CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP017149	Pseudomonas aeruginosa strain ATCC 15692 chromosome, complete genome	1 crisprs	csa3,DEDDh,cas3,DinG,WYL,RT	0	0	6	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP017149_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017149_1

342669-342782

Orphan

Consensus_repeat	Method
GGCCAAAGAACTGGAGGGCAAGGTATGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP017149_1

>merge|NZ_CP017149|1|342669-342782|CRISPRCasFinder
GGCCAAAGAACTGGAGGGCAAGGTATGAGCCAGCACAGCGTATCCCGCTCCGTATCCCGTTCAACAGGCTCTCCATCCAGAAGCGTGGCCAAAGAACTGGAGGGCAAGGTATGA

>NZ_CP017149|1|1|342669-342782|CRISPRCasFinder
GGCCAAAGAACTGGAGGGCAAGGTATGA	GCCAGCACAGCGTATCCCGCTCCGTATCCCGTTCAACAGGCTCTCCATCCAGAAGCGT
GGCCAAAGAACTGGAGGGCAAGGTATGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017149.1\|WP_003112942.1\|347354_347858_-\|transcriptional-regulator	unknown	unknown	unknown
NZ_CP017149.1\|WP_003111119.1\|329515_330394_-\|N-carbamoylputrescine-amidase	unknown	unknown	gnl\|CDD\|274553
NZ_CP017149.1\|WP_003084320.1\|349611_350364_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017149.1\|WP_003112937.1\|332601_333978_-\|glutamine-synthetase	unknown	unknown	gnl\|CDD\|223252
NZ_CP017149.1\|WP_003084290.1\|335049_336408_+\|glutamine-synthetase	unknown	unknown	gnl\|CDD\|223252
NZ_CP017149.1\|WP_003112938.1\|334256_335009_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|336781
NZ_CP017149.1\|WP_003084301.1\|339481_340579_+\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270377
NZ_CP017149.1\|WP_003107781.1\|331284_332346_-\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270377
NZ_CP017149.1\|WP_003084297.1\|336473_337844_+\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|180994
NZ_CP017149.1\|WP_003112945.1\|351952_352447_+\|DUF523-domain-containing-protein	unknown	unknown	gnl\|CDD\|224597
NZ_CP017149.1\|WP_003118763.1\|348572_349592_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225176
NZ_CP017149.1\|WP_003084299.1\|337959_339063_+\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270377
NZ_CP017149.1\|WP_003118764.1\|350412_351111_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226274
NZ_CP017149.1\|WP_003084327.1\|351132_351687_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017149.1\|WP_003084303.1\|340633_341788_+\|polyamine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|183226
NZ_CP017149.1\|WP_004352065.1\|347962_348574_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|239267
NZ_CP017149.1\|WP_003112940.1\|343825_346213_-\|penicillin-acylase-family-protein	unknown	unknown	gnl\|CDD\|225241
NZ_CP017149.1\|WP_003112936.1\|330556_331222_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP017149.1\|WP_003084339.1\|352449_353142_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_CP017149.1\|WP_003112941.1\|346323_347376_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378890

Protein	Function_ID	Function_description	E-value
NZ_CP017149.1\|WP_003111119.1\|329515_330394_-\|N-carbamoylputrescine-amidase	gnl\|CDD\|274553	TIGR03381, putative_carbon-nitrogen_hydrolase, N-carbamoylputrescine amidase. Members of this family are N-carbamoylputrescine amidase (3.5.1.53). Bacterial genes are designated AguB. The AguAB pathway replaces SpeB for conversion of agmatine to putrescine in two steps rather than one. [Central intermediary metabolism, Polyamine biosynthesis].	0
NZ_CP017149.1\|WP_003112937.1\|332601_333978_-\|glutamine-synthetase	gnl\|CDD\|223252	COG0174, GlnA, Glutamine synthetase [Amino acid transport and metabolism].	1.09186e-161
NZ_CP017149.1\|WP_003084290.1\|335049_336408_+\|glutamine-synthetase	gnl\|CDD\|223252	COG0174, GlnA, Glutamine synthetase [Amino acid transport and metabolism].	5.71424e-158
NZ_CP017149.1\|WP_003112938.1\|334256_335009_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	gnl\|CDD\|336781	pfam07722, Peptidase_C26, Peptidase C26. These peptidases have gamma-glutamyl hydrolase activity; that is they catalyze the cleavage of the gamma-glutamyl bond in poly-gamma-glutamyl substrates. They are structurally related to pfam00117, but contain extensions in four loops and at the C-terminus.	1.81471e-108
NZ_CP017149.1\|WP_003084301.1\|339481_340579_+\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	0
NZ_CP017149.1\|WP_003107781.1\|331284_332346_-\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	8.00795e-165
NZ_CP017149.1\|WP_003084297.1\|336473_337844_+\|aspartate-aminotransferase-family-protein	gnl\|CDD\|180994	PRK07480, PRK07480, putative aminotransferase; Validated.	0
NZ_CP017149.1\|WP_003118763.1\|348572_349592_+\|alpha/beta-hydrolase	gnl\|CDD\|225176	COG2267, PldB, Lysophospholipase [Lipid metabolism].	3.48481e-56
NZ_CP017149.1\|WP_003084299.1\|337959_339063_+\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	0
NZ_CP017149.1\|WP_003118764.1\|350412_351111_+\|hypothetical-protein	gnl\|CDD\|226274	COG3751, EGL-9, Predicted proline hydroxylase [Posttranslational modification, protein turnover, chaperones].	2.81845e-78
NZ_CP017149.1\|WP_003112945.1\|351952_352447_+\|DUF523-domain-containing-protein	gnl\|CDD\|224597	COG1683, COG1683, Uncharacterized conserved protein [Function unknown].	2.14015e-67
NZ_CP017149.1\|WP_003084303.1\|340633_341788_+\|polyamine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|183226	PRK11607, potG, putrescine ABC transporter ATP-binding subunit PotG.	0
NZ_CP017149.1\|WP_004352065.1\|347962_348574_-\|hypothetical-protein	gnl\|CDD\|239267	cd02969, PRX_like1, Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs. Members of this group contain a conserved cysteine that aligns to the first cysteine in the CXXC motif of TRX. This does not correspond to the peroxidatic cysteine found in PRXs, which aligns to the second cysteine in the CXXC motif of TRX. In addition, these proteins do not contain the other two conserved residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF.	0.0013342
NZ_CP017149.1\|WP_003112940.1\|343825_346213_-\|penicillin-acylase-family-protein	gnl\|CDD\|225241	COG2366, COG2366, Protein related to penicillin acylase [General function prediction only].	0
NZ_CP017149.1\|WP_003112936.1\|330556_331222_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	8.70235e-09
NZ_CP017149.1\|WP_003084339.1\|352449_353142_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	3.29364e-79
NZ_CP017149.1\|WP_003112941.1\|346323_347376_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|378890	pfam12625, Arabinose_bd, Arabinose-binding domain of AraC transcription regulator, N-term. AraC is a bacterial transcriptional regulatory protein with a DNA-binding domain at the C-terminus, HTH_AraC, pfam00165, and this dimerization domain which harbours the arabinose-binding pocket at the N-terminus. AraC positively and negatively regulates expression of the proteins required for the uptake and catabolism of the sugar L-arabinose 1,2,3].	2.54039e-32

>NZ_CP017149.1|WP_003084303.1|340633_341788_+|polyamine-ABC-transporter-ATP-binding-protein
MAIASGAYKKALEGNQQPKEVLVKIDRVTKQFDETLAVDTVSLTINKGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIFLDGQDITDLPPYERPINMMFQSYALFPHMSVAQNIAFGLKQDGLPKAEIDERVAEMLKLVHMTQYAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGVTCVMVTHDQEEAMTMAQRIAIMHLGCIEQIGSPMDIYETPASRLVCEFIGNVNLFDGVLVEDVQDHAVIACPQLENPIYIGHGISTRAEDKRITYALRPEKVMISAQKPDNLEHAGHNWAQGTVYDIAYLGGHSVYYIKLASGMIVQAFMANAERHVARPTWDQSVYISWYDDSGVVLQS
>NZ_CP017149.1|WP_003084301.1|339481_340579_+|polyamine-ABC-transporter-substrate-binding-protein
MQHSIGKTLLVAALATAIAGPVQAEKKSLHIYNWTDYIAPTTLKDFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKLYVSAVLPAKVLRLQTRTWTRIKTGK
>NZ_CP017149.1|WP_003084299.1|337959_339063_+|polyamine-ABC-transporter-substrate-binding-protein
MMKRFGKTLLALTLAGSVAGMAQAADNKVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVYDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKLPNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLVFKPENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFHSSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPKDAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMKKLYTFPDLPAKTQRAMTRSWTKIKSGK
>NZ_CP017149.1|WP_003084297.1|336473_337844_+|aspartate-aminotransferase-family-protein
MNSQITNAKTREWQALSRDHHLPPFTDYKQLNEKGARIITKAEGVYIWDSEGNKILDAMAGLWCVNVGYGREELVQAATRQMRELPFYNLFFQTAHPPVVELAKAIADVAPEGMNHVFFTGSGSEANDTVLRMVRHYWATKGQPQKKVVIGRWNGYHGSTVAGVSLGGMKALHEQGDFPIPGIVHIAQPYWYGEGGDMSPDEFGVWAAEQLEKKILEVGEENVAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYDILFIADEVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGGVVVRDEIVEVLNQGGEFYHGFTYSGHPVAAAVALENIRILREEKIIEKVKAETAPYLQKRWQELADHPLVGEARGVGMVAALELVKNKKTRERFTDKGVGMLCREHCFRNGLIMRAVGDTMIISPPLVIDPSQIDELITLARKCLDQTAAAVLA
>NZ_CP017149.1|WP_003084290.1|335049_336408_+|glutamine-synthetase
MTTKLDQLTSWLKERKITEVECLISDLTGIARGKISPTNKFIAEKGMRLPESVLLQTVTGDYVEDDIYYDLLDPADIDMVCRPDENAVFLVPWAIEPTAMVIHDTFDKLGNPIELSPRNILKRVLKMYADKGWRPIVAPEMEFYLTKRSDDPDYPLQAPVGRSGRQETGRQSFSIDAANEFDPLFEDMYDWCEAQGLDLDTLIHEEGTAQMEINFRHGDALDLADQILVFKRTMREAALKHNVAATFMAKPMTGEPGSAMHLHQSIVDVKTGKNIFSNADGTMSELFLHHIGGLQKFIPEVLPLFAPNVNSFRRFLPDTSAPVNVEWGEENRTVGLRVPDSSPENRRVENRLAGADANPYLALAASLLCGYIGMVEGIKPSAQVKGRGYERRNLRLPLTIEAALERMENCKPLEQYLGSKFISGYVAVKRAEHENFKRVISSWEREFLLLSV
>NZ_CP017149.1|WP_003112938.1|334256_335009_+|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein
MSRLPLIGVTACTKQIGLHPYHIAGDKYLRAVVNGAGGLPLIIPALGESIDQAALLDSVDGLLFTGSPSNVEPRHYSGPASEPGTLHDSDRDATTLPLVRAAIDAGIPVLGICRGFQEMNVAFGGSLHQKVHEVGTFMDHREPADQPLEVQYAPRHAMHVQPGGVLAGIGLPSEFQVNSIHGQGVDRLAPGLRVEALAPDGLVEAISVEGAKAFALGVQWHPEWQVLTNPNYLAIFQAFGKACSKRAGQR
>NZ_CP017149.1|WP_003112937.1|332601_333978_-|glutamine-synthetase
MSVPQRAVQLTEPSEFLKEHPEVQFVDLLIADMNGVVRGKRIERNSLNKVFEKGINLPASLFALDITGSTVESTGLGLDIGDADRICYPIPGTLSMEPWQKRPTAQLLMTMHELEGEPFFADPREVLRQVVARFTEMELTIVAAFELEFYLIDQENVNGRPQPPRSPISGKRPQSVQVYSIDDLDEYVECLQDIIDGARAQGIPADAIVAESAPAQFEVNLNHVNDALKACDHAVLLKRLVKNIAYDHEMDTTFMAKPYPGQAGNGLHVHISLLDKHGNNIFTSEDPEQNAALRHAIGGVLETLPASMAFLCPNVNSYRRFGSQFYVPNAPSWGLDNRTVALRVPTGSPDAVRLEHRVAGADANPYLLLAAVLAGVHHGLTNKVEPGAPIEGNSYEQMEPSLPNNLRDALRELDESEIMAKYIDPKYIDIFVACKESELEEFEHSISDLEYNWYLHTV
>NZ_CP017149.1|WP_003107781.1|331284_332346_-|polyamine-ABC-transporter-substrate-binding-protein
MPRLSALLFLALAPWLAQAEETLRVYNWNDYIDPQVLESFQKDTGIRVEYHTFATAEELDKALRSGEAIDVAVPSHDTLPALLKDNLLRPLDFTQLPNRSHLDRQLLSKLAAVDPDNRHAVPYLWGAVGLAINTPQAEAAYGGPLPNSWSLLFDASQSQRLKSCGISLLDAPDETLAILLNYQGRNLGRTAPSQVRRAAEALHGLRPNLRYVDSERYIADLEGGRLCLAMAWVGDALRAAKAGQPVSFEVPQEGSVLFIDNLVIPAGAQHPREAHRFIDYLMQPKIAAQITAATLYPSGNADAAGFLDPALRQQPGLYPDRDTSRRLFALETPPEKLRPVVDEIWKAFRGASH
>NZ_CP017149.1|WP_003112936.1|330556_331222_-|TetR/AcrR-family-transcriptional-regulator
MQPTSPTRKPRASSQARIAAILDAARGLLADEGIGGLSIYSVAERAEMPPSSVYHFFPSVPALLQGLTGEVHAAFRACLEQPVDHAGLRCWRDLSRIVEERMLAVYARDAAARQLILASHGLAEVTQADRQHDVQLGQAMRALFERHFLLPPLPTDIEIFSLAMELGDRVYALSVQRHGIIDARLAEEGMRVFDAYLGLYLPPILEKRSEPLSGFISDLNR
>NZ_CP017149.1|WP_003111119.1|329515_330394_-|N-carbamoylputrescine-amidase
MTRNVTVAATQMACSWDRPANIARAEKLVRQAAARGAQIILIQELFETPYFCQKPNPDYLQLATTVEENAAIAHFQALARELQVVLPISFFERAGRARFNSIAVIDADGGNLGVYRKSHIPDGPGYHEKYYFNPGDTGFKVWQTRYARIGVGICWDQWFPESARSMALLGAELLFYPTAIGSEPHDASISSRDHWQRVQQGHAGANLMPLVASNRIGREEQDGYDITFYGSSFIADPFGEKVEELNRTEEGILVHTFDLDALERTRSAWGVFRDRRPNLYGPLKTLDGSLES
>NZ_CP017149.1|WP_003112940.1|343825_346213_-|penicillin-acylase-family-protein
MKRTLTVIAVAVAAAAAGGAWYLHAKQPLRNGSLALAHLQAPVDVRYDERGVPHLYAQNQTDLYRALGYVHAQDRLFQMEMLRRLARGELAEVLGPKLVDTDRLFRTLRIRDHAAEYSARQDKQSQPWKVLEAYLDGVNQFQENNPAPLEFDLLGIPRRPFTPEDTLSIAGYMAYSFAAAFRTEPVLTYIRDELGSDYLRIFDLDWHPQGVLTPSGALGAGDWKDLGALARLSQQALEDAGLPQFEGSNAWVVAGSRTASGKPLLAGDPHIRFAAPAVWYEAQLSAPGFELYGHHQALNPFASLGHNRAFGWSLTMFQNDDLDLVAEKVNPDNPNQVWYQGEWVDLQSEEQEIAVKGAAPVKLTLRRSPHGPIVNDALGASSGKTPIAMWWAFLETENPVLDAFYQLNRADTLAKARAAASKIHSPGLNLVWANAAGDIGWWASAALPKRPEGVNPSFILDGSKGEADKSGFYPFADNPQEENPARGYIVSANFQPVPANGRPIPGYYNLADRGQWLDTQLADRGTKWNLDNSRALQLGNRTGYAPRLLAPLLPVLREVVDDAEGKRLVEQLAAWNGDYPVDSTAATLFNQLLFQIAEGALHDELGDAFFDSLIATRAIDSALPRLAGDADSPWWDDRRTERRETRADIVRTAWNASLAHLRGTLGNDPSGWLWGKAHTLTHEHALGQQALLRRLLNVGPFAAPGTHEVPNNLSAKIGPAPWAVTYGPSTRRLVDFADPTHSLGINPVGQSGVPFDGHYDDQAEAYIEGHYLPQHYEENEVKANSKGVLVLEPKR
>NZ_CP017149.1|WP_003112941.1|346323_347376_+|AraC-family-transcriptional-regulator
MQDDPSTSPLTHSATLRRLLYEALDALGLDPTRVYRSVYRRIPLPPPTLGGRLVHDNAPLFWTELAAVTGDADIGLHLGEAMKPRLLDVVGYLLLSARDLEEALRSFVRFQHILSGGFAARLEVEGETARLILDINYLGYASLRQQIECLMLLFLKLLALISDDEFVAERIEFRHRAPPRLGEHRRLFGRLPLFSRPHDALVFSAALLRRPSRNANPDMHDVLTRHAEEQSRELSENRLLNRVRYLIELRLGEGYGLRQCAAELGLGSGALQRALAAGGASFRQVRDEVRRQRASEMLLAGRAIREVAKACGFAELSPFYRAFRRWHAAPPEQYRARLAKREEGYSTSGT
>NZ_CP017149.1|WP_003112942.1|347354_347858_-|transcriptional-regulator
MSLRPTLALLALVSLPLMAAQNDPQPSSKELMKEHQAQIQNDLADVDYKRKRIVEANMNLTDQEGEKFWPIYNTYRTESDKLSKETLKLLLDYAQAYNSGNVSDDQASKLIERVDDLQEDRLELRDKYVKRIAKNVSPKRAMRFLQIEIQLDAIATLEIGRQVPLVE
>NZ_CP017149.1|WP_004352065.1|347962_348574_-|hypothetical-protein
MASLAPVFRVNAMTPRRKTLLVSLVGLLWAGGLLAAYWWFEIRYIRPFSEQTTLFSGDSLRLPAELAGPGAIRLVHFWDPACPCNVGNQQHLGELIERFAGKGVEFHVLQKPGSQGRLPDNLAALRALAGLPGSEQLPASPAVAIWDRDGRLAYFGPYSEGAVCTSSNSFIEPILEALLQGRPVDATHTLAVGCYCPWTPEKG
>NZ_CP017149.1|WP_003118763.1|348572_349592_+|alpha/beta-hydrolase
MCSRAAEYPWVSPVARPRIDCSPEPPMSEAFNPDYLRQHLRPLAAAEADAAVLAYQAYYGLDLRSRHPRLQARLGSMAVDGRRLAVQAWLLPEARGSLLLMHGYYDHMGLYRHVVDWALGMGFSVLACDLPGHGLSEGERASIRDFAEYQAVFKGLLGQAAELDLAAPWHLCGQSTGGAILLDYLLHGGERPELGETILLAPLVRPRAWGWSKLSYRLLSPFVDSIPRRFSENSSDPQFLDFLREHDPLQPRTLPTAWVGALTRWVPRIERAPRRALSPLVVQGESDETVDWRHGLKVLREKFDEPRILLLEEARHHLANESEGLRRRYFDFLSDALGA
>NZ_CP017149.1|WP_003084320.1|349611_350364_-|hypothetical-protein
MRALLAFALLLVGLPALADPYQRLYQAAGWPDQRAHFSDALDAAQKRYQDKLPPALYQTLVDNSNRRFAPAEVDQRALNGLRENLPDSASPLNFFESPLGRKVVAAEVLATRRDQLLQHSNGLPRQTASEPRRALVKRLAQVLPAREAGAEVSLALAGVAADSLSQMLPGLPGLLGGGQTGQLLEGQRQRLVQQIGADLENTLLYVYRDLSDAELTQYVNFAESPAGRSYYQAALAALKAGLAVDQAVAP
>NZ_CP017149.1|WP_003118764.1|350412_351111_+|hypothetical-protein
MGRYCRHAADRLSRHRGGTLQWTMHINVNHPLLHRIVDELVDQGWSHQSIFMPERLTTRLAEECRTRAVAGDLTPAAIGRGDGQVIREGIRGDLTQWLEPGESEACDEYLGVMDSLRQALNASLFLGLEDFECHFALYPPGAYYQKHVDRFRDDDARTVSAVLYLNDAWLPEHGGALRLHLPQRQVDIQPTGGSLVVFMSAGTEHEVLPASRDRLSLTGWFRRRNESLLQLS
>NZ_CP017149.1|WP_003084327.1|351132_351687_-|hypothetical-protein
MLPTRSLLPFFLAPALLASAASQAAMEALDNDSLSQVTGQAGISLRLDLRAGAARVAWVDDGGSLSLRNLVIDNGCVKAGDCPDGRGGNIPLGAAQLGLSLPIFGVEQPTLALDVTTGSGGGQQLAISLPDLATINDQLIASGLPAQRIRLRVASDLYIGDNSIGRIELRDITDLRGTIKVWGH
>NZ_CP017149.1|WP_003112945.1|351952_352447_+|DUF523-domain-containing-protein
MQKVLVSRCLLGHLVRYDGGSHGPFDLLSRWHAQGRIVALCPEVAGGLPTPRPPAEIPGGQGGEVLDRLNRVFTVDGEDVSEAFLLGAEAAVELVRRHDIRMAVLKARSPSCGNLENYDGRFNGNRVAGEGVTAAALKRMGVLVFNEDELDRAAVCLAGLDAGG
>NZ_CP017149.1|WP_003084339.1|352449_353142_-|amino-acid-ABC-transporter-permease
MNSLQKLLEWLANLVELLGMAWPFLLQGAMYTVLFAAVSMVLGLILGFSVAVVRVTKVPVVSQIAAVYVSAFRGTPLLVQIFVLYYGLPSVGIEFTPVTAGILALTLNVAAYLSESMRGAILGIDKGQWEAGLSVGLTWGQTLWNIITPQALRLAVPSLSNSLISLIKDTSLISVITVTELMLATKEVIAETFQPLPLYLAAAGIYWLLSALFERVQKALENRLTAPLRR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

53638 : 107751

Dishui_lake_phycodnavirus(25.0%)

transposase,plate

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003114586.1\|53638_54340_+\|transposase	transposase	NA	NA	NA	NA
WP_071536118.1\|54606_54843_+	hypothetical protein	NA	NA	NA	NA
WP_071557682.1\|55271_55592_+	hypothetical protein	NA	NA	NA	NA
WP_003114585.1\|55686_55965_+\|transposase	transposase	NA	NA	NA	NA
WP_003114584.1\|56063_56459_+	hypothetical protein	NA	NA	NA	NA
WP_003128157.1\|56729_58112_-	MgtC/SapB family protein	NA	NA	NA	NA
WP_003114583.1\|58303_59677_+	T3SS effector bifunctional cytotoxin exoenzyme T	NA	NA	NA	NA
WP_003111706.1\|60173_60860_+	hypothetical protein	NA	NA	NA	NA
WP_003083569.1\|60890_61244_+	DUF4810 domain-containing protein	NA	NA	NA	NA
WP_003114582.1\|61240_61906_+	DUF799 domain-containing protein	NA	NA	NA	NA
WP_003083575.1\|61920_62304_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003114581.1\|62585_64247_-	hypothetical protein	NA	NA	NA	NA
WP_003083582.1\|64856_64997_+	hypothetical protein	NA	NA	NA	NA
WP_003114665.1\|65820_67653_+	asparagine synthase (glutamine-hydrolyzing)	A0A2K9R7N5	Dishui_lake_phycodnavirus	2.7e-17	28.3
WP_003083588.1\|67705_68134_-	cupin domain-containing protein	NA	NA	NA	NA
WP_003111523.1\|69060_69609_-	RNA 2'-phosphotransferase	A0A2R2ZGT8	Clostridioides_phage	6.1e-34	41.6
WP_003083593.1\|69647_70154_-	DUF1993 family protein	NA	NA	NA	NA
WP_003083596.1\|70219_71140_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003083599.1\|71247_72135_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_003114663.1\|72197_72902_+	DsbA family protein	NA	NA	NA	NA
WP_003118563.1\|72985_73441_+	OsmC family protein	NA	NA	NA	NA
WP_003114662.1\|73551_73785_+	DUF1161 domain-containing protein	NA	NA	NA	NA
WP_003083612.1\|73796_74234_-	hypothetical protein	NA	NA	NA	NA
WP_003083614.1\|74290_74707_-	hypothetical protein	NA	NA	NA	NA
WP_003118564.1\|74798_75926_+	hypothetical protein	NA	NA	NA	NA
WP_003114660.1\|75933_76917_-	hypothetical protein	NA	NA	NA	NA
WP_003114659.1\|76949_77615_-	5'-nucleotidase	NA	NA	NA	NA
WP_003083618.1\|77607_78150_-	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_003114658.1\|78227_80273_+	oligopeptidase A	NA	NA	NA	NA
WP_003083624.1\|80269_80545_+	YheV family putative metal-binding protein	NA	NA	NA	NA
WP_003083628.1\|80633_81692_+	PA0069 family radical SAM protein	NA	NA	NA	NA
WP_003106614.1\|81921_82836_-	hypothetical protein	NA	NA	NA	NA
WP_003106615.1\|82897_84610_-	SUMF1/EgtB/PvdO family nonheme iron enzyme	NA	NA	NA	NA
WP_003083634.1\|84602_85802_-	ABC transporter permease	NA	NA	NA	NA
WP_003114657.1\|85801_86521_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.1e-18	36.3
WP_003147051.1\|86517_89616_-	protein kinase	M1PCM5	Moumouvirus	2.5e-23	27.8
WP_003106965.1\|89623_90352_-	serine/threonine-protein phosphatase	NA	NA	NA	NA
WP_003106966.1\|90361_91042_-	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_003106968.1\|91038_94569_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_003115051.1\|94565_95915_-	DotU family type VI secretion system protein	NA	NA	NA	NA
WP_003115052.1\|95921_97256_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_003083660.1\|97271_97736_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_003115054.1\|99646_100681_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_003083666.1\|100769_101288_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_003111626.1\|101300_102797_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_003083670.1\|102872_103361_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_003119488.1\|103528_104374_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_003104971.1\|104375_104885_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_003115055.1\|104881_106741_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_003104969.1\|106704_107751_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA

DBSCAN-SWA_2

638836 : 705488

Pseudomonas_phage(42.11%)

tail,tRNA,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003109020.1\|638836_639862_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	3.7e-109	58.1
WP_003085061.1\|639940_640510_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_003099587.1\|640593_640947_+	dihydroneopterin aldolase	NA	NA	NA	NA
WP_003085067.1\|640937_641480_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_003113214.1\|641452_642685_-	multifunctional CCA addition/repair protein	A0A076G5T8	Escherichia_phage	3.5e-77	43.1
WP_003085071.1\|642728_643235_-	DUF4136 domain-containing protein	NA	NA	NA	NA
WP_003099581.1\|643328_644882_-	SpoVR family protein	NA	NA	NA	NA
WP_003099579.1\|644878_646150_-	YeaH/YhbH family protein	A0A140HLI1	Bacillus_phage	4.2e-09	37.2
WP_003085078.1\|646250_648173_-	PrkA family serine protein kinase	NA	NA	NA	NA
WP_003085081.1\|648451_648784_-	thiosulfate sulfurtransferase GlpE	NA	NA	NA	NA
WP_003113213.1\|648827_649679_-	symmetrical bis(5'-nucleosyl)-tetraphosphatase	A0A2H4J0P0	uncultured_Caudovirales_phage	1.1e-08	33.3
WP_003085085.1\|649678_650059_-	Co2+/Mg2+ efflux protein ApaG	NA	NA	NA	NA
WP_003113212.1\|650095_650902_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_003109023.1\|651017_652004_-	4-hydroxythreonine-4-phosphate dehydrogenase PdxA	NA	NA	NA	NA
WP_003115345.1\|652000_653293_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_003113209.1\|653273_656048_-	LPS-assembly protein LptD	NA	NA	NA	NA
WP_003113208.1\|656174_657191_+	phosphotransferase	NA	NA	NA	NA
WP_003099549.1\|657187_657862_+	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_003099547.1\|657863_658622_+	DnaJ domain-containing protein	NA	NA	NA	NA
WP_003099546.1\|658622_659684_-	DUF3530 family protein	NA	NA	NA	NA
WP_003113207.1\|659835_662229_+	PAS domain S-box protein	NA	NA	NA	NA
WP_003085103.1\|662274_662907_+	response regulator transcription factor	NA	NA	NA	NA
WP_003085106.1\|663035_664070_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_003085109.1\|664303_665413_+	polyamine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.8e-28	34.4
WP_003099539.1\|665468_666515_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003113206.1\|666629_667877_+	ABC transporter permease	NA	NA	NA	NA
WP_003099535.1\|667982_668813_+	ABC transporter permease	NA	NA	NA	NA
WP_003085122.1\|668936_669611_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_003113205.1\|669610_670429_+	phosphoglycolate phosphatase	NA	NA	NA	NA
WP_003113204.1\|670501_671980_+	anthranilate synthase component I	NA	NA	NA	NA
WP_003113203.1\|672298_672613_-	transcription regulatory protein PrtN	NA	NA	NA	NA
WP_003113202.1\|672712_673483_-	helix-turn-helix transcriptional regulator	A0A1B0Z078	Pseudomonas_phage	1.4e-71	59.1
WP_003085132.1\|673940_674141_+	repressor PtrB	W6ATC1	Enterobacter_phage	3.7e-05	58.3
WP_003113201.1\|674188_674548_+	hypothetical protein	NA	NA	NA	NA
WP_003118908.1\|674911_675361_+	hypothetical protein	B5TK61	Pseudomonas_phage	5.0e-26	53.3
WP_003113200.1\|675382_675898_+	hypothetical protein	A0A2H4J881	uncultured_Caudovirales_phage	4.1e-32	42.9
WP_003085141.1\|675894_676452_+\|plate	phage baseplate assembly protein V	A0A2H4JG06	uncultured_Caudovirales_phage	4.6e-45	71.1
WP_003113199.1\|676604_676931_+	bacteriophage protein	A0A2H4JA09	uncultured_Caudovirales_phage	2.4e-30	60.2
WP_003085151.1\|676927_677815_+	bacteriophage protein	S4TNY7	Salmonella_phage	5.3e-88	59.8
WP_010895511.1\|677807_678341_+\|tail	phage tail protein I	Q9ZXK7	Pseudomonas_virus	3.0e-62	64.6
WP_003113198.1\|678342_680418_+	bacteriophage protein	Q9ZXK6	Pseudomonas_virus	5.1e-198	50.2
WP_010895512.1\|680414_680873_+	hypothetical protein	NA	NA	NA	NA
WP_003113197.1\|680915_682076_+\|tail	phage tail sheath family protein	Q38068	Phage_PS17	2.0e-188	83.2
WP_003085175.1\|682088_682592_+\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	8.0e-65	73.5
WP_003085178.1\|682606_682951_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_003113195.1\|683120_685358_+	hypothetical protein	NA	NA	NA	NA
WP_003113194.1\|685367_686240_+	hypothetical protein	A0A2H4J875	uncultured_Caudovirales_phage	2.5e-74	51.4
WP_003101635.1\|686214_686421_+	hypothetical protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	2.3e-18	64.2
WP_003113193.1\|686478_687468_+	phage late control D family protein	A0A2H4JBF6	uncultured_Caudovirales_phage	7.5e-107	55.8
WP_003113192.1\|687500_688130_+	glycoside hydrolase family 19 protein	A0A125RNP1	Pseudomonas_phage	1.6e-86	78.0
WP_003118918.1\|688126_688489_+	hypothetical protein	H2BDA0	Pseudomonas_phage	1.9e-15	47.9
WP_003118919.1\|688485_688743_+	hypothetical protein	A0A125RNP3	Pseudomonas_phage	8.3e-18	64.6
WP_003113190.1\|689058_689553_+	hypothetical protein	A0A286S1Q8	Klebsiella_phage	1.4e-45	56.5
WP_003113189.1\|689564_689912_+	hypothetical protein	NA	NA	NA	NA
WP_003113188.1\|689941_690196_+	hypothetical protein	A0A2H4PI34	Pseudomonas_phage	6.3e-10	38.4
WP_069591893.1\|690242_692078_+\|tail	phage tail tape measure protein	A0A0S2SYD9	Pseudomonas_phage	1.2e-28	36.2
WP_003113186.1\|692070_692412_+\|tail	phage tail protein	Q6UAW6	Klebsiella_phage	1.4e-17	40.0
WP_003113185.1\|692419_693115_+\|tail	phage minor tail protein L	A0A1B0VNE0	Pseudomonas_phage	9.7e-69	49.8
WP_003113184.1\|693117_693888_+	hypothetical protein	A0A2D1GNP8	Pseudomonas_phage	4.2e-81	55.6
WP_003113183.1\|693942_694545_+\|tail	tail assembly protein	A0A1V0E8A0	Vibrio_phage	2.2e-53	57.8
WP_003113182.1\|694603_698218_+\|tail	phage tail protein	A0A0S2SYC5	Pseudomonas_phage	0.0e+00	54.7
WP_003118927.1\|698453_699242_+	hypothetical protein	NA	NA	NA	NA
WP_003115342.1\|699265_700357_+	hypothetical protein	A0A0S2SY45	Pseudomonas_phage	1.3e-46	36.9
WP_003113180.1\|700356_700692_+	hypothetical protein	NA	NA	NA	NA
WP_010895513.1\|700672_700903_+	hypothetical protein	A0A1W6JT87	Pseudomonas_phage	3.3e-18	62.7
WP_003113178.1\|700998_702051_+	hypothetical protein	A0A0H5AXZ9	Pseudomonas_phage	4.6e-62	52.2
WP_003113177.1\|702050_702353_+	hypothetical protein	A0A0H5B141	Pseudomonas_phage	4.4e-34	71.0
WP_003113176.1\|702349_702580_+	hypothetical protein	C8ZKF3	Pseudomonas_phage	8.2e-25	71.6
WP_003113175.1\|702998_703604_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	4.6e-75	66.3
WP_003085203.1\|703605_704655_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.8e-111	57.8
WP_003113174.1\|704651_705488_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	2.1e-70	56.9

DBSCAN-SWA_3

1454761 : 1463790

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003098558.1\|1454761_1455397_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.0e-40	52.3
WP_003115226.1\|1455442_1456336_+	peptidoglycan DD-metalloendopeptidase family protein	A0A0S2SXL7	Bacillus_phage	3.0e-06	34.3
WP_003113871.1\|1456440_1457445_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	7.0e-36	37.3
WP_003092272.1\|1457871_1458195_-	Ferredoxin 1	NA	NA	NA	NA
WP_003113873.1\|1458261_1460829_-	DNA mismatch repair protein MutS	A0A1V0SGG8	Hokovirus	3.2e-24	22.1
WP_003113874.1\|1460954_1461962_-	TolB family protein	NA	NA	NA	NA
WP_003092262.1\|1462109_1462616_+	CinA family protein	B5TK85	Pseudomonas_phage	8.1e-57	76.0
WP_003092260.1\|1462749_1463790_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	1.5e-113	59.5

DBSCAN-SWA_4

2560656 : 2567550

uncultured_Caudovirales_phage(83.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003097631.1\|2560656_2561937_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	8.2e-98	45.4
WP_003113366.1\|2561938_2563336_+	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_003097628.1\|2563340_2564315_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_003108776.1\|2564402_2565386_-	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	9.3e-142	74.3
WP_003119979.1\|2565382_2565718_-	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	1.5e-38	69.4
WP_003090391.1\|2565714_2566020_-	sulfurtransferase complex subunit TusB	NA	NA	NA	NA
WP_003090389.1\|2566019_2566379_-	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	1.4e-34	61.7
WP_003090387.1\|2566375_2566771_-	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	2.7e-47	72.1
WP_003090386.1\|2566881_2567550_-	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	1.5e-90	82.1

DBSCAN-SWA_5

4718579 : 4725996

Pseudomonas_phage(100.0%)

integrase,coat

attL 4717609:4717635|attR 4729991:4730017

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4717609:4717635	attL	NA	NA	NA	NA
WP_003114154.1\|4718579_4719563_-\|integrase	bacteriophage integrase	Q56VN7	Pseudomonas_phage	4.7e-93	52.6
WP_003115206.1\|4719562_4720855_-	hypothetical protein	Q56VN8	Pseudomonas_phage	2.8e-247	94.2
WP_010895520.1\|4721084_4722359_-	hypothetical protein	Q56VN9	Pseudomonas_phage	2.1e-202	88.7
WP_003114150.1\|4722362_4722719_-	DUF2523 domain-containing protein	Q56VP0	Pseudomonas_phage	7.9e-59	100.0
WP_010895519.1\|4722723_4723986_-\|coat	phage coat protein A	Q56VP1	Pseudomonas_phage	6.7e-52	56.0
WP_003125072.1\|4724121_4724370_-\|coat	phage coat protein B	Q56VP2	Pseudomonas_phage	2.0e-32	92.7
WP_003115979.1\|4724382_4724634_-	hypothetical protein	NA	NA	NA	NA
WP_003115130.1\|4724646_4724739_-	hypothetical protein	Q56VP4	Pseudomonas_phage	7.3e-09	100.0
WP_003115132.1\|4724755_4725190_-	phage destabilizing protein	Q56VP5	Pseudomonas_phage	5.1e-60	86.1
WP_010895518.1\|4725324_4725702_-	hypothetical protein	Q56VP6	Pseudomonas_phage	9.9e-60	97.6
WP_010895517.1\|4725705_4725996_-	hypothetical protein	Q56VP7	Pseudomonas_phage	7.4e-55	96.9
4729991:4730017	attR	NA	NA	NA	NA

DBSCAN-SWA_6

5214589 : 5252388

Pseudomonas_phage(57.14%)

integrase,coat,tRNA

attL 5241557:5241616|attR 5253626:5253707

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003099340.1\|5214589_5215138_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_003146046.1\|5215168_5215702_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_003099337.1\|5215701_5216244_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_003114703.1\|5216262_5217051_+	molecular chaperone	NA	NA	NA	NA
WP_003114701.1\|5217067_5219440_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_003099330.1\|5219436_5220384_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_003099328.1\|5220385_5221759_-	MFS transporter	NA	NA	NA	NA
WP_003099324.1\|5222038_5223061_-	ferrochelatase	NA	NA	NA	NA
WP_003114699.1\|5223057_5223975_-	TIGR01777 family protein	NA	NA	NA	NA
WP_003114698.1\|5224388_5225372_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003099314.1\|5225524_5226481_+	DUF523 and DUF1722 domain-containing protein	NA	NA	NA	NA
WP_003094990.1\|5226490_5227390_+	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	8.5e-17	39.1
WP_003114697.1\|5227386_5228832_+	deoxyribodipyrimidine photo-lyase	A0A167RC11	Powai_lake_megavirus	3.1e-45	27.8
WP_003099307.1\|5228957_5229479_-	acyloxyacyl hydrolase	A0A2H4J0I5	uncultured_Caudovirales_phage	1.4e-59	69.8
WP_003099300.1\|5229612_5230410_-	glutamate racemase	NA	NA	NA	NA
WP_003114696.1\|5230399_5231158_-	molybdopterin-synthase adenylyltransferase MoeB	NA	NA	NA	NA
WP_003114694.1\|5231151_5231982_-	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_003114692.1\|5231983_5233066_-	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	5.6e-07	48.3
WP_003095001.1\|5233083_5234352_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_004352693.1\|5234495_5236268_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_003095005.1\|5236272_5236890_+	lipoprotein localization protein LolB	NA	NA	NA	NA
WP_003099284.1\|5236891_5237740_+	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_003099281.1\|5237906_5238848_+	ribose-phosphate pyrophosphokinase	A0A1V0SHF7	Hokovirus	4.1e-46	35.4
WP_003099279.1\|5238964_5239579_+	50S ribosomal protein L25/general stress protein Ctc	NA	NA	NA	NA
WP_003099278.1\|5239620_5240205_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_003099270.1\|5240245_5241346_+	redox-regulated ATPase YchF	NA	NA	NA	NA
5241557:5241616	attL	NA	NA	NA	NA
WP_003114691.1\|5241798_5242800_-\|integrase	tyrosine-type recombinase/integrase	F1BUS9	Erwinia_phage	7.6e-75	46.8
WP_004352686.1\|5242796_5244089_-	hypothetical protein	Q56VN8	Pseudomonas_phage	1.8e-241	92.3
WP_003114151.1\|5244318_5245593_-	hypothetical protein	Q56VN9	Pseudomonas_phage	2.8e-199	87.1
WP_003114150.1\|5245596_5245953_-	DUF2523 domain-containing protein	Q56VP0	Pseudomonas_phage	7.9e-59	100.0
WP_003125072.1\|5247351_5247600_-\|coat	phage coat protein B	Q56VP2	Pseudomonas_phage	2.0e-32	92.7
WP_003115979.1\|5247612_5247864_-	hypothetical protein	NA	NA	NA	NA
WP_003115096.1\|5247876_5247969_-	hypothetical protein	Q56VP4	Pseudomonas_phage	1.6e-08	96.7
WP_003115097.1\|5247985_5248420_-	hypothetical protein	Q56VP5	Pseudomonas_phage	1.2e-61	98.6
WP_033992920.1\|5248934_5249225_-	hypothetical protein	Q56VP7	Pseudomonas_phage	8.7e-56	97.9
WP_003115921.1\|5249436_5249709_-	hypothetical protein	NA	NA	NA	NA
WP_003113530.1\|5250244_5251336_+	serine/threonine-protein phosphatase	NA	NA	NA	NA
WP_003113529.1\|5251338_5252388_+	serine/threonine protein kinase	G9BWE0	Planktothrix_phage	1.0e-61	50.0
5253626:5253707	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage