-5'-phosphate-oxidase-family-protein
MTAPTVAPPGWDLDVSPFHAGELAVQQRAGVADAASAVGLRGIRRFMPDQHRAFFAQLPYFVLGGVDAEGQPWATLRVGAPGFATSPDAHTLRIAGDALPGDPLADAWRPGAPLGGLGIQFDTRRRNRVNGVVQAVDGSNALTVAVEQSFGNCAKYIQSRAPVFDPRGDAAPPRFERAARLSDADRALLAQADTFFVASANLSAEAGAARGVDVSHRGGMPGFVRVDDDATLTTPDFSGNRLFNTLGNLLLDPRAGLLFVDFERGDLVHVAARAEIVWDGPLVASFDGAQRVVRYRVQEVRRSVAVMPFRWSPVEWAPQFRARPA
>NZ_CP013464.1|WP_029226088.1|550159_550363_+|DUF2970-domain-containing-protein
MKLLGMIRLVLWSFFGVRNSKAHAADLENVNFTLLPFVAIILAALVGAVIYGVVHLVADPTSTMQGF
>NZ_CP013464.1|WP_060325465.1|550771_553015_+|TonB-dependent-siderophore-receptor
MTVNRRRASPALRRRVRVGVGIGVGLGITLFAAQAGAASVDASASASNAAASGGGTLPAISVSGARGNALRARTASVAGHDDAPLRDTPASVSVVTRALLDDQQAKRLSDVVRNDASVSNAYAPVGYFEGFSIRGFPVDLASAIRIDGLTISGEQNVPLENKERVEILKGLAGIDSGVVAPGGVVNFVTKRSANVASVTTGVDSRGSTSAAVDLGRRFGPDNQFGIRINAAKENMHSYIDGTNGRRTFGSIAADWDISPRASLQLNAEFQQWIQRSAPGYQLLGGTVVPSVKSTSKALGTQPWAKPVTTDALNLNARFDYQFNDDWKAYVAAGRSRTMIDDNSAFAYGCSYAASCAAGATSPFFFGRNGDFDVYDFRSPGEYRRNDDVRAVTTGKFSTGPVRHELTVGTSVQRRVVHMADAVYDYVGSENIYGPDVTFAPSPNVPGPSYPRLDAWQYAVFGADRISFGDHWQVLAGGKEVLLRQRSWSSLDGPQTRTDRSVFLPQVALVYKPVNALSLYASYSKALSLGDQAPVRATNAYAFLPPVESRQIEVGAKYDWLDRLSLTAAVFSISKPFQFAQPDASNSSYTFVQRGTQRHQGIELGAAGQVTQRLSLTATVAAIRARAYDSGSAAYEGHQVINVPALRASLYADYAVPGVAGLALLGGVDYSASRNANEEGTARVPAWFVFNLGARYATKIGGHRTVLRVSVDNLFNKFYWRDAGEQQGDAYLFPGAPRTARVSLTYDF
>NZ_CP013464.1|WP_059587080.1|553048_553660_+|nicotinamide-mononucleotide-transporter
MSTLEIAGVIVSALAIWLTAKRRMLCWPVGLASVALYGWIFFDAKLYSDMLLQGAFAVLQVYGWRRWLAQRVDRADGTAGGAASHGAVVPVSGVTPAKVLPDLIAAVVGSALLGGIMARWTDAALPFVDASLTAFSLVAQYWTARRYIASWGLWIVVNVVYVGMFVVKELYLTAGLYALFIGLAVIGWRDWRNTAASVRAAAS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013464_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013464_2

2882942-2883163

Orphan

Consensus_repeat	Method
GCCTGCGCCGCCGCCGAGCGCGCCGCCGAT	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP013464_2

>merge|NZ_CP013464|2|2882942-2883163|CRISPRCasFinder
GCCTGCGCCGCCGCCGACGGCCGCGCCGAGGAGGCCGCCCGTGCGGCCGCCCATCGCGTTGCCCGCCGCGGTGCCTGCGCCGCCGCCGAGCGCGCCGCCGATGATCGCGCCGGTGCGCTCGCGACGGTTCGACGTGACCGCGCCGCCTGCGCCGCCGCCGATCGCGCCGCCGATCACCGAGCCGGTGCGGCCGCCGACCGCGCCGCCGACCGCTGCGCCGGC

>NZ_CP013464|2|1|2882942-2883163|CRISPRCasFinder
GCCTGCGCCGCCGCCGACGGCCGCGCCGAG	GAGGCCGCCCGTGCGGCCGCCCATCGCGTTGCCCGCCGCGGT
GCCTGCGCCGCCGCCGAGCGCGCCGCCGAT	GATCGCGCCGGTGCGCTCGCGACGGTTCGACGTGACCGCGCC
GCCTGCGCCGCCGCCGATCGCGCCGCCGAT	CACCGAGCCGGTGCGGCC
GCCGACCGCGCCGCCGACCGCTGCGCCGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013464.1\|WP_069238297.1\|2892137_2892716_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013464.1\|WP_059968008.1\|2880774_2881569_+\|3'-kinase	unknown	unknown	gnl\|CDD\|226100
NZ_CP013464.1\|WP_069238160.1\|2886001_2887402_+\|serine-hydrolase	unknown	unknown	gnl\|CDD\|224594
NZ_CP013464.1\|WP_059968000.1\|2884790_2885210_-\|HIT-family-protein	unknown	unknown	gnl\|CDD\|223611
NZ_CP013464.1\|WP_069238159.1\|2876951_2877776_+\|heme-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|184132
NZ_CP013464.1\|WP_059968012.1\|2877812_2878424_-\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NZ_CP013464.1\|WP_029226786.1\|2890078_2890615_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224427
NZ_CP013464.1\|WP_069238295.1\|2873800_2874889_+\|heme-ABC-transporter	unknown	unknown	gnl\|CDD\|226243
NZ_CP013464.1\|WP_069238157.1\|2874885_2875794_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|226928
NZ_CP013464.1\|WP_059967995.1\|2887468_2888092_-\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|198289
NZ_CP013464.1\|WP_042584883.1\|2871030_2871258_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013464.1\|WP_059967991.1\|2890776_2891979_+\|trans-2-enoyl-CoA-reductase-family-protein	unknown	unknown	gnl\|CDD\|237460
NZ_CP013464.1\|WP_069238296.1\|2888701_2889964_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187579
NZ_CP013464.1\|WP_060302874.1\|2888234_2888705_-\|DUF2269-domain-containing-protein	unknown	unknown	gnl\|CDD\|370783
NZ_CP013464.1\|WP_069238158.1\|2875809_2876910_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP013464.1\|WP_060155825.1\|2881579_2882416_-\|(S)-ureidoglycine-aminohydrolase	unknown	unknown	gnl\|CDD\|183011
NZ_CP013464.1\|WP_060302882.1\|2878435_2880559_-\|PBP1A-family-penicillin-binding-protein	unknown	unknown	gnl\|CDD\|273955
NZ_CP013464.1\|WP_069238156.1\|2871480_2873751_+\|TonB-dependent-hemoglobin/transferrin/lactoferrin-family-receptor	unknown	unknown	gnl\|CDD\|273808
NZ_CP013464.1\|WP_155122705.1\|2892849_2893977_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376164
NZ_CP013464.1\|WP_059968003.1\|2883607_2884267_-\|isoprenylcysteine-carboxylmethyltransferase-family-protein	unknown	unknown	gnl\|CDD\|224931

Protein	Function_ID	Function_description	E-value
NZ_CP013464.1\|WP_059968008.1\|2880774_2881569_+\|3'-kinase	gnl\|CDD\|226100	COG3570, StrB, Streptomycin 6-kinase [Defense mechanisms].	1.02861e-84
NZ_CP013464.1\|WP_069238160.1\|2886001_2887402_+\|serine-hydrolase	gnl\|CDD\|224594	COG1680, AmpC, Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms].	2.80075e-41
NZ_CP013464.1\|WP_059968000.1\|2884790_2885210_-\|HIT-family-protein	gnl\|CDD\|223611	COG0537, Hit, Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only].	2.68616e-46
NZ_CP013464.1\|WP_069238159.1\|2876951_2877776_+\|heme-ABC-transporter-ATP-binding-protein	gnl\|CDD\|184132	PRK13547, hmuV, heme ABC transporter ATP-binding protein.	7.14426e-152
NZ_CP013464.1\|WP_059968012.1\|2877812_2878424_-\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	3.32721e-64
NZ_CP013464.1\|WP_029226786.1\|2890078_2890615_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	2.1414e-39
NZ_CP013464.1\|WP_069238295.1\|2873800_2874889_+\|heme-ABC-transporter	gnl\|CDD\|226243	COG3720, HemS, Putative heme degradation protein [Inorganic ion transport and metabolism].	2.55975e-143
NZ_CP013464.1\|WP_069238157.1\|2874885_2875794_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|226928	COG4558, ChuT, ABC-type hemin transport system, periplasmic component [Inorganic ion transport and metabolism].	2.04686e-75
NZ_CP013464.1\|WP_059967995.1\|2887468_2888092_-\|glutathione-S-transferase	gnl\|CDD\|198289	cd03180, GST_C_2, C-terminal, alpha helical domain of an unknown subfamily 2 of Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.	3.76334e-49
NZ_CP013464.1\|WP_059967991.1\|2890776_2891979_+\|trans-2-enoyl-CoA-reductase-family-protein	gnl\|CDD\|237460	PRK13656, PRK13656, enoyl-[acyl-carrier-protein] reductase FabV.	0
NZ_CP013464.1\|WP_069238296.1\|2888701_2889964_-\|SDR-family-oxidoreductase	gnl\|CDD\|187579	cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like, atypical (a) SDRs. This subgroup of extended SDR-like proteins are atypical SDRs. They have a glycine-rich NAD(P)-binding motif similar to the typical SDRs, GXXGXXG, and have the YXXXK active site motif (though not the other residues of the SDR tetrad). Members identified include NDUFA9 (mitochondrial) and putative nucleoside-diphosphate-sugar epimerase. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.58153e-53
NZ_CP013464.1\|WP_060302874.1\|2888234_2888705_-\|DUF2269-domain-containing-protein	gnl\|CDD\|370783	pfam10027, DUF2269, Predicted integral membrane protein (DUF2269). Members of this family of bacterial hypothetical integral membrane proteins have no known function.	1.07064e-56
NZ_CP013464.1\|WP_069238158.1\|2875809_2876910_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	4.87098e-78
NZ_CP013464.1\|WP_060155825.1\|2881579_2882416_-\|(S)-ureidoglycine-aminohydrolase	gnl\|CDD\|183011	PRK11171, PRK11171, (S)-ureidoglycine aminohydrolase.	0
NZ_CP013464.1\|WP_060302882.1\|2878435_2880559_-\|PBP1A-family-penicillin-binding-protein	gnl\|CDD\|273955	TIGR02074, Includes:_Penicillin-insensitive_transglycosylase, penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NZ_CP013464.1\|WP_069238156.1\|2871480_2873751_+\|TonB-dependent-hemoglobin/transferrin/lactoferrin-family-receptor	gnl\|CDD\|273808	TIGR01786, hemoglobin-haptoglobin-binding_protein, TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein. This model represents a family of TonB-dependent outer membrane receptor/transporters acting on iron-containing proteins such as hemoglobin, transferrin and lactoferrin. Two subfamily models with a narrower scope are contained within this model, the heme/hemoglobin receptor family protein model (TIGR01785) and the transferrin/lactoferrin receptor family model (TIGR01776). Accessions which score above trusted to this model while not scoring above trusted to the more specific models are most likely to be hemoglobin transporters. Nearly all of the species containing trusted hits to this model have access to hemoglobin, transferrin or lactoferrin or related proteins in their biological niche. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	5.27224e-123
NZ_CP013464.1\|WP_155122705.1\|2892849_2893977_+\|hypothetical-protein	gnl\|CDD\|376164	pfam18742, DpnII-MboI, REase_DpnII-MboI. REase Fold fused to DpnII/MboI-NTD.	8.52966e-53
NZ_CP013464.1\|WP_059968003.1\|2883607_2884267_-\|isoprenylcysteine-carboxylmethyltransferase-family-protein	gnl\|CDD\|224931	COG2020, STE14, Putative protein-S-isoprenylcysteine methyltransferase [Posttranslational modification, protein turnover, chaperones].	1.22228e-27

>NZ_CP013464.1|WP_060155825.1|2881579_2882416_-|(S)-ureidoglycine-aminohydrolase
MSKTTYYAPHGGHPPQTDLLTDRAMFTEAYAVIPKGVMRDIVTSWLPFWANTRLWVIARPLSGFAETFSQYIVEVNPGGGSDKPEQDKEAEAVLFVVEGEVELTLQGSKHVLKPGGYAFIPPGANWTLHNVSDAAARFHWIRKRYQAVDGIALPEAFVTNEQDVEPIPMPGTDGAWVTTRFVDMSDMRHDMHVNIVTFQPGGVIPFAETHVMEHGLYVLEGKAVYRLNQDWVEVEAGDFMWLRAFCPQACYSGGPGRFRYLLYKDVNRHMNLTLNAAR
>NZ_CP013464.1|WP_059968008.1|2880774_2881569_+|3'-kinase
MFDTYLRLWSLVPDGGPILTASGGVLPVVWHARPAMLKVATCDEERRGNALMTWWNGDGAARVWLHDSDAVLLERAQPAPTLAGLSAAGHDDDTIRIACRVVARLHAHRAPAPPEVVPLTDWFHALLSHDTGDDVLRRSAATAHRLLAVPPVDDVVLHGDIHHGNLLHFGDRGWLAIDPKGLRGDRAFDYANLFCNPAHDIAVDPARFARRVVLVAEAAQLDRRRLLQWILAWAGLSAVWLTEDDLPPDTRLQVARLAAAALDE
>NZ_CP013464.1|WP_060302882.1|2878435_2880559_-|PBP1A-family-penicillin-binding-protein
MTEHTANPPLPPAPPPASPRRAWRMLAGVLLGLTLACAGIGAWTIHHIWTQLPSVEHLAVYRPALPLRVFSRDGELLAEYGVERREFVPLERMPPLMRDALLAAEDAQFYRHGAVDLGGLARATFANLVTGQPGQGGSTITMQVARNFYLTRDKVLSRKLAEILMAYKLEREYSKDKLLELYMNEIYLGERAYGFAAAASVYFGKPLDALSAGEAAVLAGLPKAPSAFNPVVNPARATARRNYVLGRMHALGRLDDATYRAAVDAPLALSTTPPPGILAAPYVAERARRMMVERFHDDAYTLGLDVTTTISMRDQHAAEAALARGLRRQPAARDAKPALEGALVSLDAATGDMLALVGGADFARNGFDHALQAYRQPGSSFKPFVYSAALEKGYFPGVLVDDTQRTLTRAETGAQPWRPRNFGNRYEGFIPVRRGLVRSKNLVAVSLMQAADPQYVQQHAMRFGFDARRNPASLPLALGSGAVTPLELASAYAVFANGGMRLEPRLVTSVKQRHGGVLYEASPAAGTRVISARNAFMMDSMLRDVVSAGTGRGALALRRNDAAGKTGTSNGSKDVWFAGYSSGVVAVAWLGYDTPRGVGRATGATLALPVWLDYMKTAVDGRAPAEAAQPRDVAVVDGDFVYAEYTQGTCTADVPPFVRSDFACAAAHAPAGASAVAGHDAAAGVAMPAAVDAAERERVLDLFRTDD
>NZ_CP013464.1|WP_059968012.1|2877812_2878424_-|trimeric-intracellular-cation-channel-family-protein
MHTLYLIAIVAEAMSGALMGMRRGMDRFGLALVGAVTALGGGTVRDVLLGHYPLGWIAHPEYLVITLAAATVASWAARRLARMRTLFVTVDAVGLAAFTIIGCDIGAKTGSAPIIVVLAGAITGVCGGMLRDLLCNEMPLILREELYASVAFCTGALYVGMQYLGIDADVATVVALAAGFAMRMLAVRLGWKMRTFGVADVER
>NZ_CP013464.1|WP_069238159.1|2876951_2877776_+|heme-ABC-transporter-ATP-binding-protein
MLIAHQLEVARRRTVILRDLSLSIEPGCVTALLGRNGAGKSTLLKTFAGELSGRGSAAGTRVSGAVTLNGEALAHIDATRLARLRAVLPQAAQPAFPFSVDEIVLLGRYPHARRGGSASRRDRDIAWCALERAGADMLVGRDVTTLSGGELARVQFARVLAQLWPDDGGDDAAQPRYLLLDEPTAALDLAHQHRLLETVRAVAREWRLGVLAIVHDPNLAARHADRIAMLADGTIVAHGAPRDVMTPANIARCYGFAVRMVETGDGAPPVMVPA
>NZ_CP013464.1|WP_069238158.1|2875809_2876910_+|iron-ABC-transporter-permease
MPAHASSFTAPSHAASSGAARVGASRRLAPFALAALAVLVAAAAVAALCVGAYRIPPAELWAALTGDATAQQARAVLLDIRAPRVVLALLVGGGFGAAGAAMQALFRNPLADPGLVGVSSGAALGATTTIVLGPALFAASAGAALLPAVLPFAAFAGALAVAALVYRLAASRGRLALPLLLLAGIAINALAGAAIGLLTFAANDAQLRSLTFWSLGSLGGAQWPALAAVTPCVAIGCALLARERDALNALQLGETEALHLGVPVQRLKRRVLVAVALAVGALVSCAGIIGFIGLVAPHCIRLACGPDQRIVMPGAALLGALLTLAADLAARTVAAPAEIPLGVLTALLGAPFFLALLWKNRGALGG
>NZ_CP013464.1|WP_069238157.1|2874885_2875794_+|ABC-transporter-substrate-binding-protein
MSRGPFNRQRRILLASAAVGALAGALPGRGRAQTPAKRVVVIGGALAETAFALGAADARGYTLVGADTTCTYPDAARRLPKVGYQRALSAEGLLSLRPDLVLASAEAGPPAALAQVKGAGVAVTTFREGHDVDSARAKISGVAQALDVRDAGAALLQRFDRDWQAARATAAAQPPGGAQPPRVLFVLNHTGNQALAAGQRTAADAMIRYAGARNAMQGFDHYKPLTTEALAAAAPDVVLISDEGLAAVGGRAALLAAPGFAATPAGRARRVVSLDALLLLGFGPRLPLALTTLHRQLSDALA
>NZ_CP013464.1|WP_069238295.1|2873800_2874889_+|heme-ABC-transporter
MMQSAAPGQPAAQARTAAALRDAFVKLKAERQLRNRDAAQALGVSEGEALAALVGEHVVRLDARFPAMFEEMPRLGRVMALTRNETAVHEKDGEYAQMSHDGPVGLALGDIDLRIFYRHWASAFAVSDATAHGTLKSLQFFDAHGDAIHKVYLRAHSDHAAYDAFVERWRAPSQEAGLAVTPAAPKAPERADSEIDVAGFRAAWDAMTDTHQFFGITQRFGVSRLQALRLADPRYAYPVGTRALRHALERAAGSGQPIMVFVGNAGMIQIHTGPVTNVREMGAWINVLDPGFNLHVREDMIAAAWVVKKPTSDGIVTSLELFDRQGEHVALLFGERKPGRPERDDWRSLVAGLPPAEHGDAR
>NZ_CP013464.1|WP_069238156.1|2871480_2873751_+|TonB-dependent-hemoglobin/transferrin/lactoferrin-family-receptor
MHCYTLARRPICAALFGAFGLSVAPAFADSLPQGATPPPLLAASTRGDAALLDPVTVTATRTATAASRTAASVSVITDEDLEEQQAANIKDALRYEPGVTVRRTAYRPGSAALGGGRDGDSSINIRGLEGNRVLLMEDGIRLPSAFSFGPLEAGRGDYADLDTLKRIEILRGPASALYGSDGLTGAVNFITKDPQDLLSIYRKPYYFSFRPSYDSTDRSIGATVSAAAGNDRVQGMIIADGRRGHEIDTRGGNNTASTLRTTSNPQDVYSESLLGKLVLTPTSRDTIKLAAETVQRRIGTNVLSAINPPTTLGLTTSDRLERNRFSIDYDFHDDAFRWFQNAHAQFYYQEATQDQFAFETRGGSLRSRSRDNHYEERTFGGSAFAESGFSTGPFAHKLLYGVDGSLSRVKNYRDGTVPGVGEAFPNKAFPDTDYTLLGAFVQDQIGYGRLLVTPGLRFDAYRLSPSANDPLFTGKAVSTSARELSPRIAVLYEITPALIPYAQYAHGFRTPTPDQVNSSFSNPVFGYTSIGNPNLKPETSDTFEAGLRGKAGTGYGVVRYSAAAFTGRYRNFISRTTIAGSGRPNDPFVFQYVNFADARIHGLEGRAEWIMPNGITLKTALAFTKGSTQNNGAASQPLDSINPFSAVFGVRYEPGERWFVQTDLLFQAAKRDKDIPAGACSQANKSCFAPPSSFVVDVRGGYRFNKHVSATIGIRNLFDRKYWNWSDVRGIAADSQVLDAYTAPGRTVAVSMKVDF
>NZ_CP013464.1|WP_042584883.1|2871030_2871258_+|hypothetical-protein
MNAQSLSGMLRAQELLLVSMIRALPPDARHTLGEIFAEQIAFAEEHHLEGRSERDTHDAFIAHARNLLIRLESLS
>NZ_CP013464.1|WP_059968003.1|2883607_2884267_-|isoprenylcysteine-carboxylmethyltransferase-family-protein
MTLTPKVAALSVAATLVYLGLAVLGSGGFAAFFSHSALMVVAIATIVMTVVAAFSSGNLSPGEREDRGNRWVLAAFGAIGFAAAYLPALTDRLDVWTLDGETLRWAGVALYIAGGALRLWPVFVLGRRFSGLVAIQPGHTLVTDGIYRVIRNPSYLGLLVNSLGWALAFRAGVGVLLTVLTIPPLVARIRSEEALLRSHFGAEYDAYCARTWRLIPGVY
>NZ_CP013464.1|WP_059968000.1|2884790_2885210_-|HIT-family-protein
MAYDTNNPFAKILRGDLPCVKVAEDDTTLVIMDLMPQADGHVLVIPKEPAAEIFDLSADAAGACIRMTQRVAAAARDALQPDGMFIGQFNGRAAGQTVAHVHFHVIPRWEGVALKLHARDVADAATLESIAQRIRERFV
>NZ_CP013464.1|WP_069238160.1|2886001_2887402_+|serine-hydrolase
MTTPFKPLLRRAAALALLAALGYAGYTLSRLAPIATGYAAKTLCSGVFVSGRPAASVIDVDIMAGVHPLLKLVHPSVDPARHLARATFAGFAGREAVFRPGLGCTLALGPSTDALPAALPDPAPPPPAPATAPVPDDGVDARKLQTALDRAFDEPDPARPRRTRAVVVLHRGRVIAERYAPGFSADMPLPGWSMTKSVTAALIGMLVAQHKLSPDASALLPEWRDAGDPRARITLDELLRMTSGLRFNEDYDDPLSDVAVMLFTQPDTARFASAKPLAAAPGTRWHYSSGTSAILARVMRDAMGGTETDYLAFPQHALFAPLGMRNAFFEPDASGTLGSASFMYASARDWAQFGQLLLQDGVWDGKRLLPEGWVRYMARATTQAPRQEFGAHLWVKVPEPFNDPDPHATALPADAFHAVGHEGQFVSVVPSRQLVIVRLGLSRPEAAWNHEAFLARVLDAVPARSE
>NZ_CP013464.1|WP_059967995.1|2887468_2888092_-|glutathione-S-transferase
MLHILGKIPSINVRKVLWLCAELDLPFEREDWGSGFRSTDDPAYLALNPHGLVPVIKDGDFVLWESNTIIRYLANRYGGEALYPAEPQARARVDQWLDWQASDLNRSWVFAFQGLVRKSPDHQDPDAIAQSIANWTKHMHVLNAQLDATGAFVAGERFTLADIPIGLSVNRWFGTPFEHPDFPAIARYVERLAARPGFEAYGGSKNP
>NZ_CP013464.1|WP_060302874.1|2888234_2888705_-|DUF2269-domain-containing-protein
MNTYLVVKALHIVSSVLLVGTGLGTAFYLFFANRTRSVPAIAAVSRLVVRADWWFTTPAVIFQPASGLWLAHAAGWPWDTPWLVASLGLYLLAGACWLPVVWLQIELAAMAKLAHANGAAELPDRYWRYAKAWERLGYPAFFAMLSVYFLMVLKPM
>NZ_CP013464.1|WP_069238296.1|2888701_2889964_-|SDR-family-oxidoreductase
MNILVCGANGFIGRALCARLEAGGHRVVRGVHAGRRAAGPGEIAIDYARDVRPEHWRARLDGIDAVVNAVGMLTGRRGVTLDAVHRAAPCALFDACCRAGVRQIVQISALGVERGDTAYFASKLAADAYLQTLPIDFRIVRPALVYGATGASARYFRMLASLPVHVLPAGGRQLLRPVHVDDLAELVARLIERPAAGDRIVDVVGADEVEYREMLAIYRRAMGFPPAMRVSVPGALFAAAAALSGRMPGAMLTRDTWAMLRAGNTGELAASSAALGRPPRGLRAFIGAESVALRHEALAAWRRPLLTGSLAIVWIWTAIASAFIHPLRDSLALLAHVHLTGISALAALYAACALDFVFGVATVVAPSRRLWAAQIVLIVAYSAVIAVAMPGLLAEPFGPVLKNVPILAVLLILFAEEERS
>NZ_CP013464.1|WP_029226786.1|2890078_2890615_-|MarR-family-transcriptional-regulator
MELTPIAERFILHWGEMGSRWGVNRTVAQIHALLYLLGRPVAADEIAETLNVARSNVSTSLKELQAWRLAKVVHVMGDRRDHFETSTDIWELFKLIVEGRRQREIEPTLTVLRDCLTSPELADESRETEQRLRDTLQFVETLTTWSDEMLRLKPDTLMKALGIGAKISQTVRRKPSSK
>NZ_CP013464.1|WP_059967991.1|2890776_2891979_+|trans-2-enoyl-CoA-reductase-family-protein
MIIKPRVRGFICVTTHPVGCEANVKEQIDYVTSHGPIAGGPKKVLVIGASTGYGLAARITAAFGSGADTLGVFFERAGSETKPGTAGWYNSAAFEKFAAAKGLYARSINGDAFSDAVKQVTIDTIKRDLGKVDLVVYSLAAPRRTHPKTGETISSTLKPIGKAVSFRGLDTDKEVIRETVLEPATQEEIDGTVAVMGGEDWQMWIDALREAGVLADGAKTTAFTYLGEQITHDIYWNGSIGAAKKDLDKKVLAIRDSLSPTGGDARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEQGTHEGCIEQVYGLLKDSLYGATPHVDDEGRLRADYKELDPQVQAKVVALWDQVTNDNLYELTDFAGYKTEFLRLFGFAIAGVDYDADVNPDVQIPGIIEVSA
>NZ_CP013464.1|WP_069238297.1|2892137_2892716_-|hypothetical-protein
MKRKHLIFAITGLLIALPIAAFAFVKPLRVVAPALIPGVTCPDADICTDDASRLGEARQLYGDGYARAAAVTGQFHAAPRVVFCATQACADAFGLGRRAAEAIGNVGVVVAPRGWRSFYLAHELIHFRQAEVLGNVAVATRPRWLIEGMAYSLSGDPRHSLGEPLESWRAQFDAWHASLGARDLWDAARDVR
>NZ_CP013464.1|WP_155122705.1|2892849_2893977_+|hypothetical-protein
MPVTRRAFEYAKTTMSFLRDLFSMHDPSDSIGRIVLAGRRYRAWSRALSVVVLMTTGLLYLQLIWPAFLSDDLSNPAIGTLIASESFQERVRPIFDHLNRYNHRTKGESIAEPDDFHYIDGQSQFGLQLTAHYKAFKRPVSDVAGHDATDGASSVQYAYRPEFSVRIAYPALIVFSMVVCIELGIMAMIFVRRPRAQINFEEQVLDEFFHIGEEPQPTTVDVTTQLARLQHILENFHAFCKQLGIRHAGRPGFEISDEYDVQDILRALLMLHFSVVKPEEHTPAYAGRSSRIDFLLHHEEIAVEVKMTRETLRDKEIADELILDIARYATHPKCKRLVCFIYDPKELLRNPGVLRNDLTSAQRGMSVDVVVSPSR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP013464_1	1.2\|541629\|30\|NZ_CP013464\|CRT	541629-541658	30	NC_023286	Streptomyces sp. F12 plasmid pFRL6, complete sequence	131001-131030	6	0.8
NZ_CP013464_1	1.5\|541761\|30\|NZ_CP013464\|CRT	541761-541790	30	NZ_CP021236	Pontibacter actiniarum strain DSM 19842 plasmid unnamed, complete sequence	2571-2600	6	0.8
NZ_CP013464_1	1.5\|541761\|30\|NZ_CP013464\|CRT	541761-541790	30	KX853513	Uncultured virus isolate Rctr41k, partial genome	752-781	6	0.8
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_AP022622	Mycobacteroides abscessus strain JCM 30620 plasmid pJCM30620_1	38315-38344	7	0.767
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NC_021279	Mycobacteroides abscessus subsp. bolletii 50594 plasmid 2, complete sequence	96865-96894	7	0.767
NZ_CP013464_1	1.5\|541761\|30\|NZ_CP013464\|CRT	541761-541790	30	NZ_CP032695	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence	1174784-1174813	7	0.767
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_AP022622	Mycobacteroides abscessus strain JCM 30620 plasmid pJCM30620_1	38315-38344	7	0.767
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NC_021279	Mycobacteroides abscessus subsp. bolletii 50594 plasmid 2, complete sequence	96865-96894	7	0.767
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	2409589-2409618	8	0.733
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NC_019958	Mycobacterium sp. JS623 plasmid pMYCSM02, complete sequence	65237-65266	8	0.733
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	553565-553594	8	0.733
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	2409589-2409618	8	0.733
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NC_019958	Mycobacterium sp. JS623 plasmid pMYCSM02, complete sequence	65237-65266	8	0.733
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	553565-553594	8	0.733
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NC_019847	Sinorhizobium meliloti GR4 plasmid pRmeGR4b, complete sequence	99801-99830	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NC_003037	Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence	406205-406234	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP019585	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence	280009-280038	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP019585	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence	460832-460861	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NC_017324	Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence	864155-864184	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NC_017324	Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence	897963-897992	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NC_017324	Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence	142135-142164	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP009145	Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence	433158-433187	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP009145	Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence	1108426-1108455	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP021801	Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence	355249-355278	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP021801	Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence	1012356-1012385	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP021830	Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence	1358687-1358716	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP021830	Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence	511456-511485	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP021830	Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence	545261-545290	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP021824	Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence	312469-312498	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP021824	Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence	984312-984341	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP021824	Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence	1018120-1018149	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NC_018683	Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence	689749-689778	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NC_018683	Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence	1375779-1375808	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP021809	Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence	811399-811428	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP021809	Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence	1485260-1485289	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP026526	Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence	330035-330064	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP026526	Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence	596314-596343	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP026526	Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence	712281-712310	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP026529	Sinorhizobium meliloti strain AK21 plasmid pSmeAK21b, complete sequence	75234-75263	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP019483	Sinorhizobium meliloti strain B401 plasmid pSymA, complete sequence	377221-377250	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP019486	Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence	352390-352419	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NC_020527	Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence	405867-405896	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	MN234236	Mycobacterium phage QueenHazel, complete genome	4684-4713	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	HM152765	Mycobacterium phage Island3, complete genome	4682-4711	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NC_011291	Mycobacterium phage Brujita, complete genome	4682-4711	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NC_023697	Mycobacterium phage Babsiella, complete genome	4678-4707	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NC_019848	Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence	1057419-1057448	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NC_017327	Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence	413857-413886	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NC_017327	Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence	1159094-1159123	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP021798	Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence	313743-313772	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP021827	Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence	1235992-1236021	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP021794	Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence	218195-218224	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP021796	Sinorhizobium meliloti strain USDA1157 plasmid accessoryA, complete sequence	195771-195800	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP021805	Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence	108919-108948	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP021217	Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence	658-687	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP021217	Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence	745498-745527	9	0.7
NZ_CP013464_1	1.3\|541677\|30\|NZ_CP013464\|CRT	541677-541706	30	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	30625-30654	9	0.7
NZ_CP013464_1	1.5\|541761\|30\|NZ_CP013464\|CRT	541761-541790	30	NZ_KR066794	Enterococcus faecium strain Efm0123 plasmid pJEG050, complete sequence	40503-40532	9	0.7
NZ_CP013464_1	1.5\|541761\|30\|NZ_CP013464\|CRT	541761-541790	30	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	144958-144987	9	0.7
NZ_CP013464_1	1.5\|541761\|30\|NZ_CP013464\|CRT	541761-541790	30	NZ_LR135403	Enterococcus faecium isolate E8377 plasmid 3	27266-27295	9	0.7
NZ_CP013464_1	1.5\|541761\|30\|NZ_CP013464\|CRT	541761-541790	30	NZ_LR135396	Enterococcus faecium isolate E8290 plasmid 3	8579-8608	9	0.7
NZ_CP013464_1	1.5\|541761\|30\|NZ_CP013464\|CRT	541761-541790	30	NZ_LR135359	Enterococcus faecium isolate E7948 plasmid 3	25935-25964	9	0.7
NZ_CP013464_1	1.5\|541761\|30\|NZ_CP013464\|CRT	541761-541790	30	NZ_LR135387	Enterococcus faecium isolate E7933 plasmid 4	45463-45492	9	0.7
NZ_CP013464_1	1.5\|541761\|30\|NZ_CP013464\|CRT	541761-541790	30	NC_011642	Enterococcus faecalis plasmid pMG2200, complete sequence	22175-22204	9	0.7
NZ_CP013464_1	1.5\|541761\|30\|NZ_CP013464\|CRT	541761-541790	30	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	30625-30654	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NC_019847	Sinorhizobium meliloti GR4 plasmid pRmeGR4b, complete sequence	99801-99830	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NC_003037	Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence	406205-406234	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP019585	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence	280009-280038	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP019585	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence	460832-460861	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NC_017324	Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence	864155-864184	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NC_017324	Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence	897963-897992	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NC_017324	Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence	142135-142164	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP009145	Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence	433158-433187	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP009145	Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence	1108426-1108455	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP021801	Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence	355249-355278	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP021801	Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence	1012356-1012385	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP021830	Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence	1358687-1358716	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP021830	Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence	511456-511485	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP021830	Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence	545261-545290	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP021824	Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence	312469-312498	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP021824	Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence	984312-984341	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP021824	Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence	1018120-1018149	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NC_018683	Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence	689749-689778	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NC_018683	Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence	1375779-1375808	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP021809	Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence	811399-811428	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP021809	Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence	1485260-1485289	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP026526	Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence	330035-330064	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP026526	Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence	596314-596343	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP026526	Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence	712281-712310	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP026529	Sinorhizobium meliloti strain AK21 plasmid pSmeAK21b, complete sequence	75234-75263	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP019483	Sinorhizobium meliloti strain B401 plasmid pSymA, complete sequence	377221-377250	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP019486	Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence	352390-352419	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NC_020527	Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence	405867-405896	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	MN234236	Mycobacterium phage QueenHazel, complete genome	4684-4713	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	HM152765	Mycobacterium phage Island3, complete genome	4682-4711	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NC_011291	Mycobacterium phage Brujita, complete genome	4682-4711	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NC_023697	Mycobacterium phage Babsiella, complete genome	4678-4707	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NC_019848	Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence	1057419-1057448	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NC_017327	Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence	413857-413886	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NC_017327	Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence	1159094-1159123	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP021798	Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence	313743-313772	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP021827	Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence	1235992-1236021	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP021794	Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence	218195-218224	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP021796	Sinorhizobium meliloti strain USDA1157 plasmid accessoryA, complete sequence	195771-195800	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP021805	Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence	108919-108948	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP021217	Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence	658-687	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP021217	Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence	745498-745527	9	0.7
NZ_CP013464_1	1.7\|541845\|30\|NZ_CP013464\|CRT	541845-541874	30	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	30625-30654	9	0.7

1. spacer 1.2|541629|30|NZ_CP013464|CRT matches to NC_023286 (Streptomyces sp. F12 plasmid pFRL6, complete sequence) position: , mismatch: 6, identity: 0.8

gccggaagacgtacccgaggacgtacccga---	CRISPR spacer
ggcggaagacgtagccgaggacg---gcgaaca	Protospacer
* *********** *********    ***

2. spacer 1.5|541761|30|NZ_CP013464|CRT matches to NZ_CP021236 (Pontibacter actiniarum strain DSM 19842 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

acccgaggatgtgccggaggatgtgccgga	CRISPR spacer
aaatcaggatgtgccggaggaggtgctgga	Protospacer
*  . **************** ****.***

3. spacer 1.5|541761|30|NZ_CP013464|CRT matches to KX853513 (Uncultured virus isolate Rctr41k, partial genome) position: , mismatch: 6, identity: 0.8

acccgaggatgtgccggaggatgtgccgga	CRISPR spacer
gcgggtggatgagccggaggatgagccgga	Protospacer
.*  * ***** *********** ******

4. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_AP022622 (Mycobacteroides abscessus strain JCM 30620 plasmid pJCM30620_1) position: , mismatch: 7, identity: 0.767

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tcacctgggcgtatccgaggatgtgccggg	Protospacer
 * *  **.****.***************.

5. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NC_021279 (Mycobacteroides abscessus subsp. bolletii 50594 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.767

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tcacctgggcgtatccgaggatgtgccggg	Protospacer
 * *  **.****.***************.

6. spacer 1.5|541761|30|NZ_CP013464|CRT matches to NZ_CP032695 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence) position: , mismatch: 7, identity: 0.767

acccgaggatgtgccggaggatgtgccgga	CRISPR spacer
cttcgaggatgtgccggtggaggtgctcga	Protospacer
 ..************** *** ****. **

7. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_AP022622 (Mycobacteroides abscessus strain JCM 30620 plasmid pJCM30620_1) position: , mismatch: 7, identity: 0.767

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tcacctgggcgtatccgaggatgtgccggg	Protospacer
 * *  **.****.***************.

8. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NC_021279 (Mycobacteroides abscessus subsp. bolletii 50594 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.767

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tcacctgggcgtatccgaggatgtgccggg	Protospacer
 * *  **.****.***************.

9. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 8, identity: 0.733

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
cgccgaggacgttcccgaggatgtggttcc	Protospacer
  ********** ************ .

10. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NC_019958 (Mycobacterium sp. JS623 plasmid pMYCSM02, complete sequence) position: , mismatch: 8, identity: 0.733

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tcgaatggacctacccgaggatctgccggg	Protospacer
 *  . **** *********** ******.

11. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
gtctgaggacgtgcccgcggatgtgcccac	Protospacer
..*.********.**** ********* .

12. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 8, identity: 0.733

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
cgccgaggacgttcccgaggatgtggttcc	Protospacer
  ********** ************ .

13. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NC_019958 (Mycobacterium sp. JS623 plasmid pMYCSM02, complete sequence) position: , mismatch: 8, identity: 0.733

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tcgaatggacctacccgaggatctgccggg	Protospacer
 *  . **** *********** ******.

14. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
gtctgaggacgtgcccgcggatgtgcccac	Protospacer
..*.********.**** ********* .

15. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NC_019847 (Sinorhizobium meliloti GR4 plasmid pRmeGR4b, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

16. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NC_003037 (Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

17. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP019585 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

18. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP019585 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

19. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NC_017324 (Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

20. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NC_017324 (Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

21. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NC_017324 (Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

22. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP009145 (Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

23. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP009145 (Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

24. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP021801 (Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

25. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP021801 (Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

26. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP021830 (Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

27. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP021830 (Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

28. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP021830 (Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

29. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP021824 (Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

30. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP021824 (Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

31. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP021824 (Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

32. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NC_018683 (Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

33. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NC_018683 (Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

34. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP021809 (Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

35. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP021809 (Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

36. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP026526 (Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

37. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP026526 (Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

38. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP026526 (Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

39. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP026529 (Sinorhizobium meliloti strain AK21 plasmid pSmeAK21b, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

40. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP019483 (Sinorhizobium meliloti strain B401 plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

41. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP019486 (Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

42. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NC_020527 (Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

43. spacer 1.3|541677|30|NZ_CP013464|CRT matches to MN234236 (Mycobacterium phage QueenHazel, complete genome) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
gtacgaggacgtacccgaggacgagctact	Protospacer
.. ******************.* **..

44. spacer 1.3|541677|30|NZ_CP013464|CRT matches to HM152765 (Mycobacterium phage Island3, complete genome) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
gtacgaggacgtacccgaggacgagctact	Protospacer
.. ******************.* **..

45. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NC_011291 (Mycobacterium phage Brujita, complete genome) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
gtacgaggacgtacccgaggacgagctact	Protospacer
.. ******************.* **..

46. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NC_023697 (Mycobacterium phage Babsiella, complete genome) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
gtacgaggacgtacccgaggacgagctact	Protospacer
.. ******************.* **..

47. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NC_019848 (Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

48. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NC_017327 (Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

49. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NC_017327 (Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

50. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP021798 (Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

51. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP021827 (Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

52. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP021794 (Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

53. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP021796 (Sinorhizobium meliloti strain USDA1157 plasmid accessoryA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

54. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP021805 (Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

55. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP021217 (Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

56. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP021217 (Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

57. spacer 1.3|541677|30|NZ_CP013464|CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaggacgttccggaggatgtggttcc	Protospacer
  ********** ** ********* .

58. spacer 1.5|541761|30|NZ_CP013464|CRT matches to NZ_KR066794 (Enterococcus faecium strain Efm0123 plasmid pJEG050, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggatgtgccggaggatgtgccgga	CRISPR spacer
ggccgaggatatgccggaggatgccgagcg	Protospacer
. ********.************.   * .

59. spacer 1.5|541761|30|NZ_CP013464|CRT matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 9, identity: 0.7

acccgaggatgtgccggaggatgtgccgga	CRISPR spacer
ggccgaggatatgccggaggatgccgagcg	Protospacer
. ********.************.   * .

60. spacer 1.5|541761|30|NZ_CP013464|CRT matches to NZ_LR135403 (Enterococcus faecium isolate E8377 plasmid 3) position: , mismatch: 9, identity: 0.7

acccgaggatgtgccggaggatgtgccgga	CRISPR spacer
ggccgaggatatgccggaggatgccgagcg	Protospacer
. ********.************.   * .

61. spacer 1.5|541761|30|NZ_CP013464|CRT matches to NZ_LR135396 (Enterococcus faecium isolate E8290 plasmid 3) position: , mismatch: 9, identity: 0.7

acccgaggatgtgccggaggatgtgccgga	CRISPR spacer
ggccgaggatatgccggaggatgccgagcg	Protospacer
. ********.************.   * .

62. spacer 1.5|541761|30|NZ_CP013464|CRT matches to NZ_LR135359 (Enterococcus faecium isolate E7948 plasmid 3) position: , mismatch: 9, identity: 0.7

acccgaggatgtgccggaggatgtgccgga	CRISPR spacer
ggccgaggatatgccggaggatgccgagcg	Protospacer
. ********.************.   * .

63. spacer 1.5|541761|30|NZ_CP013464|CRT matches to NZ_LR135387 (Enterococcus faecium isolate E7933 plasmid 4) position: , mismatch: 9, identity: 0.7

acccgaggatgtgccggaggatgtgccgga	CRISPR spacer
ggccgaggatatgccggaggatgccgagcg	Protospacer
. ********.************.   * .

64. spacer 1.5|541761|30|NZ_CP013464|CRT matches to NC_011642 (Enterococcus faecalis plasmid pMG2200, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggatgtgccggaggatgtgccgga	CRISPR spacer
ggccgaggatatgccggaggatgccgagcg	Protospacer
. ********.************.   * .

65. spacer 1.5|541761|30|NZ_CP013464|CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggatgtgccggaggatgtgccgga	CRISPR spacer
tgccgaggacgttccggaggatgtggttcc	Protospacer
  *******.** ************ .

66. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NC_019847 (Sinorhizobium meliloti GR4 plasmid pRmeGR4b, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

67. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NC_003037 (Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

68. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP019585 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

69. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP019585 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

70. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NC_017324 (Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

71. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NC_017324 (Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

72. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NC_017324 (Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

73. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP009145 (Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

74. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP009145 (Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

75. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP021801 (Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

76. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP021801 (Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

77. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP021830 (Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

78. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP021830 (Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

79. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP021830 (Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

80. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP021824 (Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

81. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP021824 (Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

82. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP021824 (Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

83. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NC_018683 (Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

84. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NC_018683 (Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

85. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP021809 (Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

86. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP021809 (Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

87. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP026526 (Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

88. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP026526 (Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

89. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP026526 (Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

90. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP026529 (Sinorhizobium meliloti strain AK21 plasmid pSmeAK21b, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

91. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP019483 (Sinorhizobium meliloti strain B401 plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

92. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP019486 (Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

93. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NC_020527 (Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

94. spacer 1.7|541845|30|NZ_CP013464|CRT matches to MN234236 (Mycobacterium phage QueenHazel, complete genome) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
gtacgaggacgtacccgaggacgagctact	Protospacer
.. ******************.* **..

95. spacer 1.7|541845|30|NZ_CP013464|CRT matches to HM152765 (Mycobacterium phage Island3, complete genome) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
gtacgaggacgtacccgaggacgagctact	Protospacer
.. ******************.* **..

96. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NC_011291 (Mycobacterium phage Brujita, complete genome) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
gtacgaggacgtacccgaggacgagctact	Protospacer
.. ******************.* **..

97. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NC_023697 (Mycobacterium phage Babsiella, complete genome) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
gtacgaggacgtacccgaggacgagctact	Protospacer
.. ******************.* **..

98. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NC_019848 (Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

99. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NC_017327 (Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

100. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NC_017327 (Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

101. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP021798 (Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

102. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP021827 (Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

103. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP021794 (Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

104. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP021796 (Sinorhizobium meliloti strain USDA1157 plasmid accessoryA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

105. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP021805 (Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

106. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP021217 (Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

107. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP021217 (Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaagacgtccccgaggatgtgatccc	Protospacer
  ****.***** ************ .

108. spacer 1.7|541845|30|NZ_CP013464|CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 9, identity: 0.7

acccgaggacgtacccgaggatgtgccgga	CRISPR spacer
tgccgaggacgttccggaggatgtggttcc	Protospacer
  ********** ** ********* .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

634653 : 692867

uncultured_Caudovirales_phage(25.0%)

plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059483243.1\|634653_635085_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_060301662.1\|635097_635760_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_080431676.1\|635756_637103_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_080487105.1\|637160_638549_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_069237544.1\|638810_641162_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	6.3e-11	29.4
WP_080487106.1\|641085_642012_+	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_069237546.1\|642074_644729_+	hypothetical protein	NA	NA	NA	NA
WP_069238216.1\|645349_645790_+	hypothetical protein	NA	NA	NA	NA
WP_060304451.1\|647773_648214_+	hypothetical protein	NA	NA	NA	NA
WP_060304901.1\|648839_649280_+	hypothetical protein	NA	NA	NA	NA
WP_080431766.1\|649347_649599_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_060304904.1\|649678_650875_+	hypothetical protein	NA	NA	NA	NA
WP_060304453.1\|650871_654408_+	type VI secretion protein VasK	NA	NA	NA	NA
WP_069237547.1\|654424_656239_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_069238217.1\|656337_657318_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_080487107.1\|657349_658063_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_155122639.1\|658140_658860_-	hypothetical protein	NA	NA	NA	NA
WP_059967241.1\|658866_659298_-	hypothetical protein	NA	NA	NA	NA
WP_059967239.1\|659385_660987_-	tyrosinase family protein	NA	NA	NA	NA
WP_069237549.1\|661573_662434_+	hypothetical protein	NA	NA	NA	NA
WP_069237550.1\|662430_662679_+	hypothetical protein	NA	NA	NA	NA
WP_059532241.1\|662772_663156_+	avidin/streptavidin family protein	NA	NA	NA	NA
WP_080410839.1\|663443_665237_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_060304470.1\|665282_667250_-	glycosyltransferase	M1HVH2	Acanthocystis_turfacea_Chlorella_virus	2.9e-25	26.4
WP_069237551.1\|667252_668590_-	hypothetical protein	NA	NA	NA	NA
WP_059967229.1\|668610_670068_-	multidrug transporter	NA	NA	NA	NA
WP_042588734.1\|670812_671217_+	TIGR02594 family protein	A0A249Y3Q7	Serratia_phage	1.7e-28	43.7
WP_059967429.1\|671245_672682_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_059967427.1\|672692_674267_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_060326518.1\|674298_675390_-	HlyD family secretion protein	NA	NA	NA	NA
WP_010098074.1\|675454_675886_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_060304478.1\|675935_676874_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_059647429.1\|676975_677404_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_069237552.1\|677665_678913_+	aconitase X catalytic domain-containing protein	NA	NA	NA	NA
WP_069237553.1\|678905_679412_+	DUF126 domain-containing protein	NA	NA	NA	NA
WP_069237554.1\|679546_680656_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_069237555.1\|680733_682767_+	NADPH-dependent 2,4-dienoyl-CoA reductase	NA	NA	NA	NA
WP_059967217.1\|682794_683199_-	DUF2471 domain-containing protein	NA	NA	NA	NA
WP_069237556.1\|683342_684236_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_059967213.1\|684323_685112_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_060304490.1\|685119_685545_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_069237557.1\|685541_688271_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	1.4e-86	32.4
WP_006479553.1\|688409_688895_-	Hcp family type VI secretion system effector	NA	NA	NA	NA
WP_069237558.1\|688987_690766_-	OmpA family protein	NA	NA	NA	NA
WP_069237559.1\|690762_691518_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_069237560.1\|691514_692867_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA

DBSCAN-SWA_2

1498376 : 1551992

Burkholderia_phage(61.54%)

lysis,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069237767.1\|1498376_1499513_-	hypothetical protein	C5IHJ5	Burkholderia_virus	8.2e-33	65.7
WP_080487118.1\|1499660_1501160_-	Lar family restriction alleviation protein	NA	NA	NA	NA
WP_069238245.1\|1501176_1503081_-	DNA methyltransferase	Q9ZXI4	Pseudomonas_virus	1.1e-167	59.7
WP_069237769.1\|1503317_1503728_-	hypothetical protein	NA	NA	NA	NA
WP_069237770.1\|1503729_1503924_-	hypothetical protein	A9YX20	Burkholderia_phage	3.6e-21	87.7
WP_069237771.1\|1503920_1504361_-	hypothetical protein	A9YX19	Burkholderia_phage	5.7e-75	87.0
WP_069237772.1\|1504443_1505088_-	1-pyrroline-5-carboxylate dehydrogenase	A9YX18	Burkholderia_phage	8.8e-16	81.5
WP_069237773.1\|1505084_1506851_-	AAA family ATPase	H2BD46	Pseudomonas_phage	4.6e-75	36.5
WP_069237774.1\|1506847_1507726_-	cell division protein FtsK	J7I0T4	Pseudomonas_phage	3.5e-23	40.1
WP_069238246.1\|1507756_1508941_-	hypothetical protein	A0A2I7RZ22	Vibrio_phage	4.9e-20	35.0
WP_069237775.1\|1509033_1509843_-	PD-(D/E)XK nuclease family protein	J7HXJ4	Pseudomonas_phage	8.3e-88	58.6
WP_069237776.1\|1509839_1510136_-	KTSC domain-containing protein	A9YWW2	Burkholderia_phage	1.3e-35	75.8
WP_069237778.1\|1510579_1510936_-	hypothetical protein	NA	NA	NA	NA
WP_069237779.1\|1510932_1511115_-	hypothetical protein	NA	NA	NA	NA
WP_069237780.1\|1511114_1511360_-	hypothetical protein	NA	NA	NA	NA
WP_069237781.1\|1511361_1511568_-	hypothetical protein	NA	NA	NA	NA
WP_069237782.1\|1511564_1511903_-	hypothetical protein	NA	NA	NA	NA
WP_069237783.1\|1512032_1512293_-	hypothetical protein	G8CT95	Vibrio_phage	2.4e-12	57.9
WP_080487119.1\|1512331_1512544_-	hypothetical protein	A0A0U1VYM8	Pseudomonas_phage	8.7e-13	53.6
WP_069237784.1\|1512602_1513019_-	hypothetical protein	NA	NA	NA	NA
WP_080487164.1\|1514194_1514596_-	hypothetical protein	C7BGF7	Burkholderia_phage	5.2e-51	74.4
WP_059726797.1\|1515048_1515423_+	hypothetical protein	A9YWX9	Burkholderia_phage	4.6e-57	86.3
WP_080487120.1\|1515419_1515641_+	hypothetical protein	A9YWY0	Burkholderia_phage	1.4e-26	83.1
WP_069237787.1\|1515634_1515859_+	hypothetical protein	NA	NA	NA	NA
WP_069237788.1\|1515855_1517094_+	phosphoadenosine phosphosulfate reductase family protein	R9TRT5	Rhizobium_phage	1.7e-169	69.8
WP_069237789.1\|1517090_1517951_+	DNA adenine methylase	A0A0K1LM14	Caulobacter_phage	1.3e-78	52.5
WP_069237790.1\|1517950_1518427_+	hypothetical protein	Q6JIG5	Burkholderia_virus	3.8e-64	77.7
WP_069237791.1\|1518435_1518660_-	hypothetical protein	NA	NA	NA	NA
WP_069238248.1\|1519412_1519844_+	hypothetical protein	NA	NA	NA	NA
WP_155122662.1\|1519897_1520101_+	hypothetical protein	NA	NA	NA	NA
WP_069237792.1\|1520097_1520568_+	RusA family crossover junction endodeoxyribonuclease	A9YWY9	Burkholderia_phage	8.5e-69	84.0
WP_069237793.1\|1520579_1520906_+	hypothetical protein	A9YWZ0	Burkholderia_phage	8.0e-42	90.7
WP_069237794.1\|1520902_1521496_+	DNA-binding protein	A9YWZ1	Burkholderia_phage	2.5e-97	89.5
WP_069237795.1\|1521753_1521990_-	hypothetical protein	NA	NA	NA	NA
WP_069237796.1\|1522112_1522772_+	hypothetical protein	A9YWZ4	Burkholderia_phage	3.2e-114	93.2
WP_069237797.1\|1522790_1523270_+	DUF2280 domain-containing protein	A9YWZ5	Burkholderia_phage	3.0e-77	95.0
WP_069237798.1\|1523271_1524867_+	TerL protein	A9YWZ6	Burkholderia_phage	3.2e-309	96.4
WP_069237799.1\|1524863_1526345_+	DUF1073 domain-containing protein	A9YWZ7	Burkholderia_phage	7.4e-252	87.9
WP_069237800.1\|1526341_1527097_+\|capsid	minor capsid protein	A9YWZ8	Burkholderia_phage	8.5e-111	81.6
WP_155122663.1\|1527241_1527409_+	hypothetical protein	NA	NA	NA	NA
WP_069237801.1\|1527410_1528862_+	DUF2213 domain-containing protein	A9YX03	Burkholderia_phage	5.9e-177	73.1
WP_069237802.1\|1528871_1529378_+	hypothetical protein	NA	NA	NA	NA
WP_069237803.1\|1529447_1530539_+	DUF2184 domain-containing protein	A9YX23	Burkholderia_phage	4.8e-155	94.4
WP_069237804.1\|1530540_1531023_+	hypothetical protein	A9YX24	Burkholderia_phage	8.1e-14	58.8
WP_069237805.1\|1531087_1531468_+	DUF4054 domain-containing protein	A9YX25	Burkholderia_phage	6.1e-57	87.4
WP_069237806.1\|1531495_1531972_+	hypothetical protein	A9YX26	Burkholderia_phage	7.3e-68	84.7
WP_069237807.1\|1532004_1532325_+	hypothetical protein	NA	NA	NA	NA
WP_069237808.1\|1532383_1532761_+	hypothetical protein	A9YX28	Burkholderia_phage	2.5e-55	81.3
WP_069237809.1\|1532757_1533348_+	hypothetical protein	A9YX29	Burkholderia_phage	5.3e-100	91.8
WP_069237810.1\|1533357_1534833_+	DUF3383 domain-containing protein	A0A0M4RD26	Salmonella_phage	5.1e-59	46.1
WP_069237811.1\|1534848_1535289_+	DUF3277 family protein	A0A0P0IKY2	Acinetobacter_phage	9.8e-43	61.0
WP_069237812.1\|1535291_1535843_+	hypothetical protein	A0A0N7IRF3	Acinetobacter_phage	2.8e-18	34.6
WP_155122664.1\|1535839_1536046_-	hypothetical protein	NA	NA	NA	NA
WP_069237813.1\|1536026_1538036_+	mannosyl-glycoprotein endo-beta-N-acetylglucosamidase	A0A2H4J9N7	uncultured_Caudovirales_phage	1.1e-35	35.0
WP_069237814.1\|1538032_1538608_+	hypothetical protein	A0A0M3ULD5	Salmonella_phage	1.2e-19	37.6
WP_059867535.1\|1538607_1538925_+	hypothetical protein	A0A2H4J495	uncultured_Caudovirales_phage	3.1e-14	40.0
WP_069237815.1\|1538921_1539890_+	hypothetical protein	A9YX04	Burkholderia_phage	3.5e-141	86.6
WP_069237816.1\|1539886_1540264_-	hypothetical protein	A9YX05	Burkholderia_phage	9.3e-58	88.8
WP_069237817.1\|1540267_1541011_+	hypothetical protein	A9YX06	Burkholderia_phage	1.8e-121	90.3
WP_069237818.1\|1541019_1541373_+	hypothetical protein	A9YX11	Burkholderia_phage	1.1e-52	88.0
WP_069237819.1\|1541369_1542551_+	hypothetical protein	A9YX12	Burkholderia_phage	6.3e-177	83.0
WP_069237820.1\|1542550_1543213_+	DUF2612 domain-containing protein	A9YX13	Burkholderia_phage	5.9e-108	85.0
WP_069237821.1\|1543277_1544282_+	hypothetical protein	A9YX14	Burkholderia_phage	2.4e-68	39.7
WP_069237822.1\|1544412_1545411_-	acyltransferase	NA	NA	NA	NA
WP_080487122.1\|1545809_1547000_-	FkbM family methyltransferase	A0A0A0V284	uncultured_virus	1.1e-11	33.8
WP_009927668.1\|1547012_1547195_+	hypothetical protein	NA	NA	NA	NA
WP_069237823.1\|1547187_1547685_+	lysozyme	Q3HQU9	Burkholderia_phage	1.2e-65	75.2
WP_069237824.1\|1547681_1548230_+	hypothetical protein	NA	NA	NA	NA
WP_069237825.1\|1548226_1548775_+\|lysis	lysis protein	Q8W6S5	Burkholderia_virus	1.2e-61	79.8
WP_069237826.1\|1548788_1549244_-	hypothetical protein	C7BGE3	Burkholderia_phage	2.8e-32	47.5
WP_069237827.1\|1549326_1549959_+	SOS response-associated peptidase family protein	C7BGE4	Burkholderia_phage	3.4e-97	75.8
WP_155122665.1\|1549960_1550842_-	hypothetical protein	NA	NA	NA	NA
WP_069237828.1\|1551122_1551533_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_010089472.1\|1551788_1551992_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.4e-20	71.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP013465

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

112546 : 119445

Burkholderia_virus(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069238333.1\|112546_112876_-	helix-turn-helix domain-containing protein	R4JEU7	Burkholderia_phage	3.5e-29	58.7
WP_069238334.1\|113276_113603_+	hypothetical protein	NA	NA	NA	NA
WP_080487170.1\|114743_114923_+	hypothetical protein	NA	NA	NA	NA
WP_069238336.1\|114919_115171_+	hypothetical protein	A4JWW6	Burkholderia_virus	1.4e-09	49.3
WP_069238337.1\|115167_115389_+	hypothetical protein	A4JWW5	Burkholderia_virus	2.2e-14	64.7
WP_069238338.1\|115583_115892_-	hypothetical protein	NA	NA	NA	NA
WP_069238339.1\|116002_117787_+	replication endonuclease	A4JWW0	Burkholderia_virus	3.2e-289	81.7
WP_155122734.1\|117810_118065_+	ogr/Delta-like zinc finger family protein	A4JWV9	Burkholderia_virus	9.7e-27	74.7
WP_069238341.1\|118061_118274_+	ogr/Delta-like zinc finger family protein	A4JWV8	Burkholderia_virus	8.1e-19	70.0
WP_069238342.1\|118468_118723_+	hypothetical protein	E5FFJ7	Burkholderia_phage	6.1e-21	66.3
WP_069238343.1\|118809_119445_+	AAA family ATPase	A4JWV7	Burkholderia_virus	6.1e-70	66.8

DBSCAN-SWA_2

124322 : 134154

Burkholderia_phage(62.5%)

transposase,tail,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069238542.1\|124322_126089_-\|terminase	terminase	E5FFI8	Burkholderia_phage	7.5e-251	71.7
WP_069238346.1\|128309_129020_+\|tail	phage tail protein	A4JWS2	Burkholderia_virus	3.0e-41	63.2
WP_010089500.1\|129016_130084_+	phage late control D family protein	A4JWS1	Burkholderia_virus	6.3e-144	74.3
WP_010089499.1\|130125_130464_-	hypothetical protein	R4JEU5	Burkholderia_phage	1.1e-36	65.2
WP_060305804.1\|130463_131084_-	type VI secretion system amidase effector protein Tae4	R4JJZ3	Burkholderia_phage	4.0e-106	88.8
WP_060305801.1\|131087_131642_-	PAAR domain-containing protein	R4JMI1	Burkholderia_phage	8.7e-97	89.1
WP_033354587.1\|131794_132127_-	hypothetical protein	NA	NA	NA	NA
WP_060305798.1\|132211_132754_-	hypothetical protein	R4JDM9	Burkholderia_phage	4.1e-75	77.7
WP_069238347.1\|133131_134154_-\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	9.7e-09	27.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP013463

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP013464

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP013465

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection