CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP012435	Enterococcus faecium strain ISMMS_VRE_1 plasmid ISMMS_VRE_p3, complete sequence	0 crisprs	cas14j	0	0
NZ_CP012434	Enterococcus faecium strain ISMMS_VRE_1 plasmid ISMMS_VRE_p4, complete sequence	0 crisprs	cas14j	0	0
NZ_CP012432	Enterococcus faecium strain ISMMS_VRE_1 plasmid ISMMS_VRE_p1, complete sequence	0 crisprs	RT,cas14j	0	1
NZ_CP012431	Enterococcus faecium strain ISMMS_VRE_1 plasmid ISMMS_VRE_p2, complete sequence	0 crisprs	csa3,WYL	0	1
NZ_CP012433	Enterococcus faecium strain ISMMS_VRE_1 plasmid ISMMS_VRE_p5, complete sequence	0 crisprs	NA	0	0
NZ_CP012430	Enterococcus faecium strain ISMMS_VRE_1 chromosome, complete genome	2 crisprs	RT,cas14j,cas3,csa3,DinG,cas2,DEDDh	1	21

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

20056 : 34172

Streptococcus_phage(75.0%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001059542.1\|20056_21025_-	D-lactate dehydrogenase VanH-A	M1HUW8	Acanthocystis_turfacea_Chlorella_virus	3.5e-40	33.1
WP_000122610.1\|21356_22649_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.2e-57	38.9
WP_002305818.1\|22746_23901_-	VanA-type vancomycin resistance histidine kinase VanS	W8CYF6	Bacillus_phage	1.5e-13	23.3
WP_001280781.1\|23878_24574_-	VanA-type vancomycin resistance DNA-binding response regulator VanR	W8CYM9	Bacillus_phage	4.9e-36	37.7
WP_001015311.1\|25280_25961_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_002321977.1\|25990_26533_-	HTH domain-containing protein	A0A1B0RXM1	Streptococcus_phage	2.4e-91	98.3
WP_001096887.1\|26808_27603_-	aminoglycoside O-phosphotransferase APH(3')-IIIa	E4ZFP6	Streptococcus_phage	2.3e-154	100.0
WP_001255866.1\|28233_29142_-	aminoglycoside nucleotidyltransferase ANT(6)-Ia	E4ZFP8	Streptococcus_phage	2.8e-177	100.0
WP_000662263.1\|29174_29909_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.5e-141	100.0
WP_000228166.1\|29889_30759_-	nucleotidyltransferase domain-containing protein	A0A1X9I6C9	Streptococcus_phage	4.3e-159	95.8
WP_000567888.1\|30861_31107_-	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_001038792.1\|32400_33138_-	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	7.0e-134	99.2
WP_001814874.1\|33262_33346_-	23S rRNA methyltransferase attenuation leader peptide	NA	NA	NA	NA
WP_002343844.1\|33491_34172_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	6.5e-126	98.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP012430

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP012430_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012430_1

165812-165940

TypeV

Consensus_repeat	Method
GGTATGATTTTCATACCCTCTTGA	CRISPRCasFinder

2 spacers

cas14j

The CRISPR arrays of NZ_CP012430_1

>merge|NZ_CP012430|1|165812-165940|CRISPRCasFinder
GGTATGATTTTCATACCCTCTGATTTATCAACGTTTTGGCACGGTATGATTTTCATACCCTCTTGAGCCCCAAGGGATTCAGCGTCTGATTTTTCGTCGAGGGTGGGTATGATTTTCATACCCTCTGAT

>NZ_CP012430|1|1|165812-165940|CRISPRCasFinder
GGTATGATTTTCATACCCTCTGAT	TTATCAACGTTTTGGCAC
GGTATGATTTTCATACCCTCTTGA	GCCCCAAGGGATTCAGCGTCTGATTTTTCGTCGAGGGTG
GGTATGATTTTCATACCCTCTGAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012430.1\|WP_002297422.1\|179221_179485_+\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	unknown	unknown	gnl\|CDD\|376852
NZ_CP012430.1\|WP_002295673.1\|161075_161315_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012430.1\|WP_002290394.1\|170803_171121_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|368240
NZ_CP012430.1\|WP_002348857.1\|167719_167914_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012430.1\|WP_002295674.1\|163211_163553_-\|DUF5406-domain-containing-protein	unknown	unknown	gnl\|CDD\|379975
NZ_CP012430.1\|WP_010729786.1\|154050_156150_-\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|275067
NZ_CP012430.1\|WP_002287522.1\|169785_170190_-\|IS200/IS605-like-element-ISEfa4-family-transposase	unknown	unknown	gnl\|CDD\|376616
NZ_CP012430.1\|WP_002338109.1\|173698_174553_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380391
NZ_CP012430.1\|WP_002323399.1\|170548_170803_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274230
NZ_CP012430.1\|WP_002295672.1\|160799_161009_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012430.1\|WP_010729785.1\|157271_158027_-\|class-C-sortase	unknown	unknown	gnl\|CDD\|320676
NZ_CP012430.1\|WP_002336710.1\|160068_160740_-\|class-A-sortase	unknown	unknown	gnl\|CDD\|320680
NZ_CP012430.1\|WP_002350398.1\|156450_157275_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012430.1\|WP_002323647.1\|164171_164504_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012430.1\|WP_002336205.1\|176901_178077_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341026
NZ_CP012430.1\|WP_002323400.1\|171679_172615_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012430.1\|WP_002314387.1\|174649_176899_+\|alpha-galactosidase	unknown	unknown	gnl\|CDD\|225882
NZ_CP012430.1\|WP_002297404.1\|161724_162975_+\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376773
NZ_CP012430.1\|WP_002323589.1\|168620_169769_-\|transposase	cas14j	-	gnl\|CDD\|223747
NZ_CP012430.1\|WP_010729784.1\|158039_160016_-\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|374637

Protein	Function_ID	Function_description	E-value
NZ_CP012430.1\|WP_002287522.1\|169785_170190_-\|IS200/IS605-like-element-ISEfa4-family-transposase	gnl\|CDD\|376616	pfam01797, Y1_Tnp, Transposase IS200 like. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS200 from E. coli.	2.76401e-48
NZ_CP012430.1\|WP_010729786.1\|154050_156150_-\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|275067	TIGR04226, Fimbrial_subunit_type_2, fimbrial isopeptide formation D2 domain. The Streptococcus Pneumoniae pilus backbone protein, RrgB, has three tandem domains with Lys-to-Asn isopeptide bonds, but these three regions are extremely divergent in sequence. This model represents the homology domain family of the D2 domain. It occurs just once in many surface proteins but up to twenty times in some pilin subunit proteins. Three of every four members have the typical Gram-positive C-terminal motif, LPXTG, although in many cases this motif may be involved in pilin subunit cross-linking rather than cell wall attachment. Proteins with this domain include fimbrial proteins with lectin-like adhesion functions, and the majority of characterized members are involved in surface adhesion to host structures.	3.52518e-08
NZ_CP012430.1\|WP_002297422.1\|179221_179485_+\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	gnl\|CDD\|376852	pfam02604, PhdYeFM_antitox, Antitoxin Phd_YefM, type II toxin-antitoxin system. Members of this family act as antitoxins in type II toxin-antitoxin systems. When bound to their toxin partners, they can bind DNA via the N-terminus and repress the expression of operons containing genes encoding the toxin and the antitoxin. This domain complexes with Txe toxins containing pfam06769, Fic/DOC toxins containing pfam02661 and YafO toxins containing pfam13957.	6.33891e-07
NZ_CP012430.1\|WP_002295674.1\|163211_163553_-\|DUF5406-domain-containing-protein	gnl\|CDD\|379975	pfam17400, DUF5406, Family of unknown function (DUF5406). This is a family of unknown function found in Bacteria.	2.01693e-48
NZ_CP012430.1\|WP_002323589.1\|168620_169769_-\|transposase	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.71026e-54
NZ_CP012430.1\|WP_002290394.1\|170803_171121_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|368240	pfam05016, ParE_toxin, ParE toxin of type II toxin-antitoxin system, parDE. ParE is the toxin family of a type II toxin-antitoxin family. It is toxic towards DNA gyrase, but is neutralized by the antitoxin ParD. The family also encompasses RelE/ParE described in.	2.94793e-05
NZ_CP012430.1\|WP_002338109.1\|173698_174553_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|380391	cd06986, cupin_MmsR-like_N, AraC/XylS family transcriptional regulators similar to MmsR, N-terminal cupin domain. This family contains bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included is MmsR, a bacterial transcriptional regulator thought to positively regulate the expression of the mmsAB operon. The mmsAB operon contains two structural genes involved in valine metabolism: mmsA which encodes methylmalonate-semialdehyde dehydrogenase, and mmsB which encodes 3-hydroxyisobutyrate dehydrogenase. The cupin domain of members of this subfamily does not contain a metal binding site.	3.18963e-42
NZ_CP012430.1\|WP_002297404.1\|161724_162975_+\|IS110-family-transposase	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	8.21771e-29
NZ_CP012430.1\|WP_010729785.1\|157271_158027_-\|class-C-sortase	gnl\|CDD\|320676	cd05827, Sortase_C, Sortase domain found in class C sortases. Class C sortases are membrane-bound cysteine transpeptidases broadly distributed in Gram-positive bacteria (mainly present in Firmicutes and Actinobacteria). They function as pilin polymerases responsible for the assembly of pili, which are multi-subunit hair-like fibres that extend from the cell surface to promote microbial adhesion and biofilm formation. First, one or more class C sortases form the long thin shaft of the pilus through linking together pilin subunits via isopeptide bonds. The base of the pilus is then anchored to the cell wall by a housekeeping sortase or, in some cases, the class C sortase itself. Depending upon the organism both the number and type of sortase enzymes involved varies, and in some cases, accessory factors appear to be needed. In three-component spaA pilus from Corynebacterium diphtheriae, the prototypical class C sortase (named Cd-SrtA) catalyzes polymerization of the SpaA-type pilus, consisting of the shaft pilin SpaA, tip pilin SpaC and minor pilin SpaB. The pilus shaft is then attached to the cell wall by a housekeeping class E sortase, Cd-SrtF. In the absence of Cd-SrtF, Cd-SrtA attaches the pilus to the cell wall, albeit at a reduced rate. Cd-SrtA can recognize two distinct sorting signals (LPLTG in SpaA and SpaC, and LAFTG in SpaB) and it can employ lysine residues that originate from different proteins (either Lys190 within the pilin motif of SpaA or Lys139 in SpaB). However, Cd-SrtA cannot be able to polymerize the major pilin subunit SpaH, even though it contains LPLTG motif. In two-component pili of prototypical Bacillus cereus, the class C sortase (named Bc-SrtD) cleaves related sorting signals within a major pilin protein BcpA (LPVTG) and a minor tip pilin BcpB (IPNTG), and catalyzes a transpeptidation that joins the threonine residues in each signal to the side-chain of Lys162 in BcpA (located within a pilin motif). Unlike the SpaA pilus in C. diphtheriae, in B. cereus Bc-SrtD is unable to covalently attach the pilus to the cell wall without the help of the housekeeping sortase.	2.58528e-60
NZ_CP012430.1\|WP_002336710.1\|160068_160740_-\|class-A-sortase	gnl\|CDD\|320680	cd06165, Sortase_A, Sortase domain found in class A sortases. Class A sortases are membrane-bound cysteine transpeptidases distributed in Gram-positive bacteria (mainly present in Firmicutes). They perform a housekeeping role in the cell as members of this group are capable of anchoring a large number of functionally distinct surface proteins containing a cell wall sorting signal to an amino group located on the bacterial cell wall. They do so by catalyzing a transpeptidation reaction in which the surface protein substrate is cleaved at a conserved cell wall-sorting signal (Class A sortases recognize a canonical LPXTG motif, X can be any amino acid), and covalently linked to peptidoglycan for display on the bacterial surface. The prototypical sortase A protein from Staphylococcus aureus (named Sa-SrtA) cleaves the amide bond between threonine and glycine residues of the canonical LPXTG motif in a wide range of protein substrates with diverse functions that can promote bacterial adhesion, nutrient acquisition, host cell invasion, and immune evasion. Next, it catalyzes a transpeptidation reaction by which the proteins are covalently linked to the peptidoglycan precursor lipid II. SrtA is therefore affects the ability of a pathogen to establish successful infection. SrtA contains an N-terminal hydrophobic segment, a linker region and an extra-cellular C-terminal catalytic domain. The hydrophobic segment functions as both a signal peptide for secretion and a stop-transfer signal for membrane anchoring. The catalytic domain contains the catalytic TLXTC signature sequence where X is usually a valine, isoleucine or a threonine. The gene encoding SrtA is generally not located in the same gene cluster as its substrates while the gene encoding SrtB is usually clustered in the same locus as its substrate.	5.03937e-44
NZ_CP012430.1\|WP_002336205.1\|176901_178077_+\|MFS-transporter	gnl\|CDD\|341026	cd17473, MFS_arabinose_efflux_permease_like, Putative arabinose efflux permease family transporters of the Major Facilitator Superfamily. This family includes a group of putative arabinose efflux permease family transporters, such as alpha proteobacterium quinolone resistance protein NorA (characterized Staphylococcus aureus Quinolone resistance protein NorA belongs to a different group), Desulfovibrio dechloracetivorans bacillibactin exporter, Vibrio aerogenes antiseptic resistance protein. The biological function of those transporters remain unclear. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.73674e-45
NZ_CP012430.1\|WP_002314387.1\|174649_176899_+\|alpha-galactosidase	gnl\|CDD\|225882	COG3345, GalA, Alpha-galactosidase [Carbohydrate transport and metabolism].	0
NZ_CP012430.1\|WP_002323399.1\|170548_170803_+\|hypothetical-protein	gnl\|CDD\|274230	TIGR02609, hypothetical_protein_XAC1195, putative addiction module antidote. Members of this protein family are putative addiction module antidote proteins that appear recurringly in two-gene operons with members of the Doc (death-on-curing) family TIGR01550. Members of this family contain a SpoVT/AbrB-like domain (pfam04014). Note that the gene pairs with a member of this family tend to be found on bacterial chromosomes, not on plasmids. [Mobile and extrachromosomal element functions, Other].	1.87793e-06
NZ_CP012430.1\|WP_010729784.1\|158039_160016_-\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|374637	pfam16569, GramPos_pilinBB, Gram-positive pilin backbone subunit 2, Cna-B-like domain. GramPos_pilinBB is one of the major backbone units of Gram-positive pili, such as those from S.pneumoniae. There are three major pilin subunits that form the polymeric backbone of the pilin from S. pneumoniae, constructed of three transthyretin-like, CnaB, domains along with a crucial N-terminal domain, D1. The three Cna-B like domains are stabilized by internal Lys-Asn isopeptdie bonds, Gram-positive pili are formed from a single chain of covalently linked subunit proteins (pilins), usually comprising an adhesin at the distal tip, a major pilin that forms the polymer shaft and a minor pilin that mediates cell wall anchoring at the base.	3.93449e-27

>NZ_CP012430.1|WP_002323647.1|164171_164504_-|hypothetical-protein
MSYTGILSLKDICHYGKRCTATEKITKKLSTGQSKTVVQCKKYIIQKDKVSEEMIYYIGKQKQIILKDPIPLKELYPTIKHVYDQNGVLIGRRKNGVLRCTAKGMGRLIG
>NZ_CP012430.1|WP_002295674.1|163211_163553_-|DUF5406-domain-containing-protein
MKNYDPNIRLGTHTIKVSFQRWDYKGFVTFRRGGNCKGLDVLALDEDDLYDQTLTDNPIGFGLLPEDDEGNEWFKMTLMNDNGDELSVEDTWSYLSDYIVSFEIIEFVADKEE
>NZ_CP012430.1|WP_002297404.1|161724_162975_+|IS110-family-transposase
MKLFVGIDVSSEKLDVCFLTDDNQLSILSEISVANDIEGASFIRETILEFNDSYHFDQIVIGMESTSMYSFHPSMFFHEDEKLKKLNTLVTIENPFRVKQFSRMFDENKTDRNDALRIADFLRIQRFTTSPIKEEKYMALQRLTRTRYQLIKQLIRTKQHFLENLTYKCNTLAREMRDESTSLFSATLISLMTEDFTLDELAELPLEAFCDLLQEKGKGRFKQPEKIAKAIQRAITMSYRLGALAQESINVVLSVLVREIRALEKNIKELDKAIEQVIVVIPEYQCLTSIPGVGKVYAAGLIAEIGQIERFEDQTKLAKYAGLSWKVNQSGNYQSQNTPLTKQGNRYFRYYLVEAANSVKNYLPEYKAFYQSKYKEVPKHQHKRALVLTARKFTRLVDTLLRKHQLYTPPRSVIEK
>NZ_CP012430.1|WP_002295673.1|161075_161315_-|hypothetical-protein
MARPVLEAMDMDTLTKGRYVQLLARGYSPKEVFKALSKGTDMEKERLRKEFDYWRTHNGIKDLKPARPVIKRKKKITQD
>NZ_CP012430.1|WP_002295672.1|160799_161009_-|hypothetical-protein
MNYEEIENRKKVSKEMEEKLLKTMKQKHLKRLSVAQYINDMQLTGKEKACLLGSMKNFEQLRRTYRIHF
>NZ_CP012430.1|WP_002336710.1|160068_160740_-|class-A-sortase
MKKWLFGFLGVTLIVFCSVFGYVSYQKHEGEVFKQNIEKKMPVDQINAHAKSYKEDATNVNNDMSLGQMLSIQKEAIEMGVNKQVFAQIQIPALGLALPIFKGANQYTLSLGAATYFYEDAEMGKGNYVLAGHNMEMPGVLFSDIQKLSLGEVMDLVSNDGVYRYKVTRKFIVPGYFKLIDGVPEENSFLSLPKKGEKPLLTLFTCVYTSQGKERYVVQGELQ
>NZ_CP012430.1|WP_010729784.1|158039_160016_-|isopeptide-forming-domain-containing-fimbrial-protein
MAINRYVKKAGMLVGMLGIIAGCFQGYQVHAEDVTQKTPPEKVNITVHKLMYDQGTQLNVDIDGIKNDGYTHDQYPTGVTKYNKADYGDVEFTLGNITDQVLPREDSDLTNAKVDEIVQDVEDKGSNSEYVKNATNKITSAVDENGEITFTDQPAYVNSKGNVYVVYESKSAAGLVTQKAKPMVVIAPMTDKTGSGFLKNIHLYPKNIVSKLSFELTKFGDDGADQSKQTLLKGAKFELYKGEPGKGTKLGDLVSDDQGKLTATDLTLGKYYFVEVPSEVVVGSDQEPTADQYLLGADARNDAHNKLTFEITNDGVTSDLKASYVNYKAPVIDKTVTNGTGQEHSFQIGDAVNYQGTIHIPTDIAGGADGITVNGVKSETSPYSVFKWGDTAGKGLSYVAEKADIKVTNNDGSVVLKENTDYKIENSDSGFVIDFIVNNGQVSDTVANLHGQDLKMTYNMFVNDSAEIANPLTNSVDFVYNNNPFNQEEHHEKTKADVVTYGAKFLKVDSGLFGTGIKATPLEGAEFAAKNAEGKYYGGLTDTDKDGVKEAVWVDDVANAAILKSDKEGHFEITGLTEGDYSLEETKAPENYQKLTKEISFKVDKDSYKEENRITIKNNQKASVPMTGSNGFQSYVLISCLLLGAGGLSAVVYFKKKA
>NZ_CP012430.1|WP_010729785.1|157271_158027_-|class-C-sortase
MIIRKPPKRRVMHKLMIFFWLLSAVAVYLIPVVETNVAKFQQQQRILAIENLEKTDSSLDVAKIELGDPVGVLTIPSISLKLPIYDGTSDKILENGVGITEGTGDITGGNGKNPLIAGHSGLYKDNLFDDLPSVKKGQKFFIKVNEEQHAYQIYRIEEVKAEELQKNYLDYLMPEKDQDRITLMTCTPKGVNSHRFLVYGERVSFSKEDLKLQKKAKNRKSISLDWRLALLFAFFCVPIIFIYKKIRRRSE
>NZ_CP012430.1|WP_002350398.1|156450_157275_-|hypothetical-protein
MNKRKWLFVCVAALFSTVAYSQLSFADSSDSSTTQTIDNSITAPSETDSSENTTEETADSNISFTESTNPTSESSSETSEKPQDVEDTQVIKQAIHIQKIISSNQINNQGSQVAQQEGINGAKFIVYDITNILEEMSQDDNEKNQSVEIIESKLKDRAKKLSYDQLKKVAEGETKTIDDQEGVIEFSIEVPANKKQAYYIVNESSPENISNSEDIVLLTPVSNEKGEFLTDVWLYPKSEKSEPKEEIKKVVSTGVKKNFFENCWEFFAQLFFDN
>NZ_CP012430.1|WP_010729786.1|154050_156150_-|isopeptide-forming-domain-containing-fimbrial-protein
MENKIHCTTGRVITLVLFLFLLLFARGTAVQALEKVDPSQIKENNNLVLYHDSDSLRNIEVTGINGFKILDEYSTKKQKVLAWPKVKDLKSTSKIVAHYQKVGTYLGKEIDCDVTFSNFVAHAGVNQDGLAKTINGKKYYNYLLFDKNIYRGFFMQSINVMNAKLEFKYAGTKTKVALSEPQPEIQSKMRSMRAAGIDLNDTFLSIYSLNGQYQQRVSWYNDNNESVGERNIDMREFVGYEKMGSLPYFVTTDTACAEYKAPALSTNNLTSKVVGGRAEKAYSSNDHFTDVVGADTYHRSGVTYTLQGASPTFMIGANTNSMMFSFDTALLWTPQPSKPTKEVFNKANTEEAAHNIDKKVIPQGSDVYYHIHQKFDALTVNTMNKYKSFKITDTFDSKNFDMVSDGKNYDGALWYVEANGTWKKADTGGKLTVSGNTVTYTASDSFLANAANYGRDYILQLHMRAKNDAKGIAPNVATVTFNNDPNKGTQKTNTVENYFSLKPNKKVEQDGKDVDGRNDGKKGTPTAPLNAGSEVQYLVTQKWHTKGVDIASDHYKQFSIQDPVEDRLTYKEGSARVIDMSTGKDITSEGTLTYDSNSRTLKWEASADFLSKNLLDGREIQLIFTAKTPLNEELDIDNQAKVSVESIEKATNVVTIGVKPNLPQIIVPKTGSNHLVLTVIGSILFLTLASLGYVVLKLK
>NZ_CP012430.1|WP_002348857.1|167719_167914_+|hypothetical-protein
MMGFFLRFYIIELTGRLTVFFGNFAIKPFAEVTAHYICKWLDCKNKIKKVFHYISSSPCQIRPG
>NZ_CP012430.1|WP_002323589.1|168620_169769_-|transposase
MEQLKAYKFRIYPTEEQEIFFAKSFGCVRKVYNLMLDDRKKAYEEVKNDSSKKMTFPTPAKYKKEFPFLKEIDSLALANAQLNLDKAYKNFFRDKSVGFPRFKSKKNPVQSYTTNNQNGTIALIDSKFIKVPKLKSLVRIKLHRQPKGIIKSATISRHSSGKYYISLLCKEEIIELPKTNSTIGIDLGIMDFAILSDGQKIDNNKFTSKMEKKLKREQRKLSRRALLAKNKGTNLFEAKNYQKQKRKVARLHEKVMNQRTDFLNKLSTEMIKNHDIICIEDLNTKGMLRNHKLAKSISDVSWSKFVTKLQYKADWYGRKIIKVDKWFPSSQICSECGHKDGKKSLEIREWTCPVCHTHHDRDINASINILTEGLRLHSMGLA
>NZ_CP012430.1|WP_002287522.1|169785_170190_-|IS200/IS605-like-element-ISEfa4-family-transposase
MELDTNNHSVFLLYYHLVLVTKYRRQVIDDEISDYAKTTFERISESYHITLVEWNHDKDHVHIMFKAQPKTELTKFINAYKSASSRLIKRDFPRVKQFLWKEMFWSKSFCLLTTGGAPIDVIKKYIQNQGNNHK
>NZ_CP012430.1|WP_002323399.1|170548_170803_+|hypothetical-protein
MGKELKVRKIGNSVGVILPSSLGLKSGDIIQAKQEGNLFILDTTQIAKEHDRKLIEESFQDFEKGLTVSEIEMVKAFGKYGWSE
>NZ_CP012430.1|WP_002290394.1|170803_171121_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MKEYTLVYSKSFQTSLETIIEEWENELALSPASIKRFVGAIQKALELTKNFPTMHEEVSEIYGMDIPTYRIVIGKSYALFYRIDHEKKEILVGRIFQSKQMKLGF
>NZ_CP012430.1|WP_002323400.1|171679_172615_+|hypothetical-protein
MNILNEKRYVWFAGKKYITTFKRLSELMQQTVKSAMPEGYKFNFVQSSVSTESIYFSILSESRLFHFRISSHVKKTDVDIYTFRTNNYKNLNDLSRSISEYLKGNSYLKIRFSHILILLPYLNENFTLIQVDKSFIASGNQGNMNITSNKTSRVLLALMGYGILYRDDQNGQILINRAGRSLLMKYRKFIPEDFQNLQLENMRLEDLFRLAEDDKYRFEVLKIQKNELLNKLYPENAIKAHFGDANHMYSWFIPKRFRGKINAGDQVKVLNRNSTDVVMITDIYVEDEDIIKYMKPVIKLVNKNKGTRGAS
>NZ_CP012430.1|WP_002338109.1|173698_174553_+|AraC-family-transcriptional-regulator
MENSIYLVTEPNTQLKDCYFNFCGYSKTEPRHSFGPAIREQYLIHIVLEGEGYYSINDQKYFLKKGQGFVIPPGVSTFYQADEKNPWSYVWLGLSGNLVEYYLKEIGVGKNHLTFKVENLNSFKGLIFETLSYDQDNLVSELSRQKQVYKFLELLLNSASYLNEGIITKKMNPFVRQTIEIIRENAYQKLSVKDIAVSLSIHENYLSRLFKNDMGISIKEYISEIKISIANDLLSSTEYSIQQISDKIGFSTVQSFSKAFKKANGVSPGVYRKRRLGLGIINGE
>NZ_CP012430.1|WP_002314387.1|174649_176899_+|alpha-galactosidase
MYKDNEMNIIYRSENQQFHLFNQEISYIFKISEDGKLLHLYYGENLPDNDYSHLIEMHHRPMTTYRNENDLLYSLEHLKQEFPEYGTTDFRHPAISLLQKNGSRLSDFVYQGYEVEEGKPKLEGLPATYVDNNDESKTLKVYILDSVTNVQVELLYTIYRDYPVITRSARVMNKGKDIQIIENISSLSLDLPDANYEWQQLSGAWGRERTIKSRTLQQGIQSIESTRGISSHQHNPFVTLKRKNTDENQGEAIGAALVYSGNFLIQAEVDTWDVTRLQVGINPFGFNWKLNPGEIFTAPEAILVYSSKGLNAMSQTFHQLFRKRLARGKWREKDRPVLINNWEATYFDFDEEKLVNIAKKAFDVGIELFVLDDGWFGERENDCAGLGDWHVNPKRLPRGIGSLSEKIRSFGMKFGLWFEPEMVNKDSELYRTHPNWIISTPNRKPNHGRNQYVLNFGLDEVVENIFDQMCKIIDESNLDYIKWDMNRPLTDVFDSHLSADQQGEVFHRYVLGVYRLYEKLITKYPNILFESCSSGGGRFDPGMLHYAPQAWASDDSDAIERLKIQYGTSMLYPLSSIGAHVSIVPNHQTNRITPIKTRGNVAFFGAFGYELDLNELSEGDLRIVKEQIAFYKKYRTIIHNGTFYRLLSPFDDDNQTAWMVVSHDKKTAIVAHYKTLNEVNAPYRRLKLKGLDNDGLYNVGQNSLRSGMELMRAGLVCSDASSGQINDQNRRPETFDFDSKIWVITQEEK
>NZ_CP012430.1|WP_002336205.1|176901_178077_+|MFS-transporter
MNNQKSLLQKGAILSISLMLTSSQAINGVIPQMKQSLGISQSQSELLGTAPSITVILFILLSSYFAKRIGMKKTIILGLLLAGIGGIIPVFTATFQTVLISRVILGAGLGVYNSLAVTYISSLYSGNTRATLLGIRNSMEALGQTILIFLAGVLVNINWTASFLVYAIAFPVALLFALKVPEIRDENSDIPENHVKEKMNPMVFALVLFAILLVMNSIAISVRFASIATEIKGVNFNASNYLALMPILGILAGFMFGPINKWIGKGTLYLGIIFFIISNLLIAVSNGNMTFLLTGLFLSSITGSWCFPFIFSNLDKVTTKNTINFATSLIFIGCNIGNFIAPIAMQLAQFLTRSTNLTAPFFVFAGIFIVILFVTFFATNKKNTRVTRGAS
>NZ_CP012430.1|WP_002297422.1|179221_179485_+|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin
MAKTVLNPSSARKNFYKLLKDVNENHTEIEIISERSENNAVLIGLDDWKAIKETLLLEQIGTLGVVRKREKDDSGFTNVDEIDWDNL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP012430_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012430_2

2928359-2928468

Orphan

Consensus_repeat	Method
TGATGAACAATACTGGTTGAGCAAAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP012430_2

>merge|NZ_CP012430|2|2928359-2928468|CRISPRCasFinder
TGATGAACAATACTGGTTGAGCAAAGCGAAAGGAGTTTCCTTTCGAGCAAAGCGAGTAGAATCACTATGAACGAAGTGAATAGGTGATGAATAATACTGGTTGAGCAAAG

>NZ_CP012430|2|2|2928359-2928468|CRISPRCasFinder
TGATGAACAATACTGGTTGAGCAAAG	CGAAAGGAGTTTCCTTTCGAGCAAAGCGAGTAGAATCACTATGAACGAAGTGAATAGG
TGATGAATAATACTGGTTGAGCAAAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012430.1\|WP_002294577.1\|2920974_2921619_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341358
NZ_CP012430.1\|WP_002296327.1\|2929570_2930260_+\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
NZ_CP012430.1\|WP_002287791.1\|2936525_2937665_+\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP012430.1\|WP_002287792.1\|2937753_2938719_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|275027
NZ_CP012430.1\|WP_002290558.1\|2932782_2934315_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP012430.1\|WP_002294584.1\|2925019_2925892_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801
NZ_CP012430.1\|WP_002294580.1\|2922227_2922773_+\|transcription-termination/antitermination-protein-NusG	unknown	unknown	gnl\|CDD\|180161
NZ_CP012430.1\|WP_002294587.1\|2927441_2928131_+\|50S-ribosomal-protein-L1	unknown	unknown	gnl\|CDD\|180071
NZ_CP012430.1\|WP_002294585.1\|2925904_2926573_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	unknown	unknown	gnl\|CDD\|224674
NZ_CP012430.1\|WP_002289897.1\|2922831_2923737_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|283645
NZ_CP012430.1\|WP_002294579.1\|2921956_2922127_+\|preprotein-translocase-subunit-SecE	unknown	unknown	gnl\|CDD\|376355
NZ_CP012430.1\|WP_002291634.1\|2928540_2929044_+\|50S-ribosomal-protein-L10	unknown	unknown	gnl\|CDD\|234632
NZ_CP012430.1\|WP_002320938.1\|2930341_2931391_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
NZ_CP012430.1\|WP_002291638.1\|2926915_2927338_+\|50S-ribosomal-protein-L11	unknown	unknown	gnl\|CDD\|234661
NZ_CP012430.1\|WP_002287788.1\|2935503_2936217_+\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP012430.1\|WP_002294578.1\|2921780_2921933_+\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|234783
NZ_CP012430.1\|WP_002295743.1\|2931484_2932393_+\|IS982-like-element-ISEfm1-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP012430.1\|WP_002294583.1\|2923909_2924929_+\|alpha-hydroxy-acid-oxidizing-protein	unknown	unknown	gnl\|CDD\|240088
NZ_CP012430.1\|WP_002294588.1\|2929096_2929465_+\|50S-ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|234671
NZ_CP012430.1\|WP_002287787.1\|2934548_2935250_+\|glucosamine-6-phosphate-deaminase	unknown	unknown	gnl\|CDD\|238693

Protein	Function_ID	Function_description	E-value
NZ_CP012430.1\|WP_002294577.1\|2920974_2921619_-\|CBS-domain-containing-protein	gnl\|CDD\|341358	cd02205, CBS_pair_SF, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains superfamily. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	5.69774e-14
NZ_CP012430.1\|WP_002296327.1\|2929570_2930260_+\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	2.9371e-19
NZ_CP012430.1\|WP_002287791.1\|2936525_2937665_+\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.06838e-61
NZ_CP012430.1\|WP_002287792.1\|2937753_2938719_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	gnl\|CDD\|275027	TIGR04171, ribonucleotide-diphosphate_reductase_subunit_beta, ribonucleoside-diphosphate reductase, class 1b, beta subunit. Members of this family are NrdF, the beta subunit of class 1b ribonucleotide reductase. This form uses a dimanganese moiety associated with a tyrosine radical to reduce the cellular requirement for iron. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
NZ_CP012430.1\|WP_002290558.1\|2932782_2934315_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	5.56109e-170
NZ_CP012430.1\|WP_002294584.1\|2925019_2925892_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	2.63238e-103
NZ_CP012430.1\|WP_002294580.1\|2922227_2922773_+\|transcription-termination/antitermination-protein-NusG	gnl\|CDD\|180161	PRK05609, nusG, transcription antitermination protein NusG; Validated.	1.97252e-86
NZ_CP012430.1\|WP_002294587.1\|2927441_2928131_+\|50S-ribosomal-protein-L1	gnl\|CDD\|180071	PRK05424, rplA, 50S ribosomal protein L1; Validated.	1.66496e-146
NZ_CP012430.1\|WP_002294585.1\|2925904_2926573_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	gnl\|CDD\|224674	COG1760, SdaA, L-serine deaminase [Amino acid transport and metabolism].	1.41351e-73
NZ_CP012430.1\|WP_002289897.1\|2922831_2923737_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|283645	pfam06028, DUF915, Alpha/beta hydrolase of unknown function (DUF915). This family consists of several bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.	9.73807e-81
NZ_CP012430.1\|WP_002294579.1\|2921956_2922127_+\|preprotein-translocase-subunit-SecE	gnl\|CDD\|376355	pfam00584, SecE, SecE/Sec61-gamma subunits of protein translocation complex. SecE is part of the SecYEG complex in bacteria which translocates proteins from the cytoplasm. In eukaryotes the complex, made from Sec61-gamma and Sec61-alpha translocates protein from the cytoplasm to the ER. Archaea have a similar complex.	1.48e-13
NZ_CP012430.1\|WP_002291634.1\|2928540_2929044_+\|50S-ribosomal-protein-L10	gnl\|CDD\|234632	PRK00099, rplJ, 50S ribosomal protein L10; Reviewed.	3.03735e-67
NZ_CP012430.1\|WP_002320938.1\|2930341_2931391_+\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.96069e-56
NZ_CP012430.1\|WP_002291638.1\|2926915_2927338_+\|50S-ribosomal-protein-L11	gnl\|CDD\|234661	PRK00140, rplK, 50S ribosomal protein L11; Validated.	9.059e-96
NZ_CP012430.1\|WP_002287788.1\|2935503_2936217_+\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	6.15701e-49
NZ_CP012430.1\|WP_002294578.1\|2921780_2921933_+\|50S-ribosomal-protein-L33	gnl\|CDD\|234783	PRK00504, rpmG, 50S ribosomal protein L33; Validated.	3.12722e-17
NZ_CP012430.1\|WP_002295743.1\|2931484_2932393_+\|IS982-like-element-ISEfm1-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.39418e-18
NZ_CP012430.1\|WP_002294583.1\|2923909_2924929_+\|alpha-hydroxy-acid-oxidizing-protein	gnl\|CDD\|240088	cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain. LOX is a member of the family of FMN-containing alpha-hydroxyacid oxidases and catalyzes the oxidation of l-lactate using molecular oxygen to generate pyruvate and H2O2. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).	0
NZ_CP012430.1\|WP_002294588.1\|2929096_2929465_+\|50S-ribosomal-protein-L7/L12	gnl\|CDD\|234671	PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed.	5.30333e-45
NZ_CP012430.1\|WP_002287787.1\|2934548_2935250_+\|glucosamine-6-phosphate-deaminase	gnl\|CDD\|238693	cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.	8.8122e-119

>NZ_CP012430.1|WP_002294587.1|2927441_2928131_+|50S-ribosomal-protein-L1
MAKKSKKMQDALKKVDSSKVYPVAEAVALAKETNIAKFDATVEVAYRLNVDPKKADQQIRGAVVLPNGTGKTQTVLVFAKGDKAKEAEAAGADFVGDDDMVQKIQNGWFDFDVVVATPDMMATVGRLGRVLGPKGLMPNPKTGTVTMDVTKAVNEVKAGKVTYRVDKAGNIHVPIGKVSFDDEKLVENFAAIHDVLLKAKPSAAKGQYMKNVTITTTFGPGIHVDQASF
>NZ_CP012430.1|WP_002291638.1|2926915_2927338_+|50S-ribosomal-protein-L11
MAKKVEKIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGLIIPVVISVYEDRSFTFVTKTPPAAVLLKKAAKIEKGSGEPNKNKVAKVSSDQVREIAELKMEDLNAANVEAAMRMVEGTARSMGITVE
>NZ_CP012430.1|WP_002294585.1|2925904_2926573_-|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta
MKDLRYRSVFDIIGPVMIGPSSSHTAGAARIGKIIRSIFGEQPDSVDIYLYESFAKTYRGHGTDIALVGGLLGMEPDDERLADSLKLAYEAGMEVLFVPKSEKAEHPNSVKMLLKKGTRKLSVTGISIGGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTSILSETNTNIGTMTVTRESKGENAIMIIEVDDPQVEETVKRLKQLPNIDSVNYFD
>NZ_CP012430.1|WP_002294584.1|2925019_2925892_-|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MFLSIEELVDQAKAYPSVAELMIAVEMEMSGRSRSHIIEIMEKNLSVMEQSINEGKEGVTSVTGITGGDAKKLDDYLNEADFLSGETILKAVRNAVAVNEVNAKMGLICATPTAGSAGVVPGVLMAVRDRLDLTHEQQLEFLFTAGAFGLVIANNASISGAEGGCQAEVGSASAMAAAALVCAKNGTPHQAAQAVAITLKNMMGLICDPVAGLVEVPCVKRNALGSSQAFISADMALAGIESVIPPDEVVAAMYQVGRQMPSIFKETAEGGLAVTPTAKRLAEEILNKRA
>NZ_CP012430.1|WP_002294583.1|2923909_2924929_+|alpha-hydroxy-acid-oxidizing-protein
MEAGAFGYIRGGSEDEWTMKENTTSFNTKKIMPRILRGIDSADLHTSVFGIELDTPIIQAPSAAQGLAHEKGEADTAKGVAAAGSIFSISTYANTTIKDAADAAPGAPQFFQLYMSKDDRFNEFILNKAVEAGAKAIILTADSTLGGYREEDVINQFQFPLPMPNLAAYSEQSASGNGEGKGIAEIYAAAKQGLTPDDIKTIKEITHLPVIVKGIQSPEDAVIAISAGADGIWVSNHGGRQLDGGPASFEVLPKIAEVVNKRVPVIFDSGVRRGEHVFKALASGADLVAIGRPVIYGLNLGGAEGVTSVFEHLNKELSITMQLAGTKTIDEVKNTKLMD
>NZ_CP012430.1|WP_002289897.1|2922831_2923737_+|alpha/beta-fold-hydrolase
MERKRCMTEPIKNLCKRATAAALVLISLFALSGCQTTKINTTEVSDKEKTAESSKVIEKTTIPTLFFHGYSGTENSFKGMLRRLEKNQQAVKELVLTVGTDGQIQATGDLSGKADNPMVQVLFEDNKNNEWNQAEWIKTCLLYLKENYGIDKVNIVGHSMGGVSALRYLGTYGQDTSLPQVQTLTAIGAPFNDFVDDSAQSLTDELAKGPAVVSNRYQDYQQMIGNIPITTRFFLIAGQLDETDLSDGTVPLNSALAVYALLKQRGNEIEEKVVTGENASHSMLHENQEVDQLVSRFIWKE
>NZ_CP012430.1|WP_002294580.1|2922227_2922773_+|transcription-termination/antitermination-protein-NusG
MESFEKNWYVLHTYSGYENKVKANIESRAQSMKMADFIFRVVVPEEKETEVKNGKEKEIVHKTFPGYVLVEMIMTDASWYVVRNTPGVTGFVGSHGAGSKPAPLLPEEVNHILRSIGMSLRQNDLEVEVGEVVKIIEGAFAGLEGQVTEVDGEKEKLKVNIDMFGRETSTELDFDQVDKID
>NZ_CP012430.1|WP_002294579.1|2921956_2922127_+|preprotein-translocase-subunit-SecE
MKFLKSVKDEIKQVTWPSRKQLRKDTLVVIETSIIFGLMFYVMDTAIQSLFGWILK
>NZ_CP012430.1|WP_002294578.1|2921780_2921933_+|50S-ribosomal-protein-L33
MAKKKAALACSVCGSRNYTKSVSEGKSGERLEINKFCKYCNQYTLHKETK
>NZ_CP012430.1|WP_002294577.1|2920974_2921619_-|CBS-domain-containing-protein
MLLKTLVYKKKDLTTVTETSTLEEALKILETSGYRCVPILDSSGNIFRGNIYKMHIYRHKANGGDMTLPVTHLLKNATKFIYLDTSFFKVFFTIKELPYIAVLDSENHFYGILTHSTLLNMLSQSWSVEQGSYVLTIASTGKQGDLAAIAKIISKHSSIASCITLDIEKDEYIRRTLITLPANTEAKVCETIVNHLEKKNYKVVEIENLQNQEA
>NZ_CP012430.1|WP_002291634.1|2928540_2929044_+|50S-ribosomal-protein-L10
MSEAIIAKKAAIVDEVSEKFTAAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAKKAGLEGMDEVFTGPTAVAFSNEDVVAPAKIMDEFAKEAKALEIKGGIIEGKVSSLEEITALAKLPNREGLLSMLLSVLQAPVRNVAYAVKAVADKEDGDAA
>NZ_CP012430.1|WP_002294588.1|2929096_2929465_+|50S-ribosomal-protein-L7/L12
MALNIENIVAELKEATILELNDLVKAIEEEFGVSAAAPVAVAAAGGAAAAEEQTEFTVELTAAGDQKVKVIKAVREATGLGLKEAKAVVDGAPAPVKEGVSKEEAEELKAKLEEVGASVTVK
>NZ_CP012430.1|WP_002296327.1|2929570_2930260_+|TVP38/TMEM64-family-protein
MKKKIIRLMLISLGIILILVVGYRLYLEYQTDIQLFLNPRASKAELLAHIRSHGTFASILLIVLTAVMCAVPGIPTSVVGVIAGLSFGPLTGAIINILGNALGNITAIFLMHRLKFLDKKTETNHWVQAIRQMKHPKIGVMLGYMIPVIPSSMVNFAADAMKLPLQQIILSIVIGVIPSSVLYACGGEALFHGYNKTAVTLVASVTVLVGLVVFIYKDRKKKQGKQKHK
>NZ_CP012430.1|WP_002320938.1|2930341_2931391_+|MFS-transporter
MKSNEKTPLTTSLILLLSITCGVVVANMYYIQPIGTKVAASLSVSTSAVGILTMLTQLGYALGLLFLVPLGDVVDRPKLIIRMVALSAVSLLAAFFAPSFTLFACASFLIGLLSIVPQIIIPYGAVLAGPKARGKVMGTLLSGLLVGILLSRTVSGIVASLFSWRMIYLFALCAVGILTLLLYWKMPRSVQQSSTAVSYLDSLKSLPHLVASQRLLREAAVSGFFMFGTFSIFWSTLIFYISSPAYNWGTFEAGILAIFGLSGAVAAPIVGRLADSYSERKIVYMGLVMQTISFIALLVGGSHLAILLLAIILLDVGNQFGQVANQTRVQGLGEAASNRNNTVFTRGAS
>NZ_CP012430.1|WP_002295743.1|2931484_2932393_+|IS982-like-element-ISEfm1-family-transposase
MRSSKYTEHYTDTFITFKEIMRTVSNIYHNCVPDKIKNRRNTDQLKQRDTVIIACVIWGIINGYTSQRATYRAVCSVLFPNGDFPSRSRFTRLSSNLAYTIKIIRYFFIKKLTKGELVGIIDSFPSPLCKPVRNRQAKLLNQIAKVGYNSTKKSYFYGLKIHMIVTKTGFPITYSITNPGVHDVKVLETLSEEANLPNILGDKGYISHKIHEKLALKGITISVPPRKNMDKSEKLDHSLLGKQRKTVETVFSSLEKLGCQNFNSRSVKGLESRFESILLAYSVLLSRAQRRFEGTLRYSLGY
>NZ_CP012430.1|WP_002290558.1|2932782_2934315_-|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MSILTLNNITQQFGDKILYEGVDLQLNAGEHLGLIGQNGAGKSTLIKIITGEILPDDGQIHWQKNIHKGYLDQYVEVDETLTIEEFLKTAYAKEYEKEEKIAFLYQTYSETFDDSLLEKAGKLQTELDQGVFYQIDTLVAEMSSGLGIDVLGLDSLLKNLSGGQRSKVILAKLLLENPDVLILDEPTNHLDDQHIQWLTQFLQDFDGAYIVISHDQEFLDQITTHIADIEFGKITKYTGHLKQALKQKEQNRESYLRQYHAQQKQIEKTEAYIRKYKAGSRSTMAKSRQKQLDKIERLTPPASASKAVFDFPFSPIVTTLAVETTDLVIGYDRPLLAPINLTIRFGENIAIRGFNGIGKSTLLKTLIGEIEKISGDFHFPDNTKINYFSQDLYWENPLETPLQYLSSQFPKATIKELRRQLAKAGLVNQLASEPLTTLSGGEQTKVKLAQLTMNQGNLLILDEPTNHIDQETKESLQDGIQKFPGTVIIVSHEQEFYQDLVQRVIEIEPK
>NZ_CP012430.1|WP_002287787.1|2934548_2935250_+|glucosamine-6-phosphate-deaminase
MEIIRVKNAEEGGKKAFEIIKEGMNKGAKVLGLATGSTPVTLYKEMTSSDLDFSEMTSVNLDEYVGLGGSDEQSYRHFMDVQLFDKKPFKETFVPDGKAEDLEAACKKYDQIIDAHPIDIQILGIGQNGHIGFNEPGASFDGTTSVVDLTESTINANKRFFDKAEDVPTKAVSMGIGSIMKSKEIVLMAFGESKADAIKGMIEGPVTNHLPASVLQNHDNVVVIIDEEAASKL
>NZ_CP012430.1|WP_002287788.1|2935503_2936217_+|MgtC/SapB-family-protein
MNDMVLTIPEIILRLGIAMLFGGAIGFERQYKNRPAGMRTHILVCMGACIIALIQVEIASGALRDALEYPQLAGTIRSDEARLIAQVVSGVGFLGAGTIIVTKQSVTGLTTAASLWAIAGLGIAIGMGYYSIAIISFIGIAIALTVVKRVIHVPTTKKLEIQFIHRKETKDFLTDYFEEKNIVIEDVNFDVKFVDDYRVYKNIYTIDLPKGLTYADVIEELSVHKNITKLHLVSIAQ
>NZ_CP012430.1|WP_002287791.1|2936525_2937665_+|AI-2E-family-transporter
MQSRFKQSKLFFWTVELVLTIIGVYFILQMPNIFSPILKMLSAIFLPLLVAGFIYYMFDPIVVFLEKHRIPRVFGFLLTFLVVIILVVLTVMNVVPQLMEQTIQLTQSLPMYADETSKWLNELAQREEFKNFNLEEQLASANLSLSNLFNIILVSLSASVSKIISFMMQFFILLFTVPFILLFMFKDGHKFIDALSHFFPKAIRKELRQTVKELNETLSAYISSTILDALIIGVMSFLAMRIFDQPYSLLLAVICGITNIIPYVGPFIGAVPAIIVGLFISPFQALYMALSILVIQQLDGNLIKPLLFGKSMNIHPLTIILVLIGAGSVAGILGMLICIPVYAVIKTIILNIRKIYLLRRMEHVSEKLDSPKVLEETSE
>NZ_CP012430.1|WP_002287792.1|2937753_2938719_-|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta
MSETYYEAINWNEIEDIIDKSTWEKLTEQFWLDTRIPLSNDLDDWRTLSQLEKDTVGHVFGGLTLLDTVQSESGMDQLRKDVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFDWTNTNPYLQKKAERINEIYKHGTPLEKKIASVFLETFLFYSGFYTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEAEQETLKDWMYNLLYELYENEERYTEELYDPIGWTEEVKTFLRYNANKALMNLGMDPLFPDTANDVNPIVMNGISTGTSNHDFFSQVGNGYLLGHVEAMKDDDYLIGLE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221216-221254	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	452-490	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244126-244164	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27883-27921	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96547-96585	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	454-492	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	95092-95130	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358205-358243	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119937-119975	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111370-111408	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126934-126972	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153621-153659	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129212-129250	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71269-71307	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249118-249156	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107198-107236	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91402-91440	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102426-102464	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1397-1435	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60362-60400	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97677-97715	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52637-52675	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102651-102689	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200630-200668	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56543-56581	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65333-65371	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67328-67366	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14572-14610	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178898-178936	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33082-33120	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105709-105747	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39887-39925	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	35165-35203	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225612-225650	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92046-92084	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17089-17127	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86167-86205	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61653-61691	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5084-5122	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177278-177316	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244126-244164	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192113-192151	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	453-491	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168263-168301	0	1.0
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109448-109486	1	0.974
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	453-491	1	0.974
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	453-491	1	0.974
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47629-47667	1	0.974
NZ_CP012430_1	1.2\|165878\|39\|NZ_CP012430\|CRISPRCasFinder	165878-165916	39	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	3358-3396	4	0.897

1. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

2. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

3. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

4. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

5. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

6. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

7. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

8. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

9. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

10. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

11. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

12. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

13. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

14. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

15. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

16. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

17. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

18. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

19. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

20. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

21. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

22. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

23. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

24. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

25. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

26. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

27. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

28. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

29. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

30. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

31. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

32. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

33. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

34. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

35. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

36. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

37. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

38. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

39. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

40. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

41. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

42. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

43. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

44. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

45. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

46. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

47. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

48. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

49. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

50. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

51. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

52. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

53. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

54. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

55. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

56. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

57. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

58. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

59. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

60. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

61. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

62. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

63. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

64. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

65. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

66. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

67. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

68. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

69. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

70. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

71. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

72. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

73. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

74. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

75. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

76. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

77. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

78. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

79. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

80. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

81. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

82. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

83. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

84. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

85. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

86. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

87. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

88. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

89. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

90. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

91. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

92. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

93. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

94. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

95. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

96. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

97. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

98. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

99. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

100. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

101. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

102. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

103. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

104. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

105. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

106. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

107. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

108. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

109. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

110. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

111. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

112. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

113. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

114. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgcctgatttttcgtcgagggtg	Protospacer
******************.********************

115. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgcctgatttttcgtcgagggtg	Protospacer
******************.********************

116. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgcctgatttttcgtcgagggtg	Protospacer
******************.********************

117. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgaggatg	Protospacer
************************************.**

118. spacer 1.2|165878|39|NZ_CP012430|CRISPRCasFinder matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 4, identity: 0.897

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
agccccaaggattcagcgtctgatttttcgtcgagggtg	Protospacer
. *** *.*******************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4749 : 73604

Bacillus_phage(25.0%)

integrase,transposase

attL 3153:3197|attR 55585:55629

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3153:3197	attL	NA	NA	NA	NA
WP_086953894.1\|4749_6176_-\|transposase	IS3-like element ISEfa10 family transposase	A0A1B1P773	Bacillus_phage	2.3e-48	40.2
WP_002301718.1\|6417_6873_+\|transposase	IS200/IS605 family transposase	A0A0H3UZM0	Geobacillus_virus	1.3e-16	37.5
WP_002289255.1\|7458_7689_-	resolvase	NA	NA	NA	NA
WP_002289254.1\|7918_8737_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002289253.1\|8897_9587_+	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_002289252.1\|9600_11103_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002300328.1\|11115_11592_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_158514236.1\|11688_11865_-\|transposase	transposase	NA	NA	NA	NA
WP_108676098.1\|12089_13252_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002305874.1\|13754_14003_-	hypothetical protein	NA	NA	NA	NA
WP_002287870.1\|14369_14888_+	ClbS/DfsB family four-helix bundle protein	NA	NA	NA	NA
WP_002329899.1\|16024_16432_-	type II toxin-antitoxin system death-on-curing family toxin	NA	NA	NA	NA
WP_002290351.1\|16428_16662_-	addiction module antitoxin	NA	NA	NA	NA
WP_002290352.1\|16995_18081_+	tyrosine recombinase XerS	NA	NA	NA	NA
WP_002324528.1\|18364_19030_-\|integrase	site-specific integrase	A0A1B2AQ00	Phage_Wrath	4.4e-18	32.0
WP_002290356.1\|19183_19333_-	hypothetical protein	NA	NA	NA	NA
WP_002290357.1\|19325_19535_-	DUF3173 domain-containing protein	NA	NA	NA	NA
WP_002335326.1\|21039_22500_-	sucrose phosphorylase	NA	NA	NA	NA
WP_002342361.1\|22496_23717_-	hypothetical protein	NA	NA	NA	NA
WP_002290367.1\|23777_25961_-	alpha-galactosidase	NA	NA	NA	NA
WP_002290368.1\|26000_26831_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002290370.1\|26842_27715_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_002290371.1\|27724_28984_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_002329911.1\|29131_30442_-	alpha-glucosidase/alpha-galactosidase	NA	NA	NA	NA
WP_002350071.1\|30473_31298_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002350067.1\|32292_33402_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002338088.1\|33695_34721_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_002290379.1\|34965_36237_-	substrate-binding domain-containing protein	A0A1B1IVR3	uncultured_Mediterranean_phage	4.1e-17	45.0
WP_002290382.1\|37479_37953_+\|integrase	tyrosine-type recombinase/integrase	A0A097PAS9	Streptococcus_pyogenes_phage	2.3e-13	44.2
WP_002290383.1\|38125_38680_-\|integrase	tyrosine-type recombinase/integrase	W8CYP1	Bacillus_phage	8.6e-36	46.1
WP_002300314.1\|39152_40322_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_002319325.1\|41341_41959_-	hypothetical protein	NA	NA	NA	NA
WP_002311006.1\|43022_43244_-	hypothetical protein	NA	NA	NA	NA
WP_008271463.1\|43341_43587_-	hypothetical protein	NA	NA	NA	NA
WP_002344895.1\|44810_45812_-	DUF4062 domain-containing protein	NA	NA	NA	NA
WP_002344896.1\|45970_46237_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002344897.1\|46226_46583_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_016252778.1\|46717_47398_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	4.5e-127	99.1
WP_044383143.1\|47609_50759_-	type I restriction endonuclease subunit R	NA	NA	NA	NA
WP_016922464.1\|50772_51990_-	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	3.4e-24	26.9
WP_044383147.1\|51979_53575_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	1.8e-126	51.1
WP_002326540.1\|53699_54485_+	SinI family restriction endonuclease	NA	NA	NA	NA
WP_002324480.1\|54477_54720_+	hypothetical protein	NA	NA	NA	NA
WP_010731484.1\|55846_56980_-	ATP-binding protein	NA	NA	NA	NA
55585:55629	attR	NA	NA	NA	NA
WP_002350430.1\|56970_57639_-	response regulator transcription factor	W8CYM9	Bacillus_phage	8.8e-27	32.4
WP_002350432.1\|58094_59081_-	tagatose-bisphosphate aldolase	NA	NA	NA	NA
WP_002350433.1\|59093_60020_-	tagatose-6-phosphate kinase	NA	NA	NA	NA
WP_010731482.1\|60032_60548_-	galactose-6-phosphate isomerase subunit LacB	NA	NA	NA	NA
WP_010731481.1\|60566_60995_-	galactose-6-phosphate isomerase subunit LacA	NA	NA	NA	NA
WP_010731480.1\|61014_61788_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_002350438.1\|61952_62432_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002350439.1\|62488_62791_+	PTS fructose transporter subunit IIB	NA	NA	NA	NA
WP_002350440.1\|62812_64270_+	PTS galactitol transporter subunit IIC	NA	NA	NA	NA
WP_002350442.1\|64862_65615_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_016922316.1\|67239_68922_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002350447.1\|68932_69256_-	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_016922317.1\|69278_70685_-	6-phospho-beta-galactosidase	NA	NA	NA	NA
WP_002350449.1\|71151_72159_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_044383156.1\|72923_73604_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	3.2e-109	83.6

DBSCAN-SWA_2

89375 : 130418

Streptococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002336308.1\|89375_90335_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_010729754.1\|90884_91793_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_010729753.1\|91851_93654_-	3'-5' exoribonuclease	I6R9X8	Croceibacter_phage	1.4e-10	30.1
WP_002342384.1\|93716_94559_-	hypothetical protein	NA	NA	NA	NA
WP_002331328.1\|94574_94796_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002336713.1\|95291_95972_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	5.8e-127	99.1
WP_002339142.1\|96029_97250_-	PAS domain-containing protein	A0A2P0ZL82	Lactobacillus_phage	3.9e-57	58.5
WP_002339141.1\|97269_97881_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	1.7e-56	53.2
WP_002350224.1\|97923_98856_-	FAD:protein FMN transferase	NA	NA	NA	NA
WP_002350223.1\|99276_100137_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002322961.1\|101002_101170_-	hypothetical protein	NA	NA	NA	NA
WP_002298077.1\|101202_102603_-	putative basic amino acid antiporter YfcC	NA	NA	NA	NA
WP_002296840.1\|103137_104325_+\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002288620.1\|104382_105624_-	amidohydrolase family protein	NA	NA	NA	NA
WP_010729750.1\|105659_106370_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002288615.1\|106437_107253_-	fructoselysine 6-kinase	NA	NA	NA	NA
WP_002336724.1\|107263_108232_-	SIS domain-containing protein	NA	NA	NA	NA
WP_010729749.1\|108994_110287_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_002285758.1\|110365_110560_+	hypothetical protein	NA	NA	NA	NA
WP_002287659.1\|110549_110903_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_002296127.1\|111003_112551_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_002302440.1\|112779_114081_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
WP_002389879.1\|114259_114529_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A1S5SCV8	Streptococcus_phage	8.7e-18	48.8
WP_014748823.1\|114518_114785_-	antitoxin	NA	NA	NA	NA
WP_077974475.1\|114853_115081_-	ADP-ribosylglycohydrolase family protein	NA	NA	NA	NA
WP_010729807.1\|115285_115918_-	HAD family phosphatase	A0A1D8KNV9	Synechococcus_phage	3.0e-08	27.9
WP_010729806.1\|115930_118654_-	sigma 54-interacting transcriptional regulator	NA	NA	NA	NA
WP_002322451.1\|118790_119756_-	SIS domain-containing protein	A0A2P1EMF5	Moumouvirus	6.2e-05	21.7
WP_002298371.1\|119809_120622_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_010729805.1\|120635_121409_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002298375.1\|121422_121893_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002298377.1\|121889_122306_-	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_002311511.1\|122630_123473_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_010729802.1\|124931_125840_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002299197.1\|126055_126667_+	VanZ family protein	NA	NA	NA	NA
WP_002299198.1\|126739_127669_+	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_074394709.1\|127826_128564_+	TraM recognition domain-containing protein	NA	NA	NA	NA
WP_010729801.1\|128611_129790_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_171002450.1\|129887_129986_+\|transposase	transposase	NA	NA	NA	NA
WP_080114943.1\|130016_130418_+\|transposase	transposase	A0A0N9S006	Staphylococcus_phage	2.5e-24	49.2

DBSCAN-SWA_3

161724 : 208135

Streptococcus_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297404.1\|161724_162975_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002295674.1\|163211_163553_-	DUF5406 domain-containing protein	F0PIH7	Enterococcus_phage	1.5e-35	62.5
WP_002323647.1\|164171_164504_-	hypothetical protein	NA	NA	NA	NA
WP_002326172.1\|165327_166368_-	replication initiator protein A	NA	NA	NA	NA
WP_002348857.1\|167719_167914_+	hypothetical protein	NA	NA	NA	NA
WP_002323589.1\|168620_169769_-\|transposase	transposase	A0A288TXV8	Enterococcus_phage	9.0e-205	93.7
WP_002287522.1\|169785_170190_-\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
WP_002323399.1\|170548_170803_+	hypothetical protein	NA	NA	NA	NA
WP_002290394.1\|170803_171121_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_002323400.1\|171679_172615_+	hypothetical protein	NA	NA	NA	NA
WP_002338109.1\|173698_174553_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_002314387.1\|174649_176899_+	alpha-galactosidase	NA	NA	NA	NA
WP_002336205.1\|176901_178077_+	MFS transporter	NA	NA	NA	NA
WP_002297422.1\|179221_179485_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_002314366.1\|179484_179757_+	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
WP_002292678.1\|179833_180163_+	AbrB family transcriptional regulator	NA	NA	NA	NA
WP_002292680.1\|180724_181582_+	ParA family protein	F0PIG8	Enterococcus_phage	8.1e-33	30.7
WP_002331383.1\|181829_182510_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	5.8e-127	99.1
WP_086968564.1\|183915_185057_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	3.8e-78	57.7
WP_069314644.1\|185138_185435_+	hypothetical protein	NA	NA	NA	NA
WP_010729386.1\|185590_186040_+	TlpA family protein disulfide reductase	NA	NA	NA	NA
WP_087121905.1\|186069_187232_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
WP_002301194.1\|187481_188759_+	ABC transporter permease	NA	NA	NA	NA
WP_002298083.1\|188768_189425_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-22	32.1
WP_002301195.1\|189424_190801_+	ABC transporter permease	NA	NA	NA	NA
WP_002302275.1\|193359_194331_+	radical SAM protein	NA	NA	NA	NA
WP_002322470.1\|194408_194645_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_077828694.1\|194613_194745_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_002330694.1\|194820_195204_-	hypothetical protein	NA	NA	NA	NA
WP_002302270.1\|195236_196022_-	histidinol phosphate phosphatase	NA	NA	NA	NA
WP_002302268.1\|196199_197300_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_002302267.1\|197289_198114_+	alkaline phosphatase family protein	NA	NA	NA	NA
WP_002330693.1\|198110_198926_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_002313180.1\|198922_199753_+	ABC transporter permease	NA	NA	NA	NA
WP_002302261.1\|199759_200791_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.8e-26	34.6
WP_016922460.1\|202397_202583_+	hypothetical protein	NA	NA	NA	NA
WP_002348630.1\|202706_203423_+	aminotransferase class V-fold PLP-dependent enzyme	Q2XUY6	environmental_halophage	4.5e-45	50.0
WP_002285815.1\|204132_204786_+	response regulator transcription factor	W8CYM9	Bacillus_phage	4.0e-24	33.2
WP_002300494.1\|204782_206102_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_001015311.1\|206203_206884_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_086968564.1\|206994_208135_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	3.8e-78	57.7

DBSCAN-SWA_4

212801 : 258645

Streptococcus_phage(37.5%)

holin,integrase,transposase

attL 222633:222652|attR 257366:257385

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001224538.1\|212801_213419_+	recombinase family protein	Q1MVP4	Enterobacteria_phage	5.1e-13	33.1
WP_000366408.1\|213459_213759_+	BRCT domain-containing protein	NA	NA	NA	NA
WP_000824191.1\|213792_213960_+	hypothetical protein	NA	NA	NA	NA
WP_010729776.1\|214004_214475_-	recombinase family protein	NA	NA	NA	NA
WP_002319817.1\|214480_215161_-\|transposase	IS6-like element ISS1N family transposase	A0A1X9I6C6	Streptococcus_phage	2.5e-109	84.1
WP_086968564.1\|216373_217515_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	3.8e-78	57.7
WP_025189010.1\|218065_218458_+	GNAT family N-acetyltransferase	A0A0N7GFH7	Staphylococcus_phage	1.4e-69	96.9
WP_001028141.1\|218458_219898_+	bifunctional aminoglycoside N-acetyltransferase AAC(6')-Ie/aminoglycoside O-phosphotransferase APH(2'')-Ia	A0A0N9SKF6	Staphylococcus_phage	8.5e-285	100.0
WP_001015311.1\|220364_221045_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_002300493.1\|221384_222554_-\|transposase	IS256 family transposase	NA	NA	NA	NA
222633:222652	attL	NA	NA	NA	NA
WP_001015311.1\|223093_223774_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_002302237.1\|223844_224510_+	hypothetical protein	NA	NA	NA	NA
WP_002305788.1\|224553_224823_+	hypothetical protein	NA	NA	NA	NA
WP_002296377.1\|225054_225351_+	hypothetical protein	NA	NA	NA	NA
WP_010729773.1\|225352_225775_+	hypothetical protein	NA	NA	NA	NA
WP_002296379.1\|225793_227386_+	hypothetical protein	NA	NA	NA	NA
WP_086968564.1\|227887_229029_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	3.8e-78	57.7
WP_002322479.1\|229276_229471_+	hypothetical protein	NA	NA	NA	NA
WP_002330536.1\|229606_230857_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	3.0e-113	63.3
WP_025481134.1\|231239_231800_+	hypothetical protein	NA	NA	NA	NA
WP_002313122.1\|231826_233638_+	hypothetical protein	NA	NA	NA	NA
WP_002313123.1\|233698_235168_+	toprim domain-containing protein	NA	NA	NA	NA
WP_002303486.1\|235178_237188_+	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	1.6e-111	52.6
WP_002295632.1\|237303_237453_+	hypothetical protein	NA	NA	NA	NA
WP_002299811.1\|237533_238130_+	type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein	NA	NA	NA	NA
WP_002301800.1\|238142_239042_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_002301801.1\|239044_239176_+	single-stranded DNA-binding protein	A8ATZ7	Listeria_phage	1.3e-11	83.3
WP_002305808.1\|239197_239530_+	single-stranded DNA-binding protein	W6LM61	Streptococcus_phage	6.1e-21	53.2
WP_002295625.1\|239551_239809_+	hypothetical protein	NA	NA	NA	NA
WP_002295624.1\|239967_240090_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_074399798.1\|240279_240504_+	hypothetical protein	A0A0S2MYI8	Enterococcus_phage	3.6e-09	56.9
WP_002324499.1\|240951_241158_+	hypothetical protein	NA	NA	NA	NA
WP_002287517.1\|241157_241409_+	hypothetical protein	NA	NA	NA	NA
WP_002305049.1\|241424_241862_+	hypothetical protein	NA	NA	NA	NA
WP_002305050.1\|241854_242550_+	hypothetical protein	NA	NA	NA	NA
WP_002305052.1\|243388_243820_+	type II toxin-antitoxin system HicB family antitoxin	F0PIL2	Enterococcus_phage	4.3e-43	64.9
WP_000222572.1\|243993_244947_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002323715.1\|245249_246524_+	MFS transporter	NA	NA	NA	NA
WP_002361237.1\|246577_248005_+	glycoside hydrolase family 32 protein	NA	NA	NA	NA
WP_002322785.1\|248017_248890_+	ROK family protein	NA	NA	NA	NA
WP_002305056.1\|248984_249980_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_002297185.1\|250334_251630_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002323453.1\|252184_252802_+	recombinase family protein	M9Q1K0	Clostridium_phage	6.5e-16	39.5
WP_010729769.1\|252959_254186_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_071870188.1\|254259_254427_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002328876.1\|254973_255882_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_002328877.1\|255937_256435_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002328878.1\|256471_257167_-	HisJ family histidinol phosphate phosphatase	NA	NA	NA	NA
WP_000997695.1\|257466_258645_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
257366:257385	attR	NA	NA	NA	NA

DBSCAN-SWA_5

272885 : 339692

Bacillus_phage(26.67%)

tRNA,integrase,transposase

attL 270458:270474|attR 341377:341393

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
270458:270474	attL	NA	NA	NA	NA
WP_143344080.1\|272885_274048_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	3.9e-78	50.5
WP_000997695.1\|274744_275923_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002295743.1\|276047_276956_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002300833.1\|277358_279305_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002300835.1\|279307_279763_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002300836.1\|279776_281105_+	PTS galactitol transporter subunit IIC	NA	NA	NA	NA
WP_002300838.1\|281138_281423_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002300840.1\|281424_281940_+	YjbQ family protein	NA	NA	NA	NA
WP_002300841.1\|281955_282618_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_002300842.1\|282624_283197_+	SIS domain-containing protein	NA	NA	NA	NA
WP_002300843.1\|283383_284904_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_002305884.1\|285146_285332_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_002300846.1\|285315_285498_-	hypothetical protein	NA	NA	NA	NA
WP_002301839.1\|286451_287051_+\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	1.3e-29	36.1
WP_002322465.1\|287114_287714_+	bacteriophage abortive infection AbiH family protein	NA	NA	NA	NA
WP_002292418.1\|288729_289602_-	ROK family protein	NA	NA	NA	NA
WP_002293868.1\|289865_291812_-	PTS beta-glucoside transporter subunit IIBCA	NA	NA	NA	NA
WP_002302078.1\|291996_293436_+	sucrose-6-phosphate hydrolase	NA	NA	NA	NA
WP_002302077.1\|293437_294400_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.3e-20	25.8
WP_002297218.1\|294620_295916_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_086953894.1\|296091_297518_-\|transposase	IS3-like element ISEfa10 family transposase	A0A1B1P773	Bacillus_phage	2.3e-48	40.2
WP_002301718.1\|297760_298216_+\|transposase	IS200/IS605 family transposase	A0A0H3UZM0	Geobacillus_virus	1.3e-16	37.5
WP_002289255.1\|298801_299032_-	resolvase	NA	NA	NA	NA
WP_002289254.1\|299261_300080_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002289253.1\|300240_300930_+	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_002300328.1\|302456_302933_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_158514107.1\|303028_303139_-\|transposase	transposase	NA	NA	NA	NA
WP_002287966.1\|304796_305171_+	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_002287965.1\|305284_305914_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_002296289.1\|306544_306709_-	hypothetical protein	NA	NA	NA	NA
WP_002294080.1\|307003_308332_+	C1 family peptidase	R4TV59	Phaeocystis_globosa_virus	7.3e-73	38.1
WP_002287963.1\|308533_309367_+	fructosamine kinase family protein	NA	NA	NA	NA
WP_002287962.1\|309382_310120_+	acyl-ACP thioesterase	NA	NA	NA	NA
WP_002287961.1\|310274_311243_-	asparaginase	NA	NA	NA	NA
WP_002287960.1\|311474_312308_+	DUF72 domain-containing protein	NA	NA	NA	NA
WP_002287959.1\|312341_313181_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002287958.1\|313206_313767_+	haloacid dehalogenase	A0A0H3UZF4	Geobacillus_virus	2.3e-28	45.1
WP_002287957.1\|313965_315687_+	septation ring formation regulator EzrA	NA	NA	NA	NA
WP_002287956.1\|315851_316994_+	cysteine desulfurase	NA	NA	NA	NA
WP_002287955.1\|317009_318221_+\|tRNA	tRNA 4-thiouridine(8) synthase ThiI	NA	NA	NA	NA
WP_002287954.1\|318793_319441_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_002287953.1\|319833_322479_+\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	4.0e-163	42.9
WP_002294071.1\|322788_324102_+	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_002287951.1\|324091_324745_+	HAD family phosphatase	NA	NA	NA	NA
WP_002294069.1\|324799_325492_+	DNA repair protein RadC	NA	NA	NA	NA
WP_002294067.1\|325641_325842_+	cold-shock protein	Q9AZD3	Lactococcus_phage	3.7e-21	71.2
WP_002297218.1\|326087_327383_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002287948.1\|327617_329297_-	ribonuclease J	NA	NA	NA	NA
WP_002287947.1\|329298_329511_-	DNA-dependent RNA polymerase auxiliary subunit epsilon family protein	NA	NA	NA	NA
WP_002296290.1\|329903_331634_+	multidrug efflux ABC transporter subunit EfrA	W8CYL7	Bacillus_phage	2.1e-43	27.6
WP_002289400.1\|331630_333391_+	multidrug efflux ABC transporter subunit EfrB	W8CYL7	Bacillus_phage	2.5e-52	28.6
WP_002296291.1\|333485_333683_+	hypothetical protein	NA	NA	NA	NA
WP_002289401.1\|333835_334321_+	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_002289402.1\|334424_335018_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	8.9e-55	55.6
WP_002289403.1\|335197_335725_+	hypothetical protein	NA	NA	NA	NA
WP_002289404.1\|335815_336553_+	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	2.3e-12	40.0
WP_002289405.1\|336556_337474_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_002289406.1\|337475_338705_+	GTPase HflX	NA	NA	NA	NA
WP_000222572.1\|338738_339692_-\|transposase	IS30 family transposase	NA	NA	NA	NA
341377:341393	attR	NA	NA	NA	NA

DBSCAN-SWA_6

470795 : 522807

Bacillus_phage(23.08%)

holin,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289566.1\|470795_471146_+\|holin	phage holin family protein	NA	NA	NA	NA
WP_002289568.1\|471312_472251_+	HPr kinase/phosphorylase	NA	NA	NA	NA
WP_002289570.1\|472265_473096_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_002289572.1\|473139_474165_+	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_002289574.1\|474179_475118_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	4.2e-75	51.2
WP_002289575.1\|475242_475683_+	DUF948 domain-containing protein	NA	NA	NA	NA
WP_002289576.1\|475685_476288_+	YtxH domain-containing protein	NA	NA	NA	NA
WP_002297218.1\|476394_477690_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002304593.1\|477855_478962_-	aminopeptidase P family protein	NA	NA	NA	NA
WP_002289442.1\|479171_480173_+	catabolite control protein A	NA	NA	NA	NA
WP_002289443.1\|480509_482855_-	penicillin-binding protein	NA	NA	NA	NA
WP_069314649.1\|483133_484036_+	deoxyribonuclease IV	A0A2H4UU70	Bodo_saltans_virus	8.8e-22	30.7
WP_002289445.1\|484248_486024_+	hypothetical protein	NA	NA	NA	NA
WP_002326755.1\|486089_487676_-	Nramp family divalent metal transporter	NA	NA	NA	NA
WP_002294955.1\|487926_488151_+	YneF family protein	NA	NA	NA	NA
WP_002304603.1\|488291_490043_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	4.8e-56	31.2
WP_069314650.1\|490042_491827_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.6e-46	27.4
WP_002289170.1\|492152_493004_+	PRD domain-containing protein	NA	NA	NA	NA
WP_002289171.1\|493100_494981_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_002289172.1\|495020_495923_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002304606.1\|496153_497557_+	6-phospho-beta-glucosidase	NA	NA	NA	NA
WP_002304608.1\|497556_498990_+	6-phospho-beta-glucosidase	NA	NA	NA	NA
WP_002296150.1\|499134_500061_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	5.0e-89	52.4
WP_002299465.1\|500274_502002_+	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	1.5e-211	63.7
WP_002321425.1\|502016_502367_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000122610.1\|502539_503832_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.2e-57	38.9
WP_002304612.1\|503965_504826_-	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_002287322.1\|504917_505346_+	transcriptional repressor	NA	NA	NA	NA
WP_002287321.1\|505507_505684_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_002287318.1\|505710_506157_+	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	5.3e-20	39.5
WP_002296623.1\|506311_507607_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_002326809.1\|507864_509160_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	5.0e-10	21.4
WP_002288744.1\|509343_510723_-	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_002291698.1\|511427_512399_+	PhoH family protein	W8D063	Erwinia_phage	3.5e-48	49.8
WP_002299470.1\|512422_514615_+	HDIG domain-containing protein	NA	NA	NA	NA
WP_002288749.1\|514631_515108_+	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_002330764.1\|515091_515487_+	diacylglycerol kinase family protein	NA	NA	NA	NA
WP_002304617.1\|515501_516401_+	GTPase Era	NA	NA	NA	NA
WP_002288755.1\|516543_517356_+	DNA repair protein RecO	NA	NA	NA	NA
WP_002304619.1\|517739_518657_+\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
WP_002340445.1\|518658_520734_+\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_002297185.1\|521511_522807_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4

DBSCAN-SWA_7

554008 : 695893

152

Enterococcus_phage(20.0%)

capsid,portal,tRNA,holin,head,plate,integrase,transposase,terminase,tail,protease

attL 610713:610730|attR 699650:699667

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002326704.1\|554008_554917_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002304673.1\|556465_557395_-	membrane protein insertase YidC	NA	NA	NA	NA
WP_002289550.1\|557562_557910_+	hypothetical protein	NA	NA	NA	NA
WP_002289551.1\|558110_558386_-	acylphosphatase	NA	NA	NA	NA
WP_002327792.1\|558493_559258_+	RNA methyltransferase	A0A2D1A6G0	Rhodococcus_phage	7.5e-06	26.8
WP_002289559.1\|559380_559884_+	HD domain-containing protein	NA	NA	NA	NA
WP_002289561.1\|560291_560939_+	elongation factor G-binding protein	NA	NA	NA	NA
WP_086953915.1\|561121_562460_+\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-78	52.7
WP_002289547.1\|562520_563789_+	voltage-gated chloride channel family protein	A0A1X9I5Z9	Streptococcus_phage	2.2e-42	31.1
WP_002340453.1\|563815_565015_-	YdcF family protein	NA	NA	NA	NA
WP_002304680.1\|565133_566441_-	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_002288760.1\|566911_568030_+	hypothetical protein	NA	NA	NA	NA
WP_002297185.1\|568481_569777_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002323868.1\|570053_570374_+	hypothetical protein	NA	NA	NA	NA
WP_002288762.1\|570825_571026_+	cold-shock protein	Q9AZD3	Lactococcus_phage	2.5e-22	74.2
WP_002304681.1\|571172_573962_+	DEAD/DEAH box helicase family protein	A0A1X9I5C8	Streptococcus_phage	1.1e-89	30.9
WP_002348809.1\|574008_574536_+	DUF5590 domain-containing protein	NA	NA	NA	NA
WP_002304682.1\|574556_575747_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_002288767.1\|575786_577085_+\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	1.2e-59	30.3
WP_002304684.1\|578137_578812_+	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_002326717.1\|578808_579150_+	hypothetical protein	NA	NA	NA	NA
WP_002288776.1\|579179_579539_+	YccF domain-containing protein	NA	NA	NA	NA
WP_002304688.1\|580062_582144_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	2.4e-115	35.6
WP_002288779.1\|582454_583921_+	amino acid permease	NA	NA	NA	NA
WP_002304690.1\|584535_585075_+	topology modulation protein	A0A097BYE2	Leuconostoc_phage	3.8e-20	34.5
WP_002294855.1\|585148_585589_+	CopY/TcrY family copper transport repressor	NA	NA	NA	NA
WP_002289040.1\|585601_585811_+	copper chaperone CopZ	NA	NA	NA	NA
WP_002312937.1\|585810_587997_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	5.3e-121	38.6
WP_002299539.1\|588016_590188_+	copper/silver-translocating P-type ATPase CopB	A0A218MNH6	uncultured_virus	5.0e-71	32.3
WP_002304699.1\|593982_594924_-	DUF58 domain-containing protein	NA	NA	NA	NA
WP_002304700.1\|595068_595917_-	MoxR family ATPase	NA	NA	NA	NA
WP_002294839.1\|596270_597083_+	hypothetical protein	NA	NA	NA	NA
WP_002304701.1\|597236_597560_+	hypothetical protein	NA	NA	NA	NA
WP_002294835.1\|597633_598203_+	prevent-host-death protein	NA	NA	NA	NA
WP_002301695.1\|598639_599332_+	hypothetical protein	Q9MCC6	Lactobacillus_phage	4.0e-30	43.4
WP_145974683.1\|599371_600711_-\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-78	52.7
WP_099098442.1\|600815_601977_+\|transposase	IS3-like element ISEfa8 family transposase	A0A2I7SC85	Paenibacillus_phage	1.8e-80	54.2
WP_002295743.1\|602279_603188_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002326711.1\|603348_604527_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002305693.1\|604765_605197_+	DUF4231 domain-containing protein	NA	NA	NA	NA
WP_002295273.1\|605428_605686_-	hypothetical protein	NA	NA	NA	NA
WP_002297404.1\|605971_607222_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002301623.1\|607631_608606_+	choloylglycine hydrolase family protein	M1HVK5	Paramecium_bursaria_Chlorella_virus	7.1e-25	31.8
WP_002285758.1\|609078_609273_+	hypothetical protein	NA	NA	NA	NA
WP_002287659.1\|609262_609616_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_002296127.1\|609717_611265_+\|transposase	IS66 family transposase	NA	NA	NA	NA
610713:610730	attL	NA	NA	NA	NA
WP_010729462.1\|611337_612288_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_002326708.1\|613029_613347_+	SdpI family protein	NA	NA	NA	NA
WP_002289810.1\|613437_613803_-	hypothetical protein	NA	NA	NA	NA
WP_002300070.1\|614010_614493_+	hypothetical protein	NA	NA	NA	NA
WP_002289807.1\|614689_615580_+	phosphate ABC transporter substrate-binding protein PstS family protein	NA	NA	NA	NA
WP_002326707.1\|615866_617141_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	9.5e-54	35.9
WP_002297196.1\|617413_619885_+	cation-translocating P-type ATPase	M1HBF8	Paramecium_bursaria_Chlorella_virus	7.0e-45	28.8
WP_002303966.1\|619987_621724_-	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	1.2e-27	34.1
WP_002293705.1\|621720_622425_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.4e-38	36.2
WP_002297194.1\|622555_623059_+	DUF523 domain-containing protein	NA	NA	NA	NA
WP_002293708.1\|623018_623357_+	putative DNA-binding protein	NA	NA	NA	NA
WP_002293709.1\|623377_624796_+	signal recognition particle protein	NA	NA	NA	NA
WP_002293710.1\|624907_625486_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_002297192.1\|625489_626011_+	dihydrofolate reductase	NA	NA	NA	NA
WP_002293714.1\|626089_626644_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	2.3e-12	29.3
WP_002290274.1\|626896_627172_+	30S ribosomal protein S16	NA	NA	NA	NA
WP_002290277.1\|627183_627435_+	KH domain-containing protein	NA	NA	NA	NA
WP_002297190.1\|627559_628351_+	hypothetical protein	NA	NA	NA	NA
WP_002293716.1\|628520_629042_+	ribosome maturation factor RimM	NA	NA	NA	NA
WP_002293717.1\|629031_629793_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_002286913.1\|629928_630276_+	50S ribosomal protein L19	NA	NA	NA	NA
WP_033794991.1\|630407_631544_-\|integrase	site-specific integrase	A0A1P8BMN3	Lactococcus_phage	5.5e-53	36.2
WP_002371140.1\|631660_632353_-	hypothetical protein	NA	NA	NA	NA
WP_002371138.1\|632490_633144_-	hypothetical protein	NA	NA	NA	NA
WP_002371136.1\|633193_633622_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_002337457.1\|633626_634001_-	helix-turn-helix transcriptional regulator	A0A2P0ZLA1	Lactobacillus_phage	6.9e-21	44.6
WP_002337458.1\|634285_634471_+	helix-turn-helix transcriptional regulator	Q5YAA3	Bacillus_phage	1.1e-11	55.0
WP_002371134.1\|634483_634732_+	hypothetical protein	NA	NA	NA	NA
WP_002371131.1\|634762_634942_+	hypothetical protein	NA	NA	NA	NA
WP_002286568.1\|634984_635455_-	hypothetical protein	NA	NA	NA	NA
WP_002286562.1\|635541_636240_+	phage regulatory protein	D2IYT0	Enterococcus_phage	1.7e-25	34.6
WP_002286559.1\|636417_636759_+	hypothetical protein	NA	NA	NA	NA
WP_002286557.1\|636751_637423_+	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	4.2e-29	47.4
WP_069314654.1\|637428_638115_+	hypothetical protein	C9E2N1	Enterococcus_phage	4.4e-90	70.9
WP_002330650.1\|638117_638345_+	hypothetical protein	NA	NA	NA	NA
WP_002319843.1\|638347_639175_+	hypothetical protein	A0A0S2MYA8	Enterococcus_phage	3.9e-40	54.9
WP_069314655.1\|639186_639456_+	hypothetical protein	NA	NA	NA	NA
WP_002301521.1\|639460_639625_+	hypothetical protein	NA	NA	NA	NA
WP_002371792.1\|639617_639920_+	hypothetical protein	NA	NA	NA	NA
WP_002371790.1\|639916_640228_+	MazG-like family protein	A0A0D3MVS9	Staphylococcus_phage	2.0e-26	57.0
WP_002371788.1\|640224_640443_+	hypothetical protein	NA	NA	NA	NA
WP_002304472.1\|640453_641269_+	prohibitin family protein	A0A288TXV9	Enterococcus_phage	1.8e-82	69.4
WP_002371787.1\|641407_641764_+	DUF1140 family protein	A0A2H4JAZ4	uncultured_Caudovirales_phage	5.2e-10	36.4
WP_002367600.1\|641750_641969_+	hypothetical protein	NA	NA	NA	NA
WP_002371784.1\|641965_642364_+	YopX family protein	D2IZL0	Enterococcus_phage	1.7e-33	60.3
WP_069314656.1\|642360_642699_+	hypothetical protein	NA	NA	NA	NA
WP_002369131.1\|642695_642926_+	hypothetical protein	A0A0S2MYD2	Enterococcus_phage	1.8e-11	50.7
WP_002353687.1\|642932_643136_+	hypothetical protein	NA	NA	NA	NA
WP_002369129.1\|643132_643426_+	hypothetical protein	NA	NA	NA	NA
WP_002341971.1\|643455_643896_+	transcriptional regulator	D2IYV6	Enterococcus_phage	5.3e-20	38.4
WP_002305391.1\|643970_644438_+	ArpU family transcriptional regulator	D7RWH7	Brochothrix_phage	2.4e-07	28.5
WP_002341729.1\|644837_645191_-	hypothetical protein	NA	NA	NA	NA
WP_002315371.1\|645737_645950_+	hypothetical protein	D2IZF7	Enterococcus_phage	3.8e-08	59.6
WP_002315370.1\|645956_646184_+	hypothetical protein	NA	NA	NA	NA
WP_002315369.1\|646180_646465_+	hypothetical protein	NA	NA	NA	NA
WP_002371779.1\|646505_647078_+	hypothetical protein	NA	NA	NA	NA
WP_002371777.1\|647078_647390_+	HNH endonuclease	A0A1S5SFB3	Streptococcus_phage	1.7e-28	60.2
WP_002371775.1\|647380_647641_+	hypothetical protein	NA	NA	NA	NA
WP_002371773.1\|647844_648363_+	helix-turn-helix transcriptional regulator	A0A2H4JA84	uncultured_Caudovirales_phage	7.6e-26	55.8
WP_002371772.1\|648365_650057_+\|terminase	terminase large subunit	A0A059T7Q8	Listeria_phage	2.5e-166	51.9
WP_158514237.1\|650127_650427_+	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|650455_651634_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_069314658.1\|651869_652301_+	hypothetical protein	NA	NA	NA	NA
WP_002371768.1\|652429_653602_+\|portal	phage portal protein	A0A2P0ZLC9	Lactobacillus_phage	9.9e-82	46.8
WP_002371767.1\|653588_654293_+\|protease	Clp protease ClpP	A0A2H4J8Y7	uncultured_Caudovirales_phage	9.5e-48	45.9
WP_069314659.1\|654297_655458_+\|capsid	phage major capsid protein	D2XR18	Bacillus_phage	9.2e-64	39.2
WP_002371763.1\|655533_655812_+	hypothetical protein	A0A1W6JQ66	Staphylococcus_phage	1.8e-13	48.2
WP_073357576.1\|655792_656164_+\|head,tail	phage head-tail adapter protein	A0A059T6F2	Listeria_phage	1.2e-28	55.4
WP_002371760.1\|656179_656584_+	hypothetical protein	A0A2H4J7V9	uncultured_Caudovirales_phage	3.1e-19	38.6
WP_002371758.1\|656580_656991_+	hypothetical protein	A0A059T681	Listeria_phage	3.1e-22	47.2
WP_002371756.1\|657051_657639_+\|tail	phage tail protein	A0A2P0ZLF5	Lactobacillus_phage	2.7e-35	41.0
WP_002371755.1\|657711_658179_+	Ig domain-containing protein	C9E2K1	Enterococcus_phage	8.1e-19	43.9
WP_002337251.1\|658224_658533_+	hypothetical protein	NA	NA	NA	NA
WP_002371753.1\|658727_665492_+\|tail	phage tail tape measure protein	J7KDT4	Streptococcus_phage	1.5e-17	38.4
WP_002371751.1\|665495_666317_+\|tail	phage tail family protein	Q9T1A6	Listeria_phage	9.4e-55	43.0
WP_002371749.1\|666325_667369_+\|tail	phage tail protein	Q9T1A5	Listeria_phage	2.4e-103	54.1
WP_002371747.1\|667368_668400_+	hypothetical protein	A0A0B5D0C2	Listeria_phage	1.4e-23	29.1
WP_002371746.1\|668399_670502_+\|plate	BppU family phage baseplate upper protein	A0A060AI60	Enterococcus_phage	2.3e-137	70.1
WP_002352447.1\|670502_670949_+	hypothetical protein	NA	NA	NA	NA
WP_002290625.1\|670950_671088_+	XkdX family protein	NA	NA	NA	NA
WP_002312831.1\|671122_671365_+	hemolysin XhlA family protein	D2J075	Enterococcus_phage	2.0e-21	62.0
WP_002352448.1\|671380_671578_+\|holin	phage holin	A0A0S2MYF6	Enterococcus_phage	1.1e-22	82.8
WP_069314660.1\|671588_672608_+	peptidoglycan recognition protein	A0A1G5SA77	Enterococcus_phage	3.2e-60	66.1
WP_087046766.1\|673547_674709_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
WP_002286474.1\|675632_676040_+	hypothetical protein	NA	NA	NA	NA
WP_002296902.1\|676053_676455_+	hypothetical protein	NA	NA	NA	NA
WP_002286473.1\|676456_676828_+	hypothetical protein	NA	NA	NA	NA
WP_002286680.1\|676863_677166_-	hypothetical protein	NA	NA	NA	NA
WP_076005172.1\|677414_677615_-\|integrase	tyrosine-type recombinase/integrase	Q9AZR0	Lactococcus_phage	4.6e-08	75.7
WP_002348827.1\|677919_679152_-	aminopeptidase	NA	NA	NA	NA
WP_002286467.1\|679408_679978_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002297963.1\|680155_680596_-	flavodoxin	NA	NA	NA	NA
WP_002294533.1\|680753_681518_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_002286461.1\|681549_682473_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_002286457.1\|682548_683688_+	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
WP_002286455.1\|683680_684481_+	glycosyltransferase	NA	NA	NA	NA
WP_002286453.1\|684480_685308_+	glycosyltransferase	NA	NA	NA	NA
WP_002321540.1\|685285_686020_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002286449.1\|686119_686986_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	3.7e-102	62.5
WP_002286442.1\|686999_687572_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	8.3e-42	49.2
WP_002294532.1\|687593_688622_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	6.4e-69	42.9
WP_002286428.1\|688719_689571_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.7e-38	39.0
WP_002348826.1\|689604_691638_+	hypothetical protein	NA	NA	NA	NA
WP_002371302.1\|691681_692962_+	EpaQ family protein	NA	NA	NA	NA
WP_002297185.1\|693058_694354_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_010782578.1\|694618_695893_-\|transposase	ISL3-like element IS1476 family transposase	A0A1S5SBP9	Streptococcus_phage	8.6e-55	36.1
699650:699667	attR	NA	NA	NA	NA

DBSCAN-SWA_8

771370 : 846114

Streptococcus_phage(25.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287651.1\|771370_773311_+\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	3.3e-114	35.2
WP_002287653.1\|773534_774383_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002302928.1\|774777_776931_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_002296740.1\|777116_777926_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002295362.1\|778218_779655_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	3.8e-43	29.0
WP_002290958.1\|779824_781021_+	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_002295359.1\|781082_781268_-	YjzD family protein	NA	NA	NA	NA
WP_002303521.1\|781498_784813_+	DNA polymerase III subunit alpha	R4TB75	Streptomyces_phage	1.8e-149	33.0
WP_002304759.1\|784980_785943_+	6-phosphofructokinase	NA	NA	NA	NA
WP_002295355.1\|786016_787801_+	pyruvate kinase	NA	NA	NA	NA
WP_002295354.1\|787835_788738_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_002295352.1\|788923_789493_+	DUF177 domain-containing protein	NA	NA	NA	NA
WP_002290970.1\|789550_789730_+	50S ribosomal protein L32	NA	NA	NA	NA
WP_002295350.1\|789899_791321_+	NADP-dependent phosphogluconate dehydrogenase	A0A1D8KPW3	Synechococcus_phage	4.2e-34	31.1
WP_002290973.1\|791513_792200_+	response regulator transcription factor	W8CYM9	Bacillus_phage	4.8e-28	31.2
WP_002298265.1\|792196_793702_+	HAMP domain-containing histidine kinase	Q8QNA2	Ectocarpus_siliculosus_virus	3.9e-06	25.1
WP_002288811.1\|802182_802947_+	carbohydrate deacetylase	NA	NA	NA	NA
WP_002321325.1\|802933_804376_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002288813.1\|804386_805718_+	maltose-6'-phosphate glucosidase	NA	NA	NA	NA
WP_002288815.1\|805730_806189_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_002288817.1\|806480_807782_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002295336.1\|807808_808069_+	diacylglycerol kinase	NA	NA	NA	NA
WP_002287522.1\|808933_809338_+\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
WP_002287525.1\|809354_810503_+\|transposase	transposase	A0A288TXV8	Enterococcus_phage	1.2e-204	93.4
WP_002288819.1\|810958_812194_-	glycosyl transferase	NA	NA	NA	NA
WP_002288821.1\|812761_813589_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002288823.1\|813861_814632_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_002288825.1\|814849_815917_+	L-ascorbate 6-phosphate lactonase	NA	NA	NA	NA
WP_002295331.1\|815934_816396_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002288827.1\|816415_817900_+	PTS ascorbate transporter subunit IIC	NA	NA	NA	NA
WP_002288830.1\|817942_818242_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002288832.1\|818256_818895_+	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	NA	NA	NA	NA
WP_002289048.1\|818899_819760_+	L-ribulose-5-phosphate 3-epimerase	NA	NA	NA	NA
WP_002295327.1\|819749_820460_+	L-ribulose-5-phosphate 4-epimerase	NA	NA	NA	NA
WP_069314662.1\|820691_821126_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002289065.1\|821222_821522_-	hypothetical protein	NA	NA	NA	NA
WP_002289063.1\|821790_821985_-	hypothetical protein	NA	NA	NA	NA
WP_002324322.1\|822179_823358_+\|transposase	IS256-like element ISEfm2 family transposase	NA	NA	NA	NA
WP_000222572.1\|823584_824538_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002297183.1\|824762_826625_+	PRD domain-containing protein	NA	NA	NA	NA
WP_002291790.1\|826624_826957_+	PRD domain-containing protein	NA	NA	NA	NA
WP_002287107.1\|827099_828350_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002288314.1\|828759_829116_+	glycine-rich SFCGS family protein	NA	NA	NA	NA
WP_002288312.1\|829131_829482_+	DUF4312 family protein	NA	NA	NA	NA
WP_002288309.1\|829510_830290_+	DUF4311 domain-containing protein	NA	NA	NA	NA
WP_002296962.1\|830300_830978_+	DUF4310 family protein	NA	NA	NA	NA
WP_002288305.1\|830996_832103_+	amidohydrolase/deacetylase family metallohydrolase	NA	NA	NA	NA
WP_002288304.1\|832092_833184_+	DgaE family pyridoxal phosphate-dependent ammonia lyase	NA	NA	NA	NA
WP_002288301.1\|833196_833937_+	KDGP aldolase family protein	NA	NA	NA	NA
WP_002288299.1\|834224_836165_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002288297.1\|836251_838174_+	transcription antiterminator	NA	NA	NA	NA
WP_002288294.1\|838453_838876_-	arsenate reductase (thioredoxin)	A0A2H4PQT9	Staphylococcus_phage	2.0e-29	48.9
WP_002288292.1\|839267_840290_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_002288290.1\|840414_840849_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_002288289.1\|840963_841938_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_002288288.1\|842335_843289_-	1-phosphofructokinase family hexose kinase	NA	NA	NA	NA
WP_002288287.1\|843254_844046_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.4e-18	29.4
WP_002288286.1\|844269_844728_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002287107.1\|844863_846114_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3

DBSCAN-SWA_9

997395 : 1006551

Lysinibacillus_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297185.1\|997395_998691_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002297115.1\|998965_999343_-	hypothetical protein	NA	NA	NA	NA
WP_002288021.1\|999598_1000327_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	4.6e-45	41.4
WP_002295474.1\|1000326_1000581_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_002288017.1\|1000582_1001254_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_002288015.1\|1001254_1003477_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.9e-150	41.3
WP_002288013.1\|1003461_1004901_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.3e-53	33.1
WP_002288011.1\|1004923_1005976_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	2.7e-62	43.7
WP_002288010.1\|1005972_1006551_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-26	37.4

DBSCAN-SWA_10

1305340 : 1331546

Streptococcus_phage(28.57%)

integrase,transposase,protease

attL 1305257:1305273|attR 1337653:1337669

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1305257:1305273	attL	NA	NA	NA	NA
WP_000122610.1\|1305340_1306633_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.2e-57	38.9
WP_002296638.1\|1307372_1307579_+	DUF3955 domain-containing protein	NA	NA	NA	NA
WP_002296637.1\|1307780_1308782_-	alpha/beta hydrolase	M1PGN2	Moumouvirus	2.5e-09	31.8
WP_002296634.1\|1310866_1311373_-	cysteine hydrolase	NA	NA	NA	NA
WP_002296633.1\|1311532_1311973_+	Spx/MgsR family RNA polymerase-binding regulatory protein	NA	NA	NA	NA
WP_002296632.1\|1311998_1313156_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002296631.1\|1313158_1313515_-	hypothetical protein	NA	NA	NA	NA
WP_002296629.1\|1313812_1314787_-	LPXTG-anchored fibrinogen/nidogen-binding adhesin SgrA	NA	NA	NA	NA
WP_002378019.1\|1314982_1315822_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002296627.1\|1316006_1316894_+	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_002311093.1\|1317487_1318183_-	fructose-6-phosphate aldolase	E3SKN5	Synechococcus_phage	1.0e-22	31.5
WP_002296624.1\|1318166_1318565_-	PTS glucitol/sorbitol transporter subunit IIA	NA	NA	NA	NA
WP_002287107.1\|1318973_1320224_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002296760.1\|1320365_1321361_-	PTS glucitol/sorbitol transporter subunit IIB	NA	NA	NA	NA
WP_002289423.1\|1321378_1321933_-	PTS glucitol/sorbitol transporter subunit IIC	NA	NA	NA	NA
WP_002289422.1\|1321920_1322412_-	DeoR family transcriptional regulator	NA	NA	NA	NA
WP_002378335.1\|1322404_1324273_-	HTH domain-containing protein	NA	NA	NA	NA
WP_002289420.1\|1324291_1325092_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.6e-09	26.2
WP_002289418.1\|1325315_1325531_+	DUF378 domain-containing protein	NA	NA	NA	NA
WP_002303864.1\|1325669_1326155_+	hypothetical protein	NA	NA	NA	NA
WP_002289415.1\|1326610_1327024_+	Hsp20/alpha crystallin family protein	A0A1B2LRT2	Wolbachia_phage	2.1e-07	31.5
WP_000997695.1\|1328074_1329253_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_000222572.1\|1329408_1330362_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002288357.1\|1330418_1331546_+\|integrase	site-specific integrase	A0A2I7SCV1	Paenibacillus_phage	1.8e-109	55.5
1337653:1337669	attR	NA	NA	NA	NA

DBSCAN-SWA_11

1480366 : 1610507

146

Enterococcus_phage(20.0%)

capsid,tRNA,portal,holin,head,transposase,terminase,tail,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002294137.1\|1480366_1482076_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_002294136.1\|1482143_1483412_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_002294135.1\|1483572_1484373_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_002294134.1\|1484369_1485182_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	2.0e-25	46.8
WP_069314672.1\|1485590_1486841_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	1.2e-112	63.0
WP_002293875.1\|1487159_1487717_-	ribosome recycling factor	NA	NA	NA	NA
WP_002293877.1\|1487719_1488442_-	UMP kinase	NA	NA	NA	NA
WP_002293878.1\|1488577_1489459_-	elongation factor Ts	NA	NA	NA	NA
WP_002293880.1\|1489557_1490340_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_002293881.1\|1490698_1491178_+	ArgR family transcriptional regulator	NA	NA	NA	NA
WP_002326698.1\|1491394_1492486_+	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
WP_002326699.1\|1492478_1492607_+	hypothetical protein	NA	NA	NA	NA
WP_002288430.1\|1492610_1493156_+	phosphonoacetaldehyde hydrolase	NA	NA	NA	NA
WP_002288432.1\|1493608_1495300_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	2.9e-74	32.6
WP_002288434.1\|1495719_1496667_-	carbamate kinase	NA	NA	NA	NA
WP_002288437.1\|1496781_1497801_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_002288439.1\|1497891_1499121_-	arginine deiminase	NA	NA	NA	NA
WP_002288442.1\|1499581_1500283_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_002326809.1\|1500454_1501750_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	5.0e-10	21.4
WP_002301319.1\|1502413_1503430_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	5.4e-60	41.0
WP_002288445.1\|1503426_1503891_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_002348676.1\|1503897_1504440_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_002288447.1\|1504423_1505248_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_002288449.1\|1505336_1506317_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.8e-19	28.9
WP_002288451.1\|1506340_1507825_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_002288452.1\|1507836_1508826_-	UDP-glucose 4-epimerase GalE	A0A1V0SG19	Hokovirus	2.1e-48	36.8
WP_002288457.1\|1509073_1509241_+	DUF3042 family protein	NA	NA	NA	NA
WP_002288458.1\|1509302_1511114_-	FAD/NAD(P)-binding protein	NA	NA	NA	NA
WP_002288459.1\|1511110_1511476_-	DUF488 family protein	NA	NA	NA	NA
WP_002288461.1\|1511638_1512034_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_002288462.1\|1512051_1513014_-	ROK family glucokinase	NA	NA	NA	NA
WP_002293902.1\|1513013_1513226_-	YqgQ family protein	NA	NA	NA	NA
WP_002289885.1\|1513246_1513945_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_002289886.1\|1513964_1514507_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_002301321.1\|1514638_1515643_-	iron ABC transporter permease	NA	NA	NA	NA
WP_002293904.1\|1515639_1516629_-	iron ABC transporter permease	NA	NA	NA	NA
WP_002293905.1\|1516625_1517432_-	ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	1.0e-13	32.1
WP_002293906.1\|1517597_1518554_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002296121.1\|1518630_1519149_-	dihydrofolate reductase	G3MBI7	Bacillus_virus	7.1e-24	39.1
WP_002296119.1\|1519236_1519386_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_002288531.1\|1519613_1520060_+	DUF2188 domain-containing protein	NA	NA	NA	NA
WP_002288533.1\|1520254_1522150_-	asparagine synthase (glutamine-hydrolyzing)	F2Y2L7	Organic_Lake_phycodnavirus	6.0e-20	26.2
WP_002303934.1\|1522474_1523449_-	choloylglycine hydrolase family protein	M1H001	Paramecium_bursaria_Chlorella_virus	3.0e-23	29.7
WP_002296332.1\|1524014_1524581_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002296334.1\|1524836_1526168_+	DUF1576 domain-containing protein	NA	NA	NA	NA
WP_002296335.1\|1526133_1526484_+	hypothetical protein	NA	NA	NA	NA
WP_002297629.1\|1526575_1526995_-	cupin domain-containing protein	NA	NA	NA	NA
WP_002296337.1\|1526995_1527340_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_002301399.1\|1527605_1528565_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_002287776.1\|1528754_1529351_+	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	8.7e-34	41.7
WP_002287775.1\|1529474_1531274_+	glycerophosphoryl diester phosphodiesterase membrane domain-containing protein	I6XE30	Staphylococcus_phage	5.3e-10	26.5
WP_002297633.1\|1531551_1531764_-	hypothetical protein	NA	NA	NA	NA
WP_002293931.1\|1532225_1532375_+	hypothetical protein	NA	NA	NA	NA
WP_002311774.1\|1532627_1533587_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	7.5e-11	27.2
WP_002295743.1\|1533799_1534708_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002288573.1\|1534756_1535143_+	YxeA family protein	NA	NA	NA	NA
WP_002288574.1\|1535450_1536797_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_002288575.1\|1536908_1538258_-	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_002288576.1\|1538374_1539628_+	NAD(P)/FAD-dependent oxidoreductase	A0A2H4PQX1	Staphylococcus_phage	7.7e-24	55.3
WP_002288577.1\|1539698_1540184_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_002288579.1\|1540206_1540965_-	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	1.9e-25	36.4
WP_002288581.1\|1540980_1542159_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	3.9e-102	48.9
WP_002303943.1\|1542388_1544509_+	LTA synthase family protein	W6LM83	Streptococcus_phage	8.2e-220	58.0
WP_002297218.1\|1544626_1545922_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002296838.1\|1546253_1546979_+	hypothetical protein	NA	NA	NA	NA
WP_002288586.1\|1546968_1547478_+	hypothetical protein	NA	NA	NA	NA
WP_002288588.1\|1547547_1548996_-	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	1.7e-19	29.3
WP_002288590.1\|1548995_1549712_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.0e-33	35.7
WP_002288595.1\|1549692_1550043_-	SdpI family protein	NA	NA	NA	NA
WP_002288592.1\|1550186_1550960_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002302293.1\|1551716_1552019_+	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|1552300_1553479_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002321266.1\|1553815_1554055_+	hypothetical protein	NA	NA	NA	NA
WP_002289617.1\|1554416_1554677_-	hypothetical protein	NA	NA	NA	NA
WP_002297218.1\|1554962_1556258_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002289618.1\|1556383_1556881_-	GAF domain-containing protein	NA	NA	NA	NA
WP_002289619.1\|1557010_1557721_-	acetolactate decarboxylase	NA	NA	NA	NA
WP_002289620.1\|1557733_1559398_-	acetolactate synthase AlsS	NA	NA	NA	NA
WP_002300930.1\|1559602_1560265_-	DUF624 domain-containing protein	NA	NA	NA	NA
WP_002303949.1\|1560274_1561090_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002288989.1\|1561351_1561795_-	LysR family transcriptional regulator substrate-binding protein	NA	NA	NA	NA
WP_002296800.1\|1561825_1561939_-	hypothetical protein	NA	NA	NA	NA
WP_002321036.1\|1561928_1562267_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_069314673.1\|1562254_1562632_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_069314674.1\|1562855_1564049_+	MFS transporter	NA	NA	NA	NA
WP_002288984.1\|1564214_1564637_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002303955.1\|1565226_1565682_+	hypothetical protein	NA	NA	NA	NA
WP_002288982.1\|1565843_1567016_-	class C sortase	NA	NA	NA	NA
WP_002303963.1\|1570146_1572474_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_002288970.1\|1573316_1573610_-	DUF2087 domain-containing protein	NA	NA	NA	NA
WP_002299614.1\|1574111_1574342_+	hypothetical protein	NA	NA	NA	NA
WP_002330703.1\|1574347_1574647_+	hypothetical protein	NA	NA	NA	NA
WP_002286473.1\|1574682_1575054_-	hypothetical protein	NA	NA	NA	NA
WP_002296902.1\|1575055_1575457_-	hypothetical protein	NA	NA	NA	NA
WP_002286474.1\|1575470_1575878_-	hypothetical protein	NA	NA	NA	NA
WP_087046766.1\|1576800_1577963_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
WP_002349643.1\|1578902_1579928_-	N-acetylmuramoyl-L-alanine amidase	A0A139ZVY1	Enterococcus_phage	2.8e-64	61.3
WP_002286683.1\|1579924_1580149_-\|holin	phage holin	NA	NA	NA	NA
WP_002286686.1\|1580145_1580439_-	hypothetical protein	NA	NA	NA	NA
WP_002296594.1\|1580476_1580614_-	XkdX family protein	NA	NA	NA	NA
WP_002286491.1\|1580615_1581062_-	hypothetical protein	NA	NA	NA	NA
WP_002290627.1\|1581058_1581208_-	hypothetical protein	NA	NA	NA	NA
WP_002286495.1\|1581224_1583351_-	hypothetical protein	A0A060AI60	Enterococcus_phage	1.4e-62	40.1
WP_002286497.1\|1583374_1585666_-\|tail	phage tail protein	A0A1D3SNL1	Enterococcus_phage	9.6e-89	30.0
WP_002286500.1\|1585675_1586413_-\|tail	phage tail protein	NA	NA	NA	NA
WP_002348716.1\|1586463_1589895_-\|tail	phage tail tape measure protein	A0A1D3SNL5	Enterococcus_phage	3.1e-67	44.4
WP_002286510.1\|1590096_1590459_-	hypothetical protein	NA	NA	NA	NA
WP_002286512.1\|1590478_1591087_-	hypothetical protein	Q8W5Z9	Listeria_phage	3.0e-34	41.1
WP_002286516.1\|1591098_1591503_-	hypothetical protein	R4IBU7	Listeria_phage	6.1e-07	29.5
WP_002296598.1\|1591495_1591897_-	hypothetical protein	A0A1B1P759	Bacillus_phage	1.1e-13	33.3
WP_002286522.1\|1591886_1592240_-\|head	phage head closure protein	NA	NA	NA	NA
WP_002286523.1\|1592229_1592541_-	hypothetical protein	A0A1B1P751	Bacillus_phage	6.3e-12	42.1
WP_002286524.1\|1592537_1593413_-	hypothetical protein	D2IYX3	Enterococcus_phage	5.6e-130	74.2
WP_002286525.1\|1593422_1594583_-\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	1.8e-99	50.1
WP_002286527.1\|1594582_1595269_-\|protease	Clp protease ClpP	A0A2I6PDD0	Staphylococcus_phage	1.0e-30	39.7
WP_002286530.1\|1595231_1596410_-\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	5.4e-80	40.4
WP_002286533.1\|1596429_1598124_-\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	3.0e-148	49.6
WP_002286538.1\|1598101_1598416_-\|terminase	terminase	A0A1S7FYW6	Listeria_phage	3.3e-08	37.9
WP_002296599.1\|1598517_1598799_-	hypothetical protein	NA	NA	NA	NA
WP_002286540.1\|1598803_1599148_-	HNH endonuclease	A0A1B1P757	Bacillus_phage	3.8e-26	57.1
WP_002296600.1\|1599173_1599341_-	thymidylate synthase	NA	NA	NA	NA
WP_002311723.1\|1599536_1599743_-	hypothetical protein	NA	NA	NA	NA
WP_002300143.1\|1600196_1600472_+	hypothetical protein	A0A2H4JEH2	uncultured_Caudovirales_phage	9.9e-17	45.7
WP_002296602.1\|1600468_1600621_-	hypothetical protein	NA	NA	NA	NA
WP_002286542.1\|1600929_1601343_-	autolysin	C9E2P5	Enterococcus_phage	1.5e-56	81.0
WP_002286693.1\|1601419_1601716_-	hypothetical protein	NA	NA	NA	NA
WP_002286545.1\|1601712_1602270_-	DUF1642 domain-containing protein	A0A0C5KKV2	Enterococcus_phage	2.8e-10	36.2
WP_002286547.1\|1602266_1602686_-	YopX family protein	D2IZL0	Enterococcus_phage	4.1e-30	54.3
WP_002322165.1\|1602682_1602901_-	hypothetical protein	NA	NA	NA	NA
WP_069314675.1\|1602887_1603244_-	DUF1140 family protein	A0A2H4JAZ4	uncultured_Caudovirales_phage	4.0e-10	37.4
WP_002286694.1\|1603243_1603549_-	hypothetical protein	NA	NA	NA	NA
WP_002296606.1\|1603545_1603707_-	antitoxin	NA	NA	NA	NA
WP_002286695.1\|1603703_1604006_-	hypothetical protein	NA	NA	NA	NA
WP_002296607.1\|1603998_1604163_-	hypothetical protein	NA	NA	NA	NA
WP_002286696.1\|1604167_1604437_-	hypothetical protein	NA	NA	NA	NA
WP_002286552.1\|1604448_1605198_-	helix-turn-helix domain-containing protein	A0A1L2BY83	Clostridium_phage	1.7e-31	54.0
WP_069314676.1\|1605200_1605887_-	hypothetical protein	C9E2N1	Enterococcus_phage	8.3e-89	70.0
WP_002286557.1\|1605892_1606564_-	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	4.2e-29	47.4
WP_002286559.1\|1606556_1606898_-	hypothetical protein	NA	NA	NA	NA
WP_002286562.1\|1607075_1607774_-	phage regulatory protein	D2IYT0	Enterococcus_phage	1.7e-25	34.6
WP_002286568.1\|1607860_1608331_+	hypothetical protein	NA	NA	NA	NA
WP_002296610.1\|1608373_1608553_-	hypothetical protein	NA	NA	NA	NA
WP_002286573.1\|1608539_1608878_-	DUF771 domain-containing protein	NA	NA	NA	NA
WP_002296611.1\|1608893_1609097_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002290310.1\|1609111_1609888_-	phage antirepressor	A0A1Q1PVU2	Staphylococcus_phage	1.1e-73	53.8
WP_002296612.1\|1610186_1610507_+	helix-turn-helix transcriptional regulator	A0A1S5SDR1	Streptococcus_phage	2.0e-13	40.2

DBSCAN-SWA_12

1685138 : 1693610

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288083.1\|1685138_1687328_+	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.8e-286	66.6
WP_002288081.1\|1687642_1688245_+	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	1.7e-53	58.6
WP_002294035.1\|1688298_1689420_-	DNA polymerase IV	NA	NA	NA	NA
WP_002288078.1\|1689528_1690401_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.1e-88	60.4
WP_002288076.1\|1690469_1690817_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	5.1e-18	41.1
WP_002288073.1\|1690809_1691634_-	stage 0 sporulation family protein	NA	NA	NA	NA
WP_002288071.1\|1691669_1692608_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.3e-35	34.4
WP_002292340.1\|1692621_1692951_-	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_002294039.1\|1692965_1693610_-	dTMP kinase	M1PSC7	Streptococcus_phage	4.2e-58	52.6

DBSCAN-SWA_13

1756900 : 1814872

Streptococcus_phage(37.5%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287066.1\|1756900_1757374_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_002287068.1\|1757496_1758477_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_002287072.1\|1759434_1760304_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002287073.1\|1760329_1760845_+	hypothetical protein	NA	NA	NA	NA
WP_002287074.1\|1760891_1761485_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002291570.1\|1761509_1761689_-	hypothetical protein	NA	NA	NA	NA
WP_002287075.1\|1761765_1762275_-	hypothetical protein	NA	NA	NA	NA
WP_002287076.1\|1762369_1762750_-	VOC family protein	NA	NA	NA	NA
WP_002287078.1\|1763079_1763829_+	nicotinamide mononucleotide transporter	A0A2H4PB74	Lactobacillus_phage	5.1e-92	70.7
WP_002287080.1\|1764012_1765290_-	hypothetical protein	NA	NA	NA	NA
WP_002287081.1\|1765368_1766013_-	pyroglutamyl-peptidase I	NA	NA	NA	NA
WP_002287082.1\|1766211_1767156_-	DUF979 domain-containing protein	NA	NA	NA	NA
WP_002287083.1\|1767157_1767844_-	DUF969 domain-containing protein	NA	NA	NA	NA
WP_002287086.1\|1768317_1768638_+	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_002287087.1\|1768791_1769697_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	6.8e-38	39.4
WP_069314678.1\|1769693_1770467_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_002287090.1\|1770647_1772072_-	amino acid permease	NA	NA	NA	NA
WP_002287091.1\|1772282_1772729_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	NA	NA	NA	NA
WP_002287092.1\|1772793_1774776_-	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_002287094.1\|1774789_1775686_-	N-acetylmuramic acid 6-phosphate etherase	NA	NA	NA	NA
WP_002296173.1\|1775688_1776750_-	DUF871 domain-containing protein	NA	NA	NA	NA
WP_002304258.1\|1776960_1777527_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_002296175.1\|1777554_1779057_-	ABC-F type ribosomal protection protein Eat(A)	A0A1B0RXA0	Streptococcus_phage	1.4e-27	26.1
WP_000122610.1\|1779266_1780559_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.2e-57	38.9
WP_002348781.1\|1780821_1781943_-	glycerate kinase	W6LM47	Streptococcus_phage	7.6e-23	31.3
WP_002296177.1\|1782068_1783010_+	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_002290034.1\|1783159_1784056_-	hypothetical protein	NA	NA	NA	NA
WP_002296179.1\|1784324_1785665_+	amino acid permease	NA	NA	NA	NA
WP_002296181.1\|1785882_1786326_+	DUF305 domain-containing protein	NA	NA	NA	NA
WP_002296182.1\|1786829_1788248_-	Na+/H+ antiporter NhaC	NA	NA	NA	NA
WP_002293788.1\|1788650_1789874_-	M20 family metallopeptidase	NA	NA	NA	NA
WP_002296185.1\|1789904_1790744_-	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002293786.1\|1790760_1791441_-	ABC transporter permease	NA	NA	NA	NA
WP_002296186.1\|1791442_1792516_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	5.8e-28	35.5
WP_002296187.1\|1793162_1793834_-	HAD family phosphatase	NA	NA	NA	NA
WP_002304253.1\|1793920_1796599_-	magnesium-translocating P-type ATPase	M1HXH2	Paramecium_bursaria_Chlorella_virus	1.1e-48	25.6
WP_002293327.1\|1797257_1797695_+	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	4.1e-25	46.2
WP_002296189.1\|1797716_1798583_-	Rgg/GadR/MutR family transcriptional regulator	NA	NA	NA	NA
WP_002293776.1\|1798742_1800836_-	LTA synthase family protein	W6LM83	Streptococcus_phage	4.5e-162	47.1
WP_002293828.1\|1801584_1802208_-	hypothetical protein	NA	NA	NA	NA
WP_002297293.1\|1804011_1805199_+\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	4.6e-26	28.7
WP_000195429.1\|1805743_1806916_+\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
WP_001028141.1\|1807045_1808485_-	bifunctional aminoglycoside N-acetyltransferase AAC(6')-Ie/aminoglycoside O-phosphotransferase APH(2'')-Ia	A0A0N9SKF6	Staphylococcus_phage	8.5e-285	100.0
WP_000393259.1\|1808485_1808878_-	GNAT family N-acetyltransferase	A0A0N7GFH7	Staphylococcus_phage	6.9e-72	100.0
WP_000195429.1\|1808934_1810107_-\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
WP_001015311.1\|1810256_1810937_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_010730188.1\|1811385_1811709_+	quaternary ammonium compound efflux SMR transporter QacH	NA	NA	NA	NA
WP_025192524.1\|1812521_1813445_-	protein rep	NA	NA	NA	NA
WP_001015311.1\|1814191_1814872_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6

DBSCAN-SWA_14

2119155 : 2164262

Bacillus_phage(28.57%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297185.1\|2119155_2120451_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_098381422.1\|2121717_2122844_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	5.0e-75	54.1
WP_002300890.1\|2123529_2124228_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_002300896.1\|2125590_2126424_-	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_002300898.1\|2126657_2127401_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_002294730.1\|2127591_2128227_-	DUF998 domain-containing protein	NA	NA	NA	NA
WP_002300900.1\|2128373_2129615_-	serine/threonine transporter SstT	NA	NA	NA	NA
WP_025477866.1\|2129935_2130613_-	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_002300904.1\|2130863_2131406_-	DNA-binding protein	NA	NA	NA	NA
WP_002300905.1\|2131410_2131638_-	cation transporter	NA	NA	NA	NA
WP_002300907.1\|2131716_2133597_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.9e-98	33.9
WP_002300909.1\|2133882_2134218_+	PRD domain-containing protein	NA	NA	NA	NA
WP_000997695.1\|2134296_2135475_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002341883.1\|2135711_2136671_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002300328.1\|2136829_2137306_-	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_002289252.1\|2137318_2138821_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002289253.1\|2138834_2139524_-	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_002289254.1\|2139684_2140503_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002289255.1\|2140732_2140963_+	resolvase	NA	NA	NA	NA
WP_086953915.1\|2141549_2142888_+\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-78	52.7
WP_002291912.1\|2143740_2144793_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002291914.1\|2144805_2145744_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_002298023.1\|2146194_2146845_-	hypothetical protein	NA	NA	NA	NA
WP_002301781.1\|2146944_2147454_-	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	2.8e-17	34.8
WP_002331215.1\|2147816_2148200_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002336652.1\|2148440_2149055_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002336651.1\|2149870_2150845_-	tagatose-bisphosphate aldolase	NA	NA	NA	NA
WP_002336650.1\|2150863_2151319_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002336649.1\|2151346_2152792_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002331209.1\|2152788_2153724_-	1-phosphofructokinase	NA	NA	NA	NA
WP_002331208.1\|2153891_2154650_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002345001.1\|2155144_2156344_-	MFS transporter	NA	NA	NA	NA
WP_002331206.1\|2156786_2157278_-	hypothetical protein	NA	NA	NA	NA
WP_002331205.1\|2157304_2158450_-	galactonate dehydratase	Q6A202	Oenococcus_phage	1.2e-52	33.4
WP_002336647.1\|2158464_2159832_-	PTS galactitol transporter subunit IIC	NA	NA	NA	NA
WP_002331203.1\|2159856_2160135_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002336646.1\|2160153_2160612_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002336645.1\|2160623_2161244_-	bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_002336644.1\|2161254_2163297_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_001015311.1\|2163581_2164262_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6

DBSCAN-SWA_15

2171098 : 2190116

Streptococcus_phage(85.71%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002345005.1\|2171098_2173018_-	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	96.6
WP_001814923.1\|2173033_2173150_-	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_002345006.1\|2173394_2174309_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	4.7e-156	92.1
WP_002345007.1\|2174323_2175325_-	lysozyme family protein	A0A1S5SEZ8	Streptococcus_phage	1.3e-183	95.5
WP_002345008.1\|2175321_2177505_-	membrane protein	A0A1S5SF30	Streptococcus_phage	2.9e-305	82.3
WP_000331148.1\|2177507_2179955_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	98.4
WP_002345009.1\|2179938_2180331_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	4.6e-68	99.2
WP_002345010.1\|2180417_2180915_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.3e-88	97.6
WP_069314689.1\|2181031_2181283_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	7.3e-27	97.1
WP_002286940.1\|2181358_2183269_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.1e-37	29.8
WP_000398284.1\|2184052_2185258_-	replication initiation factor domain-containing protein	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
WP_000813488.1\|2185436_2186822_-	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	1.1e-265	100.0
WP_000985015.1\|2186850_2187237_-	YdcP family protein	A0A1S5SF96	Streptococcus_phage	3.0e-64	100.0
WP_000420682.1\|2187252_2187567_-	YdcP family protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0
WP_002345011.1\|2187919_2188399_-	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_002290101.1\|2188826_2190116_+	trypsin-like peptidase domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	5.7e-22	30.2

DBSCAN-SWA_16

2197865 : 2238068

Lysinibacillus_phage(20.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297218.1\|2197865_2199161_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002294157.1\|2199258_2200677_-	dipeptidase PepV	NA	NA	NA	NA
WP_002299303.1\|2200825_2201671_+	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
WP_002301667.1\|2201674_2202115_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_002315615.1\|2202164_2202359_+	hypothetical protein	NA	NA	NA	NA
WP_002289316.1\|2202494_2203181_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002302159.1\|2203588_2204278_-	hypothetical protein	NA	NA	NA	NA
WP_002341584.1\|2204252_2206382_-	hydantoinase/oxoprolinase	NA	NA	NA	NA
WP_080388548.1\|2206429_2207326_-	citrate transporter	NA	NA	NA	NA
WP_002296840.1\|2207422_2208610_+\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002341586.1\|2208716_2209058_-	hypothetical protein	NA	NA	NA	NA
WP_002289310.1\|2209493_2209853_-	50S ribosomal protein L20	NA	NA	NA	NA
WP_002289309.1\|2209905_2210106_-	50S ribosomal protein L35	NA	NA	NA	NA
WP_002293357.1\|2210177_2210702_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	1.4e-14	33.3
WP_002300053.1\|2211021_2211654_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_002300052.1\|2211655_2212561_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_002352356.1\|2212645_2213305_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	5.6e-58	51.8
WP_002288231.1\|2213620_2214565_+	mevalonate kinase	NA	NA	NA	NA
WP_002300050.1\|2214557_2215535_+	diphosphomevalonate decarboxylase	NA	NA	NA	NA
WP_002288233.1\|2215547_2216633_+	phosphomevalonate kinase	NA	NA	NA	NA
WP_002300048.1\|2216629_2217694_+	type 2 isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
WP_033582433.1\|2217942_2218746_-	gluconate 5-dehydrogenase	NA	NA	NA	NA
WP_002300046.1\|2218765_2219071_-	5-dehydro-4-deoxy-D-glucuronate isomerase	NA	NA	NA	NA
WP_126145175.1\|2219052_2219259_-	TRAP transporter large permease subunit	NA	NA	NA	NA
WP_086953915.1\|2219302_2220642_-\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-78	52.7
WP_002300788.1\|2221267_2221747_-	TRAP transporter small permease	NA	NA	NA	NA
WP_002288261.1\|2222793_2223900_-	glycosyl hydrolase	NA	NA	NA	NA
WP_002296567.1\|2224128_2226726_-	bifunctional acetaldehyde-CoA/alcohol dehydrogenase	NA	NA	NA	NA
WP_002294182.1\|2227030_2227411_-	preprotein translocase subunit YajC	NA	NA	NA	NA
WP_002294183.1\|2227507_2228653_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	2.5e-82	40.9
WP_002296566.1\|2228870_2229569_+	DUF975 family protein	NA	NA	NA	NA
WP_002289743.1\|2229736_2232376_-	cation-translocating P-type ATPase	A0A1J0FA34	Only_Syngen_Nebraska_virus	1.6e-84	31.2
WP_002297185.1\|2233017_2234313_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002296565.1\|2234516_2235548_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_002287525.1\|2236498_2237647_-\|transposase	transposase	A0A288TXV8	Enterococcus_phage	1.2e-204	93.4
WP_002287522.1\|2237663_2238068_-\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8

DBSCAN-SWA_17

2393218 : 2421503

Streptococcus_phage(77.27%)

integrase,transposase

attL 2390174:2390189|attR 2406598:2406613

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2390174:2390189	attL	NA	NA	NA	NA
WP_002298578.1\|2393218_2394784_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	3.5e-18	30.6
WP_000237797.1\|2394851_2396045_-\|integrase	site-specific integrase	A0A0S2MV79	Bacillus_phage	8.3e-44	34.2
WP_000633907.1\|2396071_2396272_-	DUF3173 domain-containing protein	NA	NA	NA	NA
WP_000845143.1\|2396769_2397000_-	helix-turn-helix domain-containing protein	A0A1S5SEX1	Streptococcus_phage	1.0e-27	78.9
WP_000804879.1\|2396996_2397419_-	sigma-70 family RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	7.5e-48	68.6
WP_001227350.1\|2397949_2398303_+	helix-turn-helix domain-containing protein	A0A1S5SFA6	Streptococcus_phage	2.2e-53	89.7
WP_032506803.1\|2398360_2398549_-	cysteine-rich KTR domain-containing protein	D0R0F6	Streptococcus_phage	7.4e-16	61.4
WP_001817446.1\|2398646_2399687_-	hypothetical protein	A0A1S5SF82	Streptococcus_phage	3.6e-192	95.7
WP_000868795.1\|2400048_2400546_+	trimethoprim-resistant dihydrofolate reductase DfrG	G3MBI7	Bacillus_virus	4.0e-40	49.1
WP_000163792.1\|2400617_2402570_-	hypothetical protein	NA	NA	NA	NA
WP_001159903.1\|2402576_2402813_-	hypothetical protein	NA	NA	NA	NA
WP_002345019.1\|2403047_2403851_-	GTP-binding protein	A0A1S5SF82	Streptococcus_phage	6.0e-147	98.9
WP_127836267.1\|2403866_2403932_-	hypothetical protein	NA	NA	NA	NA
WP_002297218.1\|2404044_2405340_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_078066630.1\|2405421_2405505_-	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_000584387.1\|2405749_2406679_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	1.1e-83	56.6
2406598:2406613	attR	NA	NA	NA	NA
WP_000768373.1\|2406695_2407718_-	lysozyme family protein	A0A1S5SEZ8	Streptococcus_phage	2.4e-132	75.5
WP_000192393.1\|2407714_2409742_-	membrane protein	A0A1S5SF30	Streptococcus_phage	5.1e-195	65.3
WP_000331165.1\|2409738_2412192_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	78.9
WP_000723887.1\|2412175_2412571_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	5.9e-47	72.6
WP_000248477.1\|2412642_2413281_-	hypothetical protein	NA	NA	NA	NA
WP_000870467.1\|2413336_2413831_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	2.8e-54	63.4
WP_000675717.1\|2413897_2414677_-	abortive infection family protein	NA	NA	NA	NA
WP_001009054.1\|2414718_2414940_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	3.1e-29	93.2
WP_000055376.1\|2414936_2415227_-	hypothetical protein	NA	NA	NA	NA
WP_000426689.1\|2415223_2416408_-	replication initiation factor domain-containing protein	A0A1S5SEX3	Streptococcus_phage	6.3e-161	68.1
WP_001130244.1\|2416589_2417993_-	DUF87 domain-containing protein	A0A1S5SFB5	Streptococcus_phage	2.2e-176	66.5
WP_000185761.1\|2418014_2418788_-	hypothetical protein	NA	NA	NA	NA
WP_001234191.1\|2418797_2419175_-	YdcP family protein	A0A1S5SF96	Streptococcus_phage	9.6e-47	76.4
WP_000421279.1\|2419195_2419510_-	YdcP family protein	A0A1S5SF38	Streptococcus_phage	1.2e-42	77.7
WP_000181735.1\|2419709_2421503_-	ATP-dependent helicase	E3T5J8	Cafeteria_roenbergensis_virus	6.9e-26	23.8

DBSCAN-SWA_18

2539804 : 2568792

Bacillus_phage(50.0%)

integrase,transposase

attL 2546262:2546276|attR 2567030:2567044

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002346925.1\|2539804_2541025_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_002320809.1\|2541096_2541255_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002297292.1\|2541942_2542683_+	metal ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	5.7e-19	33.2
WP_002297293.1\|2542774_2543962_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	4.6e-26	28.7
WP_002297294.1\|2544283_2545126_+	metal ABC transporter permease	NA	NA	NA	NA
WP_073120143.1\|2545125_2546073_+	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002297302.1\|2546087_2546321_+	iron-dependent repressor	NA	NA	NA	NA
2546262:2546276	attL	NA	NA	NA	NA
WP_071858995.1\|2546651_2547236_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002297304.1\|2547366_2548035_+	cobalt transporter	NA	NA	NA	NA
WP_002297306.1\|2548045_2549461_+	energy-coupling factor ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	5.8e-20	26.4
WP_002297308.1\|2549478_2550048_+	MptD family putative ECF transporter S component	NA	NA	NA	NA
WP_002297309.1\|2550157_2551912_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.3e-24	24.8
WP_002321752.1\|2551871_2553638_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.5e-30	29.1
WP_002297316.1\|2554160_2554430_+	30S ribosomal protein S14	NA	NA	NA	NA
WP_002297318.1\|2554444_2554624_+	50S ribosomal protein L32	NA	NA	NA	NA
WP_002297319.1\|2554655_2555033_+	hypothetical protein	NA	NA	NA	NA
WP_002297320.1\|2555053_2555203_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_002304819.1\|2555226_2556210_+	GTP-binding protein	NA	NA	NA	NA
WP_002322279.1\|2556239_2556362_+	putative metal homeostasis protein	NA	NA	NA	NA
WP_069314692.1\|2556379_2557903_+	zinc ABC transporter substrate-binding protein AdcA	NA	NA	NA	NA
WP_002304820.1\|2557926_2558166_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002297325.1\|2558358_2558820_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.5e-12	35.0
WP_002317220.1\|2559014_2559233_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002297326.1\|2559350_2560967_+	NusG domain II-containing protein	NA	NA	NA	NA
WP_077828743.1\|2562823_2562979_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_002297332.1\|2563170_2563365_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_002311665.1\|2563274_2563607_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002304825.1\|2564120_2564312_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002297333.1\|2564405_2564792_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_002297334.1\|2565485_2566691_+	YSIRK-targeted surface antigen transcriptional regulator	NA	NA	NA	NA
WP_002332818.1\|2566707_2567142_+	hypothetical protein	NA	NA	NA	NA
2567030:2567044	attR	NA	NA	NA	NA
WP_084196095.1\|2567493_2568792_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_19

2584260 : 2596021

Streptococcus_phage(88.89%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297345.1\|2584260_2585172_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	2.2e-65	44.0
WP_002297346.1\|2585190_2586195_-	lysozyme family protein	A0A1S5SEZ8	Streptococcus_phage	5.6e-118	63.5
WP_002297347.1\|2586191_2588315_-	hypothetical protein	A0A1S5SF30	Streptococcus_phage	1.2e-181	59.7
WP_002297348.1\|2588319_2590767_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	76.0
WP_002297349.1\|2590753_2591143_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	3.9e-43	68.3
WP_002297350.1\|2591202_2591706_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	9.2e-53	59.9
WP_033658092.1\|2591718_2591943_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	1.2e-23	83.8
WP_002286940.1\|2592046_2593957_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.1e-37	29.8
WP_002317225.1\|2594702_2594840_-	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_002297353.1\|2594836_2596021_-	replication initiation factor domain-containing protein	A0A1S5SEX3	Streptococcus_phage	2.9e-142	61.6

DBSCAN-SWA_20

2691976 : 2753015

Lysinibacillus_phage(14.29%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296127.1\|2691976_2693524_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_002340542.1\|2693933_2694548_+	guanylate kinase	A0A143DIC6	Abalone_herpesvirus	1.3e-24	34.6
WP_002287365.1\|2694552_2694858_+	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_002287367.1\|2695110_2697519_+	primosomal protein N'	NA	NA	NA	NA
WP_002287369.1\|2697533_2698025_+	peptide deformylase	E3SLL2	Synechococcus_phage	7.9e-17	43.2
WP_002287374.1\|2698954_2700313_+	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_002287376.1\|2700325_2701066_+	Stp1/IreP family PP2C-type Ser/Thr phosphatase	NA	NA	NA	NA
WP_002287377.1\|2701062_2703132_+	Stk1 family PASTA domain-containing Ser/Thr kinase	A0A1V0SDC3	Indivirus	3.5e-21	30.3
WP_002287379.1\|2703296_2704196_+	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
WP_002287380.1\|2704208_2704859_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_002287382.1\|2704859_2705498_+	thiamine diphosphokinase	NA	NA	NA	NA
WP_002296044.1\|2705652_2706507_+	rod shape-determining protein MreC	NA	NA	NA	NA
WP_002287385.1\|2706510_2707020_+	rod shape-determining protein MreD	NA	NA	NA	NA
WP_002287386.1\|2707274_2708849_+	C40 family peptidase	B5LJD6	Mycobacterium_phage	2.3e-17	50.5
WP_002297218.1\|2709010_2710306_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_069314695.1\|2710432_2712238_-	M3 family oligoendopeptidase	NA	NA	NA	NA
WP_002287389.1\|2712360_2712867_+	VanZ family protein	NA	NA	NA	NA
WP_002287391.1\|2712945_2713668_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_002287397.1\|2713745_2715146_-	peptidoglycan binding domain-containing protein	NA	NA	NA	NA
WP_002287399.1\|2715315_2716290_-	L-lactate dehydrogenase	NA	NA	NA	NA
WP_002287401.1\|2716642_2717203_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_002287403.1\|2717219_2720741_+	transcription-repair coupling factor	NA	NA	NA	NA
WP_002287405.1\|2720755_2722351_+	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_002287407.1\|2722361_2722631_+	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_002287409.1\|2722697_2723123_+	septum formation initiator family protein	NA	NA	NA	NA
WP_002287412.1\|2723168_2723639_+	RNA-binding protein S1	NA	NA	NA	NA
WP_002287414.1\|2723758_2725204_+\|tRNA	tRNA lysidine(34) synthetase TilS	E3T4I1	Cafeteria_roenbergensis_virus	6.8e-08	24.5
WP_002287415.1\|2725203_2725749_+	hypoxanthine phosphoribosyltransferase	A0A1V0SEQ1	Hokovirus	4.1e-06	25.3
WP_002287418.1\|2725838_2727950_+\|protease	ATP-dependent zinc metalloprotease FtsH	C7U047	Ostreococcus_tauri_virus	9.1e-110	50.3
WP_002296053.1\|2728166_2729054_+	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_002290055.1\|2729054_2730059_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_002301217.1\|2730169_2731666_+\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	6.7e-91	40.9
WP_002326809.1\|2731775_2733071_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	5.0e-10	21.4
WP_002289731.1\|2741497_2742691_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.3e-150	72.0
WP_002295566.1\|2742820_2744293_+	MFS transporter	NA	NA	NA	NA
WP_002295567.1\|2744375_2745164_+	esterase family protein	NA	NA	NA	NA
WP_002285876.1\|2745230_2745899_-	TetR/AcrR family transcriptional regulator C-terminal domain-containing protein	NA	NA	NA	NA
WP_002285883.1\|2746013_2747726_+	ABC transporter ATP-binding protein	F2Y302	Organic_Lake_phycodnavirus	1.2e-14	25.4
WP_002301355.1\|2747728_2749501_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.2e-54	29.4
WP_086953915.1\|2749626_2750965_+\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-78	52.7
WP_010729461.1\|2751836_2753015_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA

DBSCAN-SWA_21

2900880 : 2950392

Bacillus_virus(20.0%)

bacteriocin,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296623.1\|2900880_2902176_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_002289850.1\|2902265_2902943_-	DsbA family protein	NA	NA	NA	NA
WP_002289849.1\|2903060_2903636_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_002289848.1\|2903766_2904471_+	GTP pyrophosphokinase family protein	NA	NA	NA	NA
WP_002289847.1\|2904448_2905246_+	NAD kinase	NA	NA	NA	NA
WP_002294562.1\|2905247_2906147_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_002294561.1\|2906164_2907526_+	magnesium transporter	NA	NA	NA	NA
WP_002294560.1\|2907587_2908229_-	copper homeostasis protein CutC	NA	NA	NA	NA
WP_002294559.1\|2908337_2909204_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_002289592.1\|2909424_2909928_+\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
WP_002289593.1\|2909976_2910636_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_002289594.1\|2910655_2913244_+	ATP-dependent RecD-like DNA helicase	A0A218KCE8	Bacillus_phage	8.6e-62	29.2
WP_002289596.1\|2913345_2913573_+	hypothetical protein	NA	NA	NA	NA
WP_002289597.1\|2913682_2914312_-	response regulator transcription factor	NA	NA	NA	NA
WP_002289599.1\|2914308_2915388_-	GHKL domain-containing protein	NA	NA	NA	NA
WP_002324227.1\|2915504_2916437_+	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	5.9e-21	33.2
WP_002294551.1\|2916450_2917596_+	ABC transporter permease	NA	NA	NA	NA
WP_002296167.1\|2917582_2918755_+	ABC transporter permease	NA	NA	NA	NA
WP_002294549.1\|2918853_2919819_-	diacylglycerol kinase	NA	NA	NA	NA
WP_002294548.1\|2920415_2920919_+	QueT transporter family protein	E7DN70	Pneumococcus_phage	3.4e-07	34.3
WP_002294577.1\|2920974_2921619_-	CBS domain-containing protein	NA	NA	NA	NA
WP_002294578.1\|2921780_2921933_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_002294579.1\|2921956_2922127_+	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_002294580.1\|2922227_2922773_+	transcription termination/antitermination protein NusG	NA	NA	NA	NA
WP_002289897.1\|2922831_2923737_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_002294583.1\|2923909_2924929_+	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_002294584.1\|2925019_2925892_-	L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha	NA	NA	NA	NA
WP_002294585.1\|2925904_2926573_-	L-serine ammonia-lyase, iron-sulfur-dependent, subunit beta	NA	NA	NA	NA
WP_002291638.1\|2926915_2927338_+	50S ribosomal protein L11	NA	NA	NA	NA
WP_002294587.1\|2927441_2928131_+	50S ribosomal protein L1	NA	NA	NA	NA
WP_002291634.1\|2928540_2929044_+	50S ribosomal protein L10	NA	NA	NA	NA
WP_002294588.1\|2929096_2929465_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_002296327.1\|2929570_2930260_+	TVP38/TMEM64 family protein	NA	NA	NA	NA
WP_002320938.1\|2930341_2931391_+	MFS transporter	NA	NA	NA	NA
WP_002295743.1\|2931484_2932393_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002290558.1\|2932782_2934315_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	3.3e-45	28.0
WP_002287787.1\|2934548_2935250_+	glucosamine-6-phosphate deaminase	NA	NA	NA	NA
WP_002287788.1\|2935503_2936217_+	MgtC/SapB family protein	G3MA03	Bacillus_virus	6.5e-20	43.7
WP_002287791.1\|2936525_2937665_+	AI-2E family transporter	NA	NA	NA	NA
WP_002287792.1\|2937753_2938719_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	3.4e-128	70.4
WP_002287793.1\|2938768_2940928_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	3.8e-265	63.2
WP_002287795.1\|2941086_2941311_-	glutaredoxin-like protein NrdH	A0A0M7REK7	Lactobacillus_phage	1.7e-11	42.7
WP_002287797.1\|2941711_2942185_+	ferrous iron transport protein A	NA	NA	NA	NA
WP_002287799.1\|2942181_2944314_+	ferrous iron transport protein B	NA	NA	NA	NA
WP_002290587.1\|2944315_2944450_+	hypothetical protein	NA	NA	NA	NA
WP_002287801.1\|2944543_2945188_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002287805.1\|2945374_2946568_+	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-29	37.0
WP_002287807.1\|2946560_2948288_+	ABC transporter permease/substrate binding protein	NA	NA	NA	NA
WP_002304799.1\|2948681_2948879_+\|bacteriocin	leucocin A/sakacin P family class II bacteriocin	NA	NA	NA	NA
WP_002287810.1\|2948880_2949192_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_002321654.1\|2949295_2949442_+\|bacteriocin	EntF family bacteriocin induction factor	NA	NA	NA	NA
WP_000222572.1\|2949438_2950392_-\|transposase	IS30 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP012432

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

20664 : 28335

Temperate_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002321302.1\|20664_21138_+	single-stranded DNA-binding protein	Q938M7	Temperate_phage	5.6e-44	62.0
WP_002321303.1\|21503_21764_+	hypothetical protein	A0A0S2MYI8	Enterococcus_phage	3.4e-11	51.4
WP_002296239.1\|22208_22415_+	hypothetical protein	NA	NA	NA	NA
WP_002305766.1\|22414_22666_+	hypothetical protein	NA	NA	NA	NA
WP_002305764.1\|22681_23098_+	hypothetical protein	NA	NA	NA	NA
WP_002348912.1\|23079_23352_+	hypothetical protein	NA	NA	NA	NA
WP_002305759.1\|23518_23920_+\|transposase	IS200/IS605 family transposase	A0A1P8BMC0	Lactococcus_phage	1.4e-24	43.1
WP_002305757.1\|23931_25077_+\|transposase	transposase	D9J0Y9	Brochothrix_phage	7.7e-164	74.6
WP_002287514.1\|25314_25578_+	hypothetical protein	NA	NA	NA	NA
WP_002321032.1\|25571_25922_+	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_002318230.1\|25945_26560_-	recombinase family protein	M9Q1K0	Clostridium_phage	2.6e-17	31.9
WP_002348911.1\|27009_28335_+	Y-family DNA polymerase	M1Q231	Streptococcus_phage	1.2e-99	43.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP012431

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP012430

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP012432

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection