CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP017150	Brevibacterium aurantiacum strain SMQ-1335 chromosome, complete genome	1 crisprs	casR,WYL,RT,csa3,cas3,DEDDh,cas4,DinG	0	0	10	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP017150_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017150_1

230778-230884

Orphan

Consensus_repeat	Method
CCCTGGCCGCCTTCGCTGCGCTCGTTGTCGCC	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP017150_1

>merge|NZ_CP017150|1|230778-230884|CRISPRCasFinder
CCCTGGCCGCCTTCGCTGCGCTCGTTGTCGCCGCCGAAGCCGCCCTGTTCCTGGCCACCCTGGGACTGCTGTCCGCCCTGGCCGCCTTCGTTGCGCTCGTTGTCGCC

>NZ_CP017150|1|1|230778-230884|CRISPRCasFinder
CCCTGGCCGCCTTCGCTGCGCTCGTTGTCGCC	GCCGAAGCCGCCCTGTTCCTGGCCACCCTGGGACTGCTGTCCG
CCCTGGCCGCCTTCGTTGCGCTCGTTGTCGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017150.1\|WP_069601225.1\|227072_228521_+\|amino-acid-permease	unknown	unknown	gnl\|CDD\|129987
NZ_CP017150.1\|WP_069599220.1\|224231_224705_-\|RidA-family-protein	unknown	unknown	gnl\|CDD\|100006
NZ_CP017150.1\|WP_069599231.1\|240084_240414_-\|antibiotic-biosynthesis-monooxygenase	unknown	unknown	gnl\|CDD\|224278
NZ_CP017150.1\|WP_096145750.1\|240444_241446_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP017150.1\|WP_069601224.1\|225902_226364_-\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176868
NZ_CP017150.1\|WP_069599221.1\|224701_225826_-\|PLP-dependent-cysteine-synthase-family-protein	unknown	unknown	gnl\|CDD\|223110
NZ_CP017150.1\|WP_069599224.1\|229715_230567_+\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223257
NZ_CP017150.1\|WP_069601223.1\|221697_223503_+\|transferase	unknown	unknown	gnl\|CDD\|366419
NZ_CP017150.1\|WP_069599227.1\|234068_235328_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110
NZ_CP017150.1\|WP_069599226.1\|231623_232871_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110
NZ_CP017150.1\|WP_069599229.1\|238587_239343_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|224332
NZ_CP017150.1\|WP_009882120.1\|233155_234076_+\|hydroxymethylglutaryl-CoA-lyase	unknown	unknown	gnl\|CDD\|163676
NZ_CP017150.1\|WP_069599223.1\|228517_229432_+\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NZ_CP017150.1\|WP_069599230.1\|239431_239983_+\|deaminase	unknown	unknown	gnl\|CDD\|223340
NZ_CP017150.1\|WP_069599228.1\|236494_237067_+\|tripartite-tricarboxylate-transporter-TctB-family-protein	unknown	unknown	gnl\|CDD\|377815
NZ_CP017150.1\|WP_083248611.1\|235436_236498_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|225722
NZ_CP017150.1\|WP_069599219.1\|223499_224183_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP017150.1\|WP_069599222.1\|226398_226755_-\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP017150.1\|WP_009882125.1\|237076_238591_+\|tripartite-tricarboxylate-transporter-TctA	unknown	unknown	gnl\|CDD\|225870
NZ_CP017150.1\|WP_069599218.1\|220855_221551_-\|DUF1275-domain-containing-protein	unknown	unknown	gnl\|CDD\|377734

Protein	Function_ID	Function_description	E-value
NZ_CP017150.1\|WP_069601225.1\|227072_228521_+\|amino-acid-permease	gnl\|CDD\|129987	TIGR00909, putative_amino_acid_transporter, amino acid transporter. [Transport and binding proteins, Amino acids, peptides and amines].	5.96806e-128
NZ_CP017150.1\|WP_069599220.1\|224231_224705_-\|RidA-family-protein	gnl\|CDD\|100006	cd02199, YjgF_YER057c_UK114_like_1, This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.	6.00067e-75
NZ_CP017150.1\|WP_069599231.1\|240084_240414_-\|antibiotic-biosynthesis-monooxygenase	gnl\|CDD\|224278	COG1359, COG1359, Uncharacterized conserved protein [Function unknown].	8.28684e-24
NZ_CP017150.1\|WP_096145750.1\|240444_241446_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	4.64427e-17
NZ_CP017150.1\|WP_069601224.1\|225902_226364_-\|SRPBCC-family-protein	gnl\|CDD\|176868	cd07826, SRPBCC_CalC_Aha1-like_9, Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins. SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of a functionally uncharacterized subgroup of CalC- and Aha1-like proteins. This group shows similarity to the SRPBCC domains of Micromonospora echinospora CalC (a protein which confers resistance to enediynes) and human Aha1 (one of several co-chaperones which regulate the dimeric chaperone Hsp90), and belongs to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands.	4.70959e-59
NZ_CP017150.1\|WP_069599221.1\|224701_225826_-\|PLP-dependent-cysteine-synthase-family-protein	gnl\|CDD\|223110	COG0031, CysK, Cysteine synthase [Amino acid transport and metabolism].	1.02282e-85
NZ_CP017150.1\|WP_069599224.1\|229715_230567_+\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|223257	COG0179, MhpD, 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism].	1.47395e-80
NZ_CP017150.1\|WP_069601223.1\|221697_223503_+\|transferase	gnl\|CDD\|366419	pfam01019, G_glu_transpept, Gamma-glutamyltranspeptidase.	3.26656e-127
NZ_CP017150.1\|WP_069599227.1\|234068_235328_+\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	1.15018e-123
NZ_CP017150.1\|WP_069599226.1\|231623_232871_+\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	1.67711e-129
NZ_CP017150.1\|WP_069599229.1\|238587_239343_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	3.00352e-20
NZ_CP017150.1\|WP_009882120.1\|233155_234076_+\|hydroxymethylglutaryl-CoA-lyase	gnl\|CDD\|163676	cd07938, DRE_TIM_HMGL, 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain. 3-hydroxy-3-methylglutaryl-CoA lyase (HMGL) catalyzes the cleavage of HMG-CoA to acetyl-CoA and acetoacetate, one of the terminal steps in ketone body generation and leucine degradation, and is a key enzyme in the pathway that supplies metabolic fuel to extrahepatic tissues. Mutations in HMGL cause a human autosomal recessive disorder called primary metabolic aciduria that affects ketogenesis and leucine catabolism and can be fatal due to an inability to tolerate hypoglycemia. HMGL has a TIM barrel domain with a catalytic center containing a divalent cation-binding site formed by a cluster of invariant residues that cap the core of the barrel. The cleavage of HMG-CoA requires the presence of a divalent cation like Mg2+ or Mn2+, and the reaction is thought to involve general acid/base catalysis. This family belongs to the DRE-TIM metallolyase superfamily. DRE-TIM metallolyases include 2-isopropylmalate synthase (IPMS), alpha-isopropylmalate synthase (LeuA), 3-hydroxy-3-methylglutaryl-CoA lyase, homocitrate synthase, citramalate synthase, 4-hydroxy-2-oxovalerate aldolase, re-citrate synthase, transcarboxylase 5S, pyruvate carboxylase, AksA, and FrbC. These members all share a conserved triose-phosphate isomerase (TIM) barrel domain consisting of a core beta(8)-alpha(8) motif with the eight parallel beta strands forming an enclosed barrel surrounded by eight alpha helices. The domain has a catalytic center containing a divalent cation-binding site formed by a cluster of invariant residues that cap the core of the barrel. In addition, the catalytic site includes three invariant residues - an aspartate (D), an arginine (R), and a glutamate (E) - which is the basis for the domain name "DRE-TIM".	4.17289e-124
NZ_CP017150.1\|WP_069599223.1\|228517_229432_+\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	1.38716e-10
NZ_CP017150.1\|WP_069599230.1\|239431_239983_+\|deaminase	gnl\|CDD\|223340	COG0262, FolA, Dihydrofolate reductase [Coenzyme metabolism].	2.79371e-16
NZ_CP017150.1\|WP_069599228.1\|236494_237067_+\|tripartite-tricarboxylate-transporter-TctB-family-protein	gnl\|CDD\|377815	pfam07331, TctB, Tripartite tricarboxylate transporter TctB family. This family consists of several hypothetical bacterial proteins of around 150 residues in length. This family was formerly known as DUF1468.	7.30564e-06
NZ_CP017150.1\|WP_083248611.1\|235436_236498_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|225722	COG3181, COG3181, Uncharacterized protein conserved in bacteria [Function unknown].	1.17541e-67
NZ_CP017150.1\|WP_069599219.1\|223499_224183_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	3.3197e-45
NZ_CP017150.1\|WP_069599222.1\|226398_226755_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	3.45959e-15
NZ_CP017150.1\|WP_009882125.1\|237076_238591_+\|tripartite-tricarboxylate-transporter-TctA	gnl\|CDD\|225870	COG3333, COG3333, Uncharacterized protein conserved in bacteria [Function unknown].	0
NZ_CP017150.1\|WP_069599218.1\|220855_221551_-\|DUF1275-domain-containing-protein	gnl\|CDD\|377734	pfam06912, DUF1275, Protein of unknown function (DUF1275). This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown although most members have 6 TM regions, and may be putative permeases.	1.09574e-28

>NZ_CP017150.1|WP_069599224.1|229715_230567_+|fumarylacetoacetate-hydrolase-family-protein
MELLRLGPIGHEIPVVRDNDVYYDLRPLTTDITPEFFADDGIGRVRTALDEGSLVPLEGAEDLRIGAPVARPSAVVCVGMNYAAHAREAGAEPPAAPVVFFKMPSTIAGPYDALELPPYATKADWEVELGLVIGSRAFRVASAEDAYSHVAGYMLANDLSERRFQIEESGGQWSKGKNLPGFTPLGPWIRPAAEVDPGSLRLRSWVNGDVRQDSSTRDLIFDVGQIIYLLSQTMPFEPGDVILTGTPQGVAMSGKFPYLAADDVVEMEIESLGRHRQAVTVTQ
>NZ_CP017150.1|WP_069599223.1|228517_229432_+|universal-stress-protein
MSIVVGIAPGQDNRPAVELGIVLARSYGHRLVAVAIDSAAWPMSPALFESEYQKKLRNVAEAALDEVRTLLPDDIESECLVHSARSSRRGLLEMCQKENAFRLVVGPAADGKPGRIALGSVSTGLLHSASLPVALAPVGYRVAPEARLRRLTAAYSGSSTSADLILGAAVVSAESGVPFRIASFAPRSRVISAAGVGLDVESSVIDEWANVIRRDTDEILCSIDRLQIKPGETDVAIGTGPDWESALSAVQWEDPEIMMLGSSGLGALKRVSLGSHAMRILQHSPVPIVVVPRRAKSDYTSAAV
>NZ_CP017150.1|WP_069601225.1|227072_228521_+|amino-acid-permease
MPTLRQQLFRVKPVPQQGESPESDLKRTIGLFSLTMIGVGSTIGTGIFFILSESVPVAGPAVIWSFVIAGLVAGLAVICYAELAGSVPVSGSSYSYAYATLGELPAMGVAACLLLEYGVAGAAVAVGWSQYVNQLLFNLFGFEIPHALAYAPEEGGIVNLPAILLLAMCCFLLVRGTGESVVINTVMVCTKIGVLLFFVCVGVTGWNVDNFADFAPFGFSGVVAGSGLIFFSYVGMDAVATAGDETKNPKKTMPRALIAALIIVTTVYVLVAVAALSAQPWQEFEGQTAGLSAILENIVGAQWPGTIVAAGAVISIFSVTLVSIYGQTRILFTMSRDGMMPKLFGEVNPRTLTPVKGTIVVTVVIAILAGFIPLNFLAEMTSIGTLVAFVVVSLAVIILRVREPNLERGFKVPLYPVLPVLAIIGCLWIISNLQIITIVVFLIWTAVILGLYFIFGRKSSVLGKQRAEQERIGGTDPAGGKQ
>NZ_CP017150.1|WP_069599222.1|226398_226755_-|winged-helix-turn-helix-transcriptional-regulator
MADQLTKVFAALADPTRRDIVARLSLADATVNELAEPYEVSVQAVSKHLKVLEDSGLVTRTRDAQRRPVHLEDNVFDLMTKWIERYQRQAEERYQRLDAVLDEMNADEDTEEESIKGA
>NZ_CP017150.1|WP_069601224.1|225902_226364_-|SRPBCC-family-protein
MQLDVPEGTQTVSITRDFAATPDKVFRAHTDPELFVKWCGPDSITNTIREWDAQTGGKWSYVSTDDNGEYGFFGSFHEVRENERIVQTFTFEGFPDAVNLEILTLTDLGDGRTRLQSTSVFDSLESRDGMVASGMEHGIREGYDKLEKMLAEG
>NZ_CP017150.1|WP_069599221.1|224701_225826_-|PLP-dependent-cysteine-synthase-family-protein
MTDSHDHTSVPAEDDIDRYDPQARQWLAGAIRAVKSDANRSSDTHLLHVPLPSDWGIDLYLKDESSHPTGSLKHRLARSLFLHALCNGWIRPGRPVVEASSGSTAVSEAYFAQLIGVPFIAVMARSTSAQKISLIEFYGGTCHFVDNANEVYEVAADLAAESGGHYMDQFTYAERATDWRGNNNIAESIFDQMSSETHPEPSWIIATAGTGGTSATLARYVRYTGRATGICVADPDNSAFFAGWRDHDPAATTDQGSRIEGIGRQRVEASFIASSIDRMMHVPDAAAIASIQLLETLMGRRAGASTGTGLWAAFRIVSQMKAAGQTGSLVSLICDPGERYLDKYYSSQWLTEAEIDATGYRERLDEFMTTGVLK
>NZ_CP017150.1|WP_069599220.1|224231_224705_-|RidA-family-protein
MISESTITPEARLEERGLAIPEVAAPVAAYIPAVRTGQYIYTSGQLPVQGGQPIHTGKVGAEVTLEQAQAAARQCTLNALAAIRAITGGLSAIKRIVKVTGFVASAPDFTAQPQVINGASELLGEVFGDAGIHARSAVGVAVLPLDVPVEIEMIVEV
>NZ_CP017150.1|WP_069599219.1|223499_224183_+|GntR-family-transcriptional-regulator
MTNQTSNSIAVGAKIRHDIIKGVHPPGGKLREAALAKQYDVSRIPIREALRSLESEGLVESRPYSGSMVAPSPVEDAEDLFEIRIVLESATAKRAAKRAAQQSNGEVPDERWRTIRKEINEILDAGDIVIGEERYDDLAVLNMRFHFAIAELSGSLSFVSLLRQISGKIEWLYSLNVTRRGPQAWPEHRDIIAAIDAGQETKAAEVMGQHVRRSRDSYFTMMAERPS
>NZ_CP017150.1|WP_069601223.1|221697_223503_+|transferase
MPFVPPAAFTTRPTLEGHFGMATSTHWLATAASQAVLERGGNAFDAAVAGAFLLHVVEPHLNGPGGDMTGVFATAEDPANPQIMMGQGPAPAAATIDHYRGEGLDMVPGAGALAAAVPGAVDAWLNLLEHHGTWELADVLDFAIDYAENGHPVLGRVVGTIERVQELFTEHWPTSAAQWMPEGQIPKTGDLVFNRPYVEVLRRLISAGEEAEGRAARVAAARQEWKSGFVAEAVAEFISTPHRHSTGGDHAGVMTAEDFAGFDAHFEDPVTIDFHGYSIAKIGAWGQGPVLLQTLKILDGFDDERLDPSTEIGAHTILEALKLAMADRDTYYGDADVDLDWLLSDDYAASRRELITEEASLEFRPGADRTGAVPTFTPPLMLEGADKDAMAKAGIGEPTVQKNGVNNGDTCHIDVVDRWGNIISATPSGGWLQSSPVIPELGFCLGTRLQMMWLDETAPSALTPGKRPRTTLTPTLISKNGQPVIALGSPGGDQQEQWQLLLILRMLIGGYAPQQAIDAPALHTTALAGSFWPRTWVPGGAVVEDRLGEDVINGLIARGHVVTKAGDWELGRLSCVTRDPATGRVTAGANPRGAQGYAAGR
>NZ_CP017150.1|WP_069599218.1|220855_221551_-|DUF1275-domain-containing-protein
MTRRLDLAMLLVLTFSTGMVDAIGYLGFDKVFTGNMTGNVVILGMGLAGAEDTPVLRPALALVFFMVGAALGGRILGRIGEEWHMRTTIIFAGVAIGCAGLAVYVALVPNPELGLAGTIFTSVLSALMGAQAAAARRMKIADVTTVVVTSTIVGLASDSRLAGGDSVRWIRRALAVLLILIGAIAGAATLMINQWIGIALVAAAIAVVTVIGHRGAKKRALAEATASPVHA
>NZ_CP017150.1|WP_069599226.1|231623_232871_+|CoA-transferase
MTARRLPLSGVRVLELGNYIAAPTTGRMLADFGAEVIKIERPESGDELRNWRLKQGTTSMLYRTINRNKKSVVLDLRSEEGKASALELVRRSDIVLENFRPGTIEKWGLGPEVLEEANPDIILVRISAFGQTGPMSERPGFAAVAEGYSGFRELVGDPDRPPVRVGISIGDSIAGMQAAFGAVMMLFDRQRQKIAGAAEAVVGSDHSFEGRGSLADRTVDVALNEAMFSVMKSLVPDYSAFGETRTRTGGRMEGIAPSNGYLCAGGKSVVIAGNGDGIYKRLMDAVDRPDLGEDPDLQTNAGRWERREELDEAIGAWCAKRDVAEVVETLEAAGVPAGPIYTAEDLVADEQLAARGMIQHLDVSTGEEMLSDVAFPGITPVIGGSSIPIDHLGPDLGEHTDEVLEQLGGKLPERD
>NZ_CP017150.1|WP_009882120.1|233155_234076_+|hydroxymethylglutaryl-CoA-lyase
MVRPTSVTILDTTLRDGLQIEDAIVPTDAKVALGEQLIAAGLKEIEVGSFVNPKKVPQMADTGEVLQRLQSHEAEGVDFFTLVFNLKGAQRAVDAGAKNIKLVLSASEGHSQANSDAPIAQATQRLLEAATFAKDNGVRFDIATAVSFICPFDGITDADHLVEVLRPFVDAGAHGVGVADTIGNANPSLVARNTSAVIEAFPGNPVNLHLHDTYNFGMANVIAALDLGISNFDAAMGGLGGCPFAPGAAGNIGTDDLVHLLHREGVNTGVDVEALSAIREPLTSAVGHELTSSLSSIPAVPAAYHA
>NZ_CP017150.1|WP_069599227.1|234068_235328_+|CoA-transferase
MLEQAESSTVDAQELPLAGIRVIEFSHMVMGPSCGMILADLGAEVIKVEPRGAGDKTRYLPGSGSGLFPAFNRNKQSVQLDIAEAADRDVALSLIDSADVLLENFRVGKMESMGYGYEELAQRNPRLIYCSLKGFLSGPYGQRTALDEVVQMLGGLAYMTGPPGQPLRAGASVNDIMGGMFGVIGVLSALRVRERTGEGQVINSALFENNAFLVGTHMAQAQISGEPLRPMPTRRATWAVYDIFRDKHDDQIFVAAVSDGQWHDLCDEFDLSQLAGDPELETNQGRVDQRDRIHRELQAALSRLDLAEIEEKCTRRGLPVAPVNTPADLTTDAHLVASGALASTGLPSGDQVDVPLLPLTFGGRRLGLRSDVPTPGEHNNRYRDGPADTSAADSDPGQTATTDPFATDTDVEESKTQSQ
>NZ_CP017150.1|WP_083248611.1|235436_236498_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MRSTVITGQGRATSARQKGKALKPAIKVGAVLATLALVATGCGNKAQPPGEGSDYPKGPVTVNVPSEPGSGWDTTARALVEALQKEEIVSTPLPVQNKPGGTGCTWMTSMMQQEKGKDDQIAITSLASQTMKARGLCEFGPEDTTLIATMYVEDFMVVTPDKGDIKSVEDLVKALKKDPQKVTVAASGDDTLPFALFAKEAGVDPADINFVNYEGGGEQTTAMLNGDAKVAIAGLSEFRSVLESGDIKPLVTFAKEPLQAPYDSVPTAADAGYDVTLGNWRGVYGPAEMPQEAVDYWAKTLEEVSETKTWKDTLEKNQWAPEFLTGDEAKKYAEETAATVEEGVKETDLGNSK
>NZ_CP017150.1|WP_069599228.1|236494_237067_+|tripartite-tricarboxylate-transporter-TctB-family-protein
MRTLTPALRGDVITGIAVTLVGAVYYIATFWIQETKNIVTPRTFPAIVGIALIVLGLFLIGQAVYRSRKLAEVVPAGAASASSGASGVASGSGAADSGVEDEPAGVVLDAPEEPKSKQVVLQFALFFIYLGILIPVGFLLSTAAFLMTMTSIYAPHRWIRNLIFSVLFSVIIYVAFVYGLAVYLPVGILG
>NZ_CP017150.1|WP_009882125.1|237076_238591_+|tripartite-tricarboxylate-transporter-TctA
MDTLIDLGGGFASALEPLSLAFALLGVLLGTVVGVLPGIGPISAIAILIPVSFGMEPVHGLILLCGIYYGSMYGGSITATLIKTPGEVASAVTAIEGYEMARRGRGKAALATAALGSFLAGTLAIIGLTFLSPVLVQLANVFGSTEYFLLMATALLLASTMSSGSRAKALISIFIGLAVGLVGLDFQTGLPRQTFGMSLLSDGIDFTIFAMALFAIPEAIRNLALGRGAKDVIQSFGDDTWMTKQDWQRSAMPWARGSVLGFIIGILPGVGPSLASFMSYIMEKRISKRKSEFGKGAIEGVAGPEAANNAGVGGAMIPLFSLGIPGSATTALLLFVFTMYGLQPGPLIFRDESGLIWTIIASMYIGNVALIILNLPLVGVFVKLLKMPKEILFSSILVLVAIGAYAIEFSLFGLMLLGIFGVIGYLMDKGGIPLAPSILALVLVPLLEDNFRRMLQISGGSFMPLLTRPVSLSIIVLMVLGIVGPIIFRWWVRRRQLLADVSVA
>NZ_CP017150.1|WP_069599229.1|238587_239343_+|helix-turn-helix-domain-containing-protein
MKENHMTETTDTSGTSGASASSGGTASAKEIGVIDRSAAILTALQDTPLTAAEVCRRLGYSKSTTYRLLADLRTHRFIVRDNNGLLRLGPFPGRRSIATTNSVLEHLRTLTSESVQLWVRVGEDRVCVRNVEADHELRVSRSVGTVLPLVDGGSGALALCGPGNPQEFYATKQARVKGTASASVAFTVGGAILALCVSYPLTREPDNVAGAYRTVLSQAAVELKALLDDSEELAVLRDIARLALGAKVREG
>NZ_CP017150.1|WP_069599230.1|239431_239983_+|deaminase
MPRTVYYTATTLDGYIADPSDSLEWLLRQPNDESDDNFFAGIGATVMGATTYEWLLRNHDGAWPYSIPTWVMTHRDLPKPSKDEVSEDPDIRFAKGSVADYYVEMCMATGDHDLWIMGGGGVAGQFVDEGLLDEIITWTAPVTLGSGRPLLPRRLDLELLDVDWKGPFVVSRHKVVDALAEDQ
>NZ_CP017150.1|WP_069599231.1|240084_240414_-|antibiotic-biosynthesis-monooxygenase
MIFIVVKFQVKPEKAEEWPQITKEFTEATRAEPGNKWFDWSRSLDDPNEYVLVEAFDDDAAEAHVKSDHFQKATADGGPMNSALASTPRIISRQIDGDSWDEMGELQVG
>NZ_CP017150.1|WP_096145750.1|240444_241446_-|IS481-family-transposase
MPHSNSPLSIEGRRRLVERCRSRPIAHVAAEMGISRACASKWVNRYRRYGELGLCDRPSTPRRQPHATPGNVVVRIEQMRRDHKWSAGRITFELHVEGVPICRRTVSRHLAALGLNRRRFIDPSGDLNREPRKINARWPGHMVHVDVKKVGRIPDGGGWRIHGRGTTQAKKAEQAKRKTKRGGYVYLHSAVDGYSRLAYTEALSDEKAVTAIAFLHRARAWFAAHGITRINRVVTDNGACYRADAFARAMLGSRHQRITPYTPRHNGKVERYNRILAEEFLYAREWTSEDERAAALNVWNIHYNYHRPHGASHGRPPASRLPVGVTNVVASYN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

177246 : 192691

Corynebacterium_phage(100.0%)

protease,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_101547469.1\|177246_178159_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_101556112.1\|178231_179167_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_114355012.1\|179175_179622_+	hypothetical protein	NA	NA	NA	NA
WP_069599196.1\|180020_181598_-\|transposase	IS1634 family transposase	NA	NA	NA	NA
WP_069599197.1\|181651_182152_-	hypothetical protein	NA	NA	NA	NA
WP_069599198.1\|182148_182355_-	hypothetical protein	NA	NA	NA	NA
WP_009882371.1\|182869_184144_-\|transposase	IS256-like element ISBli2 family transposase	A0A220NQR7	Corynebacterium_phage	8.9e-169	70.5
WP_125240290.1\|184273_185098_+	hypothetical protein	NA	NA	NA	NA
WP_069599200.1\|185206_185677_-	hypothetical protein	NA	NA	NA	NA
WP_125240291.1\|185858_186506_+	hypothetical protein	NA	NA	NA	NA
WP_069599202.1\|186771_187308_-	hypothetical protein	NA	NA	NA	NA
WP_085974909.1\|187512_188896_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_069599203.1\|189037_189682_-	hypothetical protein	NA	NA	NA	NA
WP_162619298.1\|189666_190269_-	S8 family serine peptidase	NA	NA	NA	NA
WP_009883781.1\|190397_191144_-	ATP-binding protein	NA	NA	NA	NA
WP_009884100.1\|191140_192691_-\|transposase	IS21 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

541423 : 645273

Shigella_phage(14.29%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_113717709.1\|541423_542335_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_083248635.1\|542462_543887_+	RNA-directed DNA polymerase	NA	NA	NA	NA
WP_147271736.1\|543874_546010_+	RNA-directed DNA polymerase	NA	NA	NA	NA
WP_069599383.1\|547100_548678_-\|transposase	IS1634 family transposase	NA	NA	NA	NA
WP_009883781.1\|548904_549651_-	ATP-binding protein	NA	NA	NA	NA
WP_009884100.1\|549647_551198_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_069599384.1\|551254_552457_+	CHAT domain-containing protein	NA	NA	NA	NA
WP_083248636.1\|553212_553401_-	hypothetical protein	NA	NA	NA	NA
WP_069599388.1\|554085_555171_+	glycosyltransferase	NA	NA	NA	NA
WP_113717711.1\|555167_556307_+	hypothetical protein	NA	NA	NA	NA
WP_113717803.1\|557077_558235_+	glycosyltransferase	NA	NA	NA	NA
WP_113717805.1\|558389_559581_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	6.4e-28	34.1
WP_069599392.1\|560400_561489_-	YbdK family carboxylate-amine ligase	NA	NA	NA	NA
WP_069599393.1\|561888_562068_-	hypothetical protein	NA	NA	NA	NA
WP_069599394.1\|562564_563617_-	iron-containing redox enzyme family protein	NA	NA	NA	NA
WP_069599395.1\|563660_564014_-	hypothetical protein	NA	NA	NA	NA
WP_069599396.1\|564148_565591_-	trehalose-6-phosphate synthase	NA	NA	NA	NA
WP_069599397.1\|565693_565891_-	CsbD family protein	NA	NA	NA	NA
WP_069599398.1\|565952_566225_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_069599399.1\|566273_566585_-	general stress protein	NA	NA	NA	NA
WP_069599400.1\|566847_567513_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_069599401.1\|567556_568645_+	hypothetical protein	NA	NA	NA	NA
WP_083248913.1\|568876_569170_-	DUF3263 domain-containing protein	NA	NA	NA	NA
WP_069599402.1\|569331_569805_+	DUF2505 domain-containing protein	NA	NA	NA	NA
WP_069601250.1\|570769_570985_+	hypothetical protein	NA	NA	NA	NA
WP_069599404.1\|571012_571531_+	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_083248639.1\|572599_573073_+	DUF4383 domain-containing protein	NA	NA	NA	NA
WP_069599234.1\|573257_573818_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_069599233.1\|573906_574368_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_069599406.1\|574452_575454_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_069599407.1\|575644_576631_+	malate dehydrogenase	NA	NA	NA	NA
WP_069599408.1\|576876_577458_-	recombinase family protein	A0A1V0E035	Clostridioides_phage	4.2e-09	26.7
WP_009883781.1\|577981_578728_-	ATP-binding protein	NA	NA	NA	NA
WP_009884100.1\|578724_580275_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_069601251.1\|580443_582018_+\|transposase	IS1634 family transposase	NA	NA	NA	NA
WP_083248641.1\|583145_584213_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_069599409.1\|584699_584882_+	hypothetical protein	NA	NA	NA	NA
WP_035279844.1\|586367_586595_+	hypothetical protein	NA	NA	NA	NA
WP_069599412.1\|587208_587817_-	hypothetical protein	NA	NA	NA	NA
WP_125178126.1\|588622_588925_+	hypothetical protein	NA	NA	NA	NA
WP_069599413.1\|589269_590112_-	hypothetical protein	NA	NA	NA	NA
WP_083248642.1\|590650_591397_-	hypothetical protein	NA	NA	NA	NA
WP_069599415.1\|591438_592620_-	YbfB/YjiJ family MFS transporter	NA	NA	NA	NA
WP_113717713.1\|592857_594450_+	hypothetical protein	NA	NA	NA	NA
WP_069599416.1\|595110_596478_-	cation:dicarboxylase symporter family transporter	NA	NA	NA	NA
WP_069601254.1\|596647_597079_+	hypothetical protein	NA	NA	NA	NA
WP_069599417.1\|597119_598835_+	sensor histidine kinase	NA	NA	NA	NA
WP_069599418.1\|598824_599532_+	response regulator	NA	NA	NA	NA
WP_069599419.1\|599647_600187_+	hypothetical protein	NA	NA	NA	NA
WP_069601255.1\|600258_601113_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_069599420.1\|601164_602700_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	1.5e-34	27.5
WP_069599421.1\|602795_603590_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_069599422.1\|603663_605061_-	MHS family MFS transporter	NA	NA	NA	NA
WP_069599423.1\|605120_606080_-	phosphotriesterase	NA	NA	NA	NA
WP_069599424.1\|606224_606704_+	MaoC family dehydratase	NA	NA	NA	NA
WP_069601256.1\|606715_607498_+	glucose 1-dehydrogenase	NA	NA	NA	NA
WP_069599425.1\|607527_608529_+	NADPH:quinone oxidoreductase family protein	NA	NA	NA	NA
WP_069599426.1\|608610_609834_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_069599427.1\|609830_610856_+	phosphotransferase family protein	NA	NA	NA	NA
WP_009881665.1\|610905_611595_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_009881664.1\|611604_612564_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_069601257.1\|612618_613215_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_069599428.1\|613325_614288_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_069599429.1\|614398_615364_+	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_069601258.1\|615435_616236_+	hypothetical protein	NA	NA	NA	NA
WP_009881659.1\|616341_617115_+	DUF4065 domain-containing protein	NA	NA	NA	NA
WP_162619308.1\|617129_617480_+	type II toxin-antitoxin system death-on-curing family toxin	NA	NA	NA	NA
WP_069599431.1\|617516_618293_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_069601259.1\|618416_618830_+	DUF2000 family protein	NA	NA	NA	NA
WP_009881655.1\|618908_619775_+	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_069599432.1\|619750_620368_-	DUF4166 domain-containing protein	NA	NA	NA	NA
WP_069599433.1\|620430_621132_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_069599434.1\|621138_622074_-	hydroxymethylglutaryl-CoA lyase	NA	NA	NA	NA
WP_069599435.1\|622073_623294_-	CoA transferase	NA	NA	NA	NA
WP_069599436.1\|623494_624802_+	2-hydroxycarboxylate transporter family protein	NA	NA	NA	NA
WP_069599437.1\|624809_625463_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_069601260.1\|625705_626620_+	CoA transferase subunit A	NA	NA	NA	NA
WP_069599438.1\|626616_627429_+	3-oxoadipate--succinyl-CoA transferase subunit B	NA	NA	NA	NA
WP_069599439.1\|627416_628085_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_069599440.1\|628072_628615_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_162619309.1\|628820_629183_+	hypothetical protein	NA	NA	NA	NA
WP_009884204.1\|629371_630769_-\|transposase	IS1380-like element ISBli5 family transposase	A0A222ZN33	Mycobacterium_phage	6.6e-125	51.7
WP_009885417.1\|631427_632174_-	ATP-binding protein	A0A0D4DBZ2	Acinetobacter_phage	2.1e-05	29.2
WP_069599442.1\|632170_633736_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_096147176.1\|634935_635394_+	hypothetical protein	NA	NA	NA	NA
WP_125187709.1\|635390_636248_+	hypothetical protein	NA	NA	NA	NA
WP_069601261.1\|636291_637467_+	hypothetical protein	NA	NA	NA	NA
WP_081448687.1\|637478_638153_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.4e-26	35.8
WP_069599443.1\|638145_639342_+	ABC transporter permease	NA	NA	NA	NA
WP_069599133.1\|639573_640689_-\|transposase	IS1249 family transposase	NA	NA	NA	NA
WP_009882371.1\|641989_643264_-\|transposase	IS256-like element ISBli2 family transposase	A0A220NQR7	Corynebacterium_phage	8.9e-169	70.5
WP_167352468.1\|643854_645273_-\|transposase	IS1380-like element ISBli4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

1043510 : 1109609

Mycobacterium_phage(30.77%)

tRNA,protease,transposase,integrase

attL 1036260:1036276|attR 1079193:1079209

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1036260:1036276	attL	NA	NA	NA	NA
WP_069599652.1\|1043510_1044611_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_083248670.1\|1044613_1044805_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_069599654.1\|1045061_1045565_-	hypothetical protein	NA	NA	NA	NA
WP_069599655.1\|1045561_1045936_-	hypothetical protein	NA	NA	NA	NA
WP_162619315.1\|1045925_1047038_-	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	1.3e-22	35.3
WP_069599657.1\|1047695_1047884_-	hypothetical protein	NA	NA	NA	NA
WP_069599659.1\|1048717_1050028_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	1.3e-167	67.5
WP_162619316.1\|1049996_1050239_-	hypothetical protein	NA	NA	NA	NA
WP_069599661.1\|1050544_1052185_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_069599659.1\|1052449_1053760_+\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	1.3e-167	67.5
WP_069599662.1\|1053842_1054715_-	hypothetical protein	NA	NA	NA	NA
WP_162619317.1\|1054755_1055955_-	lysine biosynthesis protein LysW	NA	NA	NA	NA
WP_146001504.1\|1056656_1057769_-	protein rep	NA	NA	NA	NA
WP_069599664.1\|1058332_1059838_-	hypothetical protein	NA	NA	NA	NA
WP_069599665.1\|1060171_1061380_+	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_069599666.1\|1063734_1064655_+	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_069601284.1\|1064674_1065289_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_069599667.1\|1065445_1067059_+	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	2.8e-18	63.9
WP_069599668.1\|1067067_1069128_+	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_069601285.1\|1069189_1070362_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_069599669.1\|1070506_1071985_+	cardiolipin synthase	NA	NA	NA	NA
WP_009883381.1\|1072030_1072852_-	HAD family hydrolase	NA	NA	NA	NA
WP_009883382.1\|1072979_1073291_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_069601286.1\|1073314_1073800_+	SRPBCC domain-containing protein	NA	NA	NA	NA
WP_009883384.1\|1073959_1074463_+	MaoC family dehydratase	NA	NA	NA	NA
WP_069601287.1\|1074471_1075275_+	CoA ester lyase	NA	NA	NA	NA
WP_069601288.1\|1075297_1075963_+	peptide deformylase	E3SLL2	Synechococcus_phage	1.9e-13	35.9
WP_069599670.1\|1076030_1077221_+	hypothetical protein	NA	NA	NA	NA
WP_009883388.1\|1077213_1077744_+	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_029417075.1\|1078026_1078563_+	nitroreductase	NA	NA	NA	NA
WP_009883390.1\|1078559_1079855_+	MFS transporter	NA	NA	NA	NA
1079193:1079209	attR	NA	NA	NA	NA
WP_069601289.1\|1083803_1084565_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_069599672.1\|1084695_1087236_+	PhoX family phosphatase	NA	NA	NA	NA
WP_009883394.1\|1087519_1088164_-	VOC family protein	NA	NA	NA	NA
WP_009883395.1\|1088342_1088828_-	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	6.8e-29	43.4
WP_069599673.1\|1088940_1090407_+	D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase	NA	NA	NA	NA
WP_069601290.1\|1090403_1091420_+	cytoplasmic protein	NA	NA	NA	NA
WP_029417078.1\|1091406_1092438_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_069601291.1\|1092481_1093714_-	amidohydrolase family protein	NA	NA	NA	NA
WP_009883400.1\|1093879_1095163_+	MFS transporter	NA	NA	NA	NA
WP_009883401.1\|1095210_1095762_+	hypoxanthine phosphoribosyltransferase	A0A1V0SEQ1	Hokovirus	1.8e-09	31.7
WP_069599674.1\|1095929_1098104_+\|protease	ATP-dependent zinc metalloprotease FtsH	G8DDJ2	Micromonas_pusilla_virus	2.9e-111	45.7
WP_101598234.1\|1098130_1098727_+	GTP cyclohydrolase I FolE	E7DN69	Pneumococcus_phage	3.0e-42	53.7
WP_069599675.1\|1098736_1099621_+	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	1.1e-16	28.5
WP_009884264.1\|1099617_1100544_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_069599676.1\|1100572_1101034_+	DUF3180 domain-containing protein	NA	NA	NA	NA
WP_069599677.1\|1101030_1101531_+	PH domain-containing protein	NA	NA	NA	NA
WP_069599678.1\|1101533_1103387_+	PH domain-containing protein	NA	NA	NA	NA
WP_069601292.1\|1103398_1104289_+	DUF2520 domain-containing protein	NA	NA	NA	NA
WP_069599679.1\|1104389_1105949_+\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	4.1e-75	34.4
WP_101557271.1\|1105953_1106199_+	hypothetical protein	NA	NA	NA	NA
WP_029417415.1\|1106164_1106503_+	Lsr2 family protein	S5W0B7	Mycobacterium_phage	1.7e-10	37.4
WP_009884271.1\|1107056_1109609_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A1S6UBG5	Serratia_phage	1.1e-133	41.9

DBSCAN-SWA_4

1194019 : 1267375

Gordonia_phage(20.0%)

transposase,integrase

attL 1216657:1216672|attR 1267920:1267933

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069599718.1\|1194019_1195330_-\|transposase	ISL3-like element ISBli1 family transposase	A0A2H4PDF8	Mycobacterium_phage	3.5e-168	67.8
WP_009882371.1\|1196036_1197311_+\|transposase	IS256-like element ISBli2 family transposase	A0A220NQR7	Corynebacterium_phage	8.9e-169	70.5
WP_069599719.1\|1197464_1198031_+	hypothetical protein	NA	NA	NA	NA
WP_069599720.1\|1198285_1198687_-	heme-binding protein	NA	NA	NA	NA
WP_069599721.1\|1198716_1199493_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_069599722.1\|1199593_1200208_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_133066549.1\|1200337_1200598_-	hypothetical protein	NA	NA	NA	NA
WP_127361976.1\|1201073_1202243_+	hypothetical protein	NA	NA	NA	NA
WP_069599725.1\|1202433_1203015_+	recombinase family protein	A0A1V0E035	Clostridioides_phage	6.5e-10	27.7
WP_125178027.1\|1205091_1205409_+	hypothetical protein	NA	NA	NA	NA
WP_083248683.1\|1205659_1206214_+	copper resistance protein CopC	NA	NA	NA	NA
WP_069599727.1\|1206269_1206857_+	copper chaperone PCu(A)C	NA	NA	NA	NA
WP_069599728.1\|1206853_1208074_+	Dyp-type peroxidase	NA	NA	NA	NA
WP_069599729.1\|1208096_1209530_+	PepSY domain-containing protein	NA	NA	NA	NA
WP_113717727.1\|1210035_1210200_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_096158425.1\|1210214_1211036_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.2e-06	27.7
WP_162619319.1\|1211172_1211532_+\|transposase	transposase	A0A1B3AZE5	Gordonia_phage	2.2e-16	57.7
WP_069601299.1\|1211605_1213018_-	hypothetical protein	A0A1V0SK38	Klosneuvirus	1.0e-48	30.6
WP_069599731.1\|1213222_1213795_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_083248685.1\|1213838_1214864_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A0M4S3B4	Mycobacterium_phage	4.7e-120	66.6
WP_069599732.1\|1214894_1217051_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	8.7e-201	49.5
1216657:1216672	attL	NA	NA	NA	NA
WP_069599733.1\|1217047_1217530_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	5.0e-16	44.5
1216657:1216672	attL	NA	NA	NA	NA
WP_035278435.1\|1218071_1219001_+	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_009882356.1\|1218997_1219738_+	metal ABC transporter ATP-binding protein	W5SAS9	Pithovirus	1.8e-17	32.4
WP_009882354.1\|1219734_1220628_+	metal ABC transporter permease	NA	NA	NA	NA
WP_069599735.1\|1220624_1221275_+	metal-dependent transcriptional regulator	NA	NA	NA	NA
WP_029416765.1\|1221293_1221980_-	metal-dependent transcriptional regulator	NA	NA	NA	NA
WP_009882351.1\|1222054_1223596_-	peptidoglycan recognition protein	NA	NA	NA	NA
WP_069599736.1\|1224270_1225407_-	YibE/F family protein	NA	NA	NA	NA
WP_029416759.1\|1226242_1226821_+	recombinase family protein	G8I4U3	Mycobacterium_phage	1.3e-31	45.1
WP_009882337.1\|1226892_1227519_+	maleylpyruvate isomerase family mycothiol-dependent enzyme	NA	NA	NA	NA
WP_069599737.1\|1227617_1227935_+	hypothetical protein	NA	NA	NA	NA
WP_009882371.1\|1228263_1229538_+\|transposase	IS256-like element ISBli2 family transposase	A0A220NQR7	Corynebacterium_phage	8.9e-169	70.5
WP_009885260.1\|1229759_1230050_-	hypothetical protein	NA	NA	NA	NA
WP_009885490.1\|1230046_1232020_-\|integrase	tyrosine-type recombinase/integrase	K7P7R5	Enterobacteria_phage	5.5e-08	27.5
WP_035278301.1\|1231982_1233071_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_009882863.1\|1233834_1234161_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_069599738.1\|1234416_1235028_-	recombinase family protein	M9Q1K0	Clostridium_phage	1.3e-21	37.2
WP_162619320.1\|1235404_1236202_+	S8 family serine peptidase	NA	NA	NA	NA
WP_083248688.1\|1236186_1237023_+	hypothetical protein	NA	NA	NA	NA
WP_009885516.1\|1237000_1237543_+	hypothetical protein	NA	NA	NA	NA
1237134:1237149	attR	NA	NA	NA	NA
WP_069599741.1\|1237997_1239089_+\|transposase	IS630 family transposase	NA	NA	NA	NA
1237134:1237149	attR	NA	NA	NA	NA
WP_162619321.1\|1239106_1239283_+	hypothetical protein	NA	NA	NA	NA
WP_083248689.1\|1240315_1240522_-\|transposase	transposase	NA	NA	NA	NA
WP_069599742.1\|1240799_1242002_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_069599743.1\|1241998_1242955_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_069599744.1\|1242951_1243977_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_113717729.1\|1244023_1244758_-\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	5.7e-43	48.5
WP_009883477.1\|1244682_1244994_-\|transposase	transposase	A0A1B3AZF8	Gordonia_phage	2.1e-15	46.1
WP_009883781.1\|1245547_1246294_-	ATP-binding protein	NA	NA	NA	NA
WP_009884100.1\|1246290_1247841_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_083248691.1\|1247897_1248653_+	hypothetical protein	NA	NA	NA	NA
WP_009882346.1\|1249535_1249964_-	hypothetical protein	NA	NA	NA	NA
WP_125178024.1\|1249992_1250622_-	hypothetical protein	NA	NA	NA	NA
WP_009882371.1\|1251538_1252813_+\|transposase	IS256-like element ISBli2 family transposase	A0A220NQR7	Corynebacterium_phage	8.9e-169	70.5
WP_069599747.1\|1253010_1253217_+	hypothetical protein	NA	NA	NA	NA
WP_009881631.1\|1253665_1254757_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_162619322.1\|1254929_1255577_-	hypothetical protein	NA	NA	NA	NA
WP_162619323.1\|1255758_1256163_+	hypothetical protein	NA	NA	NA	NA
WP_009885260.1\|1256427_1256718_-	hypothetical protein	NA	NA	NA	NA
WP_009885490.1\|1256714_1258688_-\|integrase	tyrosine-type recombinase/integrase	K7P7R5	Enterobacteria_phage	5.5e-08	27.5
WP_035278301.1\|1258650_1259739_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_069599744.1\|1260049_1261075_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_069599743.1\|1261071_1262028_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_069599742.1\|1262024_1263227_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_009883329.1\|1263655_1265089_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	4.0e-61	37.7
WP_069599752.1\|1266475_1267375_-\|integrase	tyrosine-type recombinase/integrase	A0A0K0N6I5	Gordonia_phage	6.9e-35	39.7
1267920:1267933	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2005531 : 2027074

Enterobacteria_phage(33.33%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_055082838.1\|2005531_2006518_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_069600089.1\|2006487_2006958_+	redox-sensitive transcriptional activator SoxR	NA	NA	NA	NA
WP_069600090.1\|2007064_2007874_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	4.8e-35	34.8
WP_069600091.1\|2007875_2009546_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_069600092.1\|2009579_2009909_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_069600093.1\|2009923_2010415_-	VOC family protein	NA	NA	NA	NA
WP_009883781.1\|2010880_2011627_-	ATP-binding protein	NA	NA	NA	NA
WP_009884100.1\|2011623_2013174_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_167352471.1\|2014595_2016017_+\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_009884202.1\|2016369_2016951_-	recombinase family protein	A0A1V0E035	Clostridioides_phage	6.5e-10	27.7
WP_009884203.1\|2017501_2018695_+	hypothetical protein	NA	NA	NA	NA
WP_009882371.1\|2019550_2020825_+\|transposase	IS256-like element ISBli2 family transposase	A0A220NQR7	Corynebacterium_phage	8.9e-169	70.5
WP_162619328.1\|2021328_2022078_+	hypothetical protein	NA	NA	NA	NA
WP_069600094.1\|2022061_2022700_+	hypothetical protein	NA	NA	NA	NA
WP_125178134.1\|2023366_2023594_-	hypothetical protein	NA	NA	NA	NA
WP_069600095.1\|2024444_2025344_+	universal stress protein	NA	NA	NA	NA
WP_101584360.1\|2025439_2026210_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_009882457.1\|2026316_2026550_-	hypothetical protein	NA	NA	NA	NA
WP_009882456.1\|2026660_2027074_-\|holin	phage holin family protein	NA	NA	NA	NA

DBSCAN-SWA_6

2070545 : 2121298

Mycobacterium_phage(20.0%)

capsid,portal,transposase,integrase

attL 2094633:2094671|attR 2096108:2096146

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009881614.1\|2070545_2071826_-\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	3.3e-107	50.5
WP_009882379.1\|2073416_2074418_-	hypothetical protein	NA	NA	NA	NA
WP_081448531.1\|2074414_2075128_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.8e-25	34.4
WP_147271746.1\|2075129_2076392_-	hypothetical protein	NA	NA	NA	NA
WP_009882376.1\|2076519_2076867_-	hypothetical protein	NA	NA	NA	NA
WP_009882375.1\|2077469_2077994_+	helix-turn-helix domain-containing protein	K4ICM4	Acidithiobacillus_phage	2.0e-13	45.7
WP_009882373.1\|2078012_2078600_+	PIN domain-containing protein	NA	NA	NA	NA
WP_009884204.1\|2078734_2080132_+\|transposase	IS1380-like element ISBli5 family transposase	A0A222ZN33	Mycobacterium_phage	6.6e-125	51.7
WP_081448653.1\|2081379_2081766_+	DUF1003 domain-containing protein	NA	NA	NA	NA
WP_167352468.1\|2083331_2084750_+\|transposase	IS1380-like element ISBli4 family transposase	NA	NA	NA	NA
WP_069600115.1\|2084957_2085395_+	hypothetical protein	NA	NA	NA	NA
WP_029417735.1\|2086964_2088428_+	glycosyltransferase	NA	NA	NA	NA
WP_009885189.1\|2088914_2089340_-	cupin domain-containing protein	NA	NA	NA	NA
WP_069600116.1\|2089465_2091466_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	2.1e-108	41.0
WP_029417737.1\|2091559_2091793_-	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_029417739.1\|2091959_2092643_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_009885193.1\|2092850_2093315_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_069600117.1\|2093610_2094519_-	universal stress protein	NA	NA	NA	NA
2094633:2094671	attL	NA	NA	NA	NA
WP_096145777.1\|2094737_2096030_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_029417741.1\|2096399_2096732_+	LuxR family transcriptional regulator	NA	NA	NA	NA
2096108:2096146	attR	NA	NA	NA	NA
WP_009885196.1\|2096777_2097149_+	non-heme iron oxygenase ferredoxin subunit	NA	NA	NA	NA
WP_069600118.1\|2097533_2098079_+	YceI family protein	NA	NA	NA	NA
WP_069600119.1\|2098206_2098947_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_081448654.1\|2098943_2100356_-	nitrate reductase	Q9KX94	Enterobacteria_phage	3.7e-83	44.7
WP_009885200.1\|2100534_2101590_+	biotin synthase BioB	NA	NA	NA	NA
WP_009885201.1\|2101634_2103176_-	AMP-binding protein	A0A1V0SBX8	Catovirus	6.3e-20	23.5
WP_009885202.1\|2103364_2104198_+	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_069600120.1\|2104243_2104972_+	hypothetical protein	NA	NA	NA	NA
WP_083248728.1\|2105038_2105836_-	peroxide stress protein YaaA	NA	NA	NA	NA
WP_009885205.1\|2106350_2107016_-	hypothetical protein	NA	NA	NA	NA
WP_069600121.1\|2107017_2107851_-	ROK family protein	NA	NA	NA	NA
WP_069600122.1\|2107861_2108770_-	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_009885208.1\|2108908_2109634_+	FadR family transcriptional regulator	NA	NA	NA	NA
WP_009885209.1\|2109802_2110921_-	alanine dehydrogenase	NA	NA	NA	NA
WP_009885210.1\|2111249_2111453_+	hypothetical protein	NA	NA	NA	NA
WP_009885211.1\|2111456_2112815_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_069600123.1\|2112819_2115861_+	bifunctional [glutamine synthetase] adenylyltransferase/[glutamine synthetase]-adenylyl-L-tyrosine phosphorylase	NA	NA	NA	NA
WP_069600124.1\|2115870_2117340_-	mycothione reductase	A0A2K5B2C5	Erysipelothrix_phage	4.2e-29	25.3
WP_069600125.1\|2117805_2118129_-	hypothetical protein	NA	NA	NA	NA
WP_069600126.1\|2118128_2118467_-	hypothetical protein	NA	NA	NA	NA
WP_069600127.1\|2118468_2119308_-\|capsid	phage major capsid protein	I3ULZ9	Rhodobacter_phage	3.7e-06	23.6
WP_069600128.1\|2119425_2119908_-	hypothetical protein	NA	NA	NA	NA
WP_069600129.1\|2119909_2121298_-\|portal	phage portal protein	A0A2H4JAT8	uncultured_Caudovirales_phage	8.2e-51	35.4

DBSCAN-SWA_7

2142653 : 2212622

Streptomyces_phage(13.33%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009884649.1\|2142653_2143358_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_009884648.1\|2143466_2144339_+	cytochrome c oxidase subunit II	NA	NA	NA	NA
WP_069600143.1\|2144335_2146033_+	cytochrome c oxidase subunit I	NA	NA	NA	NA
WP_069600144.1\|2146029_2146431_+	cytochrome c oxidase subunit 4	NA	NA	NA	NA
WP_069600146.1\|2147766_2149392_-	ubiquinol-cytochrome c reductase cytochrome b subunit	NA	NA	NA	NA
WP_069600147.1\|2149388_2150432_-	Rieske (2Fe-2S) protein	NA	NA	NA	NA
WP_029417563.1\|2150481_2151267_-	c-type cytochrome	NA	NA	NA	NA
WP_009884639.1\|2151324_2151894_-	heme-copper oxidase subunit III	NA	NA	NA	NA
WP_069600148.1\|2152179_2153301_+	anthranilate phosphoribosyltransferase	NA	NA	NA	NA
WP_069600149.1\|2153268_2155014_-	DEDD exonuclease domain-containing protein	G3MAD3	Bacillus_virus	4.7e-11	28.8
WP_009884636.1\|2155073_2155496_-	hypothetical protein	NA	NA	NA	NA
WP_009884635.1\|2155525_2156317_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_035279411.1\|2156402_2157182_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_009884633.1\|2157422_2158004_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_029417561.1\|2158298_2159111_-	ParA family protein	NA	NA	NA	NA
WP_009884631.1\|2159285_2162687_+	pyruvate carboxylase	NA	NA	NA	NA
WP_009884630.1\|2162679_2163186_+	peptide deformylase	A0A142EZU8	Stenotrophomonas_phage	1.2e-07	30.5
WP_009884629.1\|2163227_2164082_+	3-hydroxybutyryl-CoA dehydrogenase	NA	NA	NA	NA
WP_069600150.1\|2164177_2165437_-	aminotransferase	NA	NA	NA	NA
WP_069600151.1\|2165530_2166292_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_069600152.1\|2166426_2166891_-	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_069600153.1\|2166974_2167910_+	AEC family transporter	NA	NA	NA	NA
WP_029417556.1\|2168068_2168584_-	ferritin	NA	NA	NA	NA
WP_009884623.1\|2168782_2169064_+	4a-hydroxytetrahydrobiopterin dehydratase	NA	NA	NA	NA
WP_069600154.1\|2169039_2170488_-	amidase	NA	NA	NA	NA
WP_069600155.1\|2170492_2171725_-	amidohydrolase	NA	NA	NA	NA
WP_069600156.1\|2171793_2172528_-	hypothetical protein	NA	NA	NA	NA
WP_069600157.1\|2172538_2173285_-	DUF5058 family protein	NA	NA	NA	NA
WP_069600158.1\|2173507_2174068_+	hypothetical protein	NA	NA	NA	NA
WP_162619332.1\|2174134_2174287_-	hypothetical protein	NA	NA	NA	NA
WP_162619333.1\|2174243_2174459_-	HIT domain-containing protein	NA	NA	NA	NA
WP_069601348.1\|2174553_2175060_-	DUF4442 domain-containing protein	NA	NA	NA	NA
WP_009884902.1\|2175417_2175891_-	transglycosylase family protein	A0A1J0GVU2	Streptomyces_phage	5.3e-26	57.1
WP_009884901.1\|2176071_2178453_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	4.7e-123	32.6
WP_069600159.1\|2178458_2178878_-	VOC family protein	NA	NA	NA	NA
WP_069600160.1\|2178889_2179324_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_009884898.1\|2179320_2180865_-	APC family permease	NA	NA	NA	NA
WP_069600161.1\|2180889_2182242_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_069601349.1\|2182344_2183316_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_069600162.1\|2183374_2184319_+	WYL domain-containing protein	NA	NA	NA	NA
WP_069600163.1\|2184344_2184656_-	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	2.7e-18	57.9
WP_069600164.1\|2184618_2185929_-\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	7.7e-168	66.4
WP_096146982.1\|2186053_2186284_-	hypothetical protein	NA	NA	NA	NA
WP_069600166.1\|2187558_2188164_-	hypothetical protein	NA	NA	NA	NA
WP_069600167.1\|2188312_2188708_+	hypothetical protein	NA	NA	NA	NA
WP_069600168.1\|2188795_2189422_+	hypothetical protein	NA	NA	NA	NA
WP_069600169.1\|2190416_2190977_+	hypothetical protein	NA	NA	NA	NA
WP_009885521.1\|2191034_2191379_+	hypothetical protein	NA	NA	NA	NA
WP_083248732.1\|2191628_2192696_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_069600171.1\|2193914_2194289_-	hypothetical protein	NA	NA	NA	NA
WP_069600172.1\|2194325_2195477_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_083248733.1\|2197469_2198105_-	DUF1345 domain-containing protein	NA	NA	NA	NA
WP_113717818.1\|2198160_2199311_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	7.8e-39	38.3
WP_069601355.1\|2199878_2200583_+	O-methyltransferase	A0A2P1JQT7	Mycobacterium_phage	7.1e-35	42.9
WP_009882371.1\|2201005_2202280_-\|transposase	IS256-like element ISBli2 family transposase	A0A220NQR7	Corynebacterium_phage	8.9e-169	70.5
WP_069600174.1\|2202340_2202718_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_147271743.1\|2202852_2203164_+	hypothetical protein	NA	NA	NA	NA
WP_029603710.1\|2203213_2203531_+\|transposase	transposase	A0A1B3AZF8	Gordonia_phage	5.6e-32	63.8
WP_162619334.1\|2203533_2204238_+\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	3.3e-72	62.7
WP_069600176.1\|2205932_2206385_-	thioredoxin	A0A1J0GW78	Streptomyces_phage	1.2e-11	39.8
WP_069600177.1\|2206381_2209009_-	ATP-dependent chaperone ClpB	K4FB40	Cronobacter_phage	1.2e-124	37.9
WP_069600178.1\|2208999_2209311_-	HspR protein	NA	NA	NA	NA
WP_069600179.1\|2209307_2210195_-	DnaJ domain-containing protein	A0A167RAM8	Powai_lake_megavirus	8.7e-14	51.3
WP_069600180.1\|2210198_2210738_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_069600181.1\|2210756_2212622_-	molecular chaperone DnaK	M4R062	Micromonas_pusilla_virus	3.0e-149	47.4

DBSCAN-SWA_8

2627728 : 2661741

Gordonia_phage(30.0%)

tRNA,holin,transposase,integrase

attL 2647982:2647998|attR 2665256:2665272

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009883061.1\|2627728_2629291_+\|holin	choline oxidase	A0A1V0SI18	Klosneuvirus	8.7e-118	44.9
WP_069600349.1\|2629546_2631343_-	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	1.6e-19	24.3
WP_029417909.1\|2631445_2631757_+\|transposase	transposase	A0A1B3AZF8	Gordonia_phage	1.5e-16	48.0
WP_083248757.1\|2631753_2632665_+\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	5.0e-41	44.7
WP_162619336.1\|2632873_2633212_+\|transposase	transposase	A0A160DCU2	Gordonia_phage	9.6e-22	54.4
WP_009885325.1\|2639365_2639767_-	YccF domain-containing protein	NA	NA	NA	NA
WP_069600350.1\|2640017_2641304_-\|tRNA	tyrosine--tRNA ligase	A0A1L2CUL7	Pectobacterium_phage	2.2e-66	38.0
WP_069600351.1\|2641930_2643352_-	argininosuccinate lyase	NA	NA	NA	NA
WP_069600352.1\|2643428_2643944_-	arginine repressor	NA	NA	NA	NA
WP_069600353.1\|2643940_2644864_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_069600354.1\|2644957_2646175_-	acetylornithine transaminase	A0A249XSK4	Mycobacterium_phage	1.2e-13	26.3
WP_167352473.1\|2646167_2647151_-	acetylglutamate kinase	NA	NA	NA	NA
WP_069600356.1\|2647165_2648344_-	bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ	NA	NA	NA	NA
2647982:2647998	attL	NA	NA	NA	NA
WP_069600357.1\|2648340_2649450_-	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_069600358.1\|2649494_2650472_+	quinone oxidoreductase	E3SJ82	Synechococcus_phage	3.9e-07	26.5
WP_083248759.1\|2652022_2653090_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_113717825.1\|2653883_2654999_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_069600360.1\|2655066_2657058_-	ATP-dependent helicase	NA	NA	NA	NA
WP_069600361.1\|2657054_2659772_-	class I SAM-dependent DNA methyltransferase	Q6NE04	Leptospira_phage	4.0e-142	36.4
WP_069600362.1\|2660086_2660551_+	hypothetical protein	NA	NA	NA	NA
WP_162619337.1\|2660994_2661741_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	Q8W6R2	Burkholderia_virus	1.6e-13	40.2
2665256:2665272	attR	NA	NA	NA	NA

DBSCAN-SWA_9

2928114 : 3002089

Mycobacterium_phage(33.33%)

tRNA,transposase,integrase

attL 2997213:2997240|attR 3000604:3000631

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009882663.1\|2928114_2929617_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_009882665.1\|2929616_2929922_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_147271706.1\|2930068_2930635_-	hypothetical protein	NA	NA	NA	NA
WP_069600505.1\|2930752_2932942_-	NAD-dependent DNA ligase LigA	A0A0A8J9A9	Ralstonia_phage	4.7e-101	35.5
WP_069600506.1\|2932938_2934093_-	hypothetical protein	NA	NA	NA	NA
WP_069600507.1\|2934085_2936098_-	S9 family peptidase	NA	NA	NA	NA
WP_069600508.1\|2936182_2937376_-\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_009882677.1\|2938704_2939055_+	hypothetical protein	NA	NA	NA	NA
WP_069600510.1\|2941347_2942292_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_035278552.1\|2942482_2944075_-	hypothetical protein	NA	NA	NA	NA
WP_085974892.1\|2944316_2944925_+	oligoribonuclease	A0A0K0N5G5	Tsukamurella_phage	9.8e-17	36.2
WP_035278538.1\|2945002_2945428_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_069600511.1\|2945424_2947119_+	SulP family inorganic anion transporter	NA	NA	NA	NA
WP_069601392.1\|2947174_2948095_-	hypothetical protein	NA	NA	NA	NA
WP_069600512.1\|2948111_2948954_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_009882688.1\|2949176_2950172_+	(Fe-S)-binding protein	NA	NA	NA	NA
WP_069601393.1\|2950183_2951698_+	iron-sulfur cluster-binding protein	NA	NA	NA	NA
WP_081448542.1\|2951895_2952456_+	LUD domain-containing protein	NA	NA	NA	NA
WP_101557325.1\|2952511_2953234_+	DUF2993 domain-containing protein	NA	NA	NA	NA
WP_162619340.1\|2953301_2953451_+	hypothetical protein	NA	NA	NA	NA
WP_069600513.1\|2953564_2954854_+	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	2.4e-49	37.9
WP_069600514.1\|2954919_2956200_+	Zn-dependent hydrolase	NA	NA	NA	NA
WP_009882695.1\|2956245_2956605_+	antitoxin	NA	NA	NA	NA
WP_069600515.1\|2956611_2957340_-	hypothetical protein	NA	NA	NA	NA
WP_069600516.1\|2957342_2958197_-	hypothetical protein	NA	NA	NA	NA
WP_009882698.1\|2958402_2959722_+	glutaminase	NA	NA	NA	NA
WP_009882699.1\|2959901_2960720_+	siderophore-interacting protein	NA	NA	NA	NA
WP_069600517.1\|2960769_2963043_-	LPXTG cell wall anchor domain-containing protein	M4SLV1	Cyanophage	2.2e-08	24.8
WP_009882701.1\|2963191_2964115_-	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_069600518.1\|2964111_2964975_-	ribokinase	NA	NA	NA	NA
WP_009882705.1\|2965065_2965494_-	organic hydroperoxide resistance protein	NA	NA	NA	NA
WP_101557318.1\|2966033_2966372_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_069600520.1\|2966678_2968130_-	allantoin permease	NA	NA	NA	NA
WP_083248941.1\|2968155_2969031_-	hypothetical protein	NA	NA	NA	NA
WP_069600522.1\|2969199_2970123_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_069600523.1\|2970372_2971845_-	hypothetical protein	NA	NA	NA	NA
WP_069600524.1\|2971945_2972437_-	hypothetical protein	NA	NA	NA	NA
WP_069600525.1\|2972474_2974835_-	hypothetical protein	NA	NA	NA	NA
WP_069600526.1\|2974831_2976571_-	hypothetical protein	NA	NA	NA	NA
WP_069600527.1\|2976605_2977868_-	hypothetical protein	NA	NA	NA	NA
WP_069600528.1\|2978011_2981413_-	hypothetical protein	A0A068F1K4	Mycobacterium_phage	1.2e-18	26.2
WP_069600529.1\|2981439_2982582_-	hypothetical protein	NA	NA	NA	NA
WP_069600530.1\|2982585_2982885_-	hypothetical protein	NA	NA	NA	NA
WP_069600531.1\|2982891_2983509_-	hypothetical protein	NA	NA	NA	NA
WP_069600532.1\|2983625_2984141_-	hypothetical protein	NA	NA	NA	NA
WP_162619341.1\|2984191_2985910_-	DUF2800 domain-containing protein	NA	NA	NA	NA
WP_069600534.1\|2986020_2987892_-	hypothetical protein	NA	NA	NA	NA
WP_069600535.1\|2987810_2989001_-	hypothetical protein	NA	NA	NA	NA
WP_069600536.1\|2988987_2989698_-	thioredoxin domain-containing protein	NA	NA	NA	NA
WP_083248778.1\|2989976_2990375_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013350322.1\|2990432_2991743_+\|transposase	ISL3-like element ISAar39 family transposase	A0A2H4PDF8	Mycobacterium_phage	7.2e-166	64.8
WP_013350323.1\|2991766_2992543_-	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	4.8e-16	33.0
WP_069600538.1\|2992539_2993604_-	iron ABC transporter permease	NA	NA	NA	NA
WP_069600539.1\|2993593_2994625_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_013350326.1\|2994639_2995482_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_101557321.1\|2995670_2996835_+\|transposase	IS3-like element ISAar24 family transposase	U5P429	Shigella_phage	5.5e-40	37.2
2997213:2997240	attL	NA	NA	NA	NA
WP_069600541.1\|2997306_2998332_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_069599743.1\|2998328_2999285_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_069599742.1\|2999281_3000484_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_069600542.1\|3000787_3002089_+\|transposase	ISL3-like element ISAar42 family transposase	A0A2H4PDF8	Mycobacterium_phage	4.9e-183	71.7
3000604:3000631	attR	NA	NA	NA	NA

DBSCAN-SWA_10

3131259 : 3166441

Gordonia_phage(16.67%)

capsid,integrase,portal,transposase,terminase

attL 3118817:3118831|attR 3171292:3171306

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3118817:3118831	attL	NA	NA	NA	NA
WP_083248787.1\|3131259_3131997_+\|integrase	tyrosine-type recombinase/integrase	A0A0E3XBN7	Gordonia_phage	2.8e-42	40.4
WP_009883781.1\|3132108_3132855_-	ATP-binding protein	NA	NA	NA	NA
WP_009884100.1\|3132851_3134402_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_069600621.1\|3134577_3134943_+\|integrase	tyrosine-type recombinase/integrase	A0A0E3XBN7	Gordonia_phage	7.4e-12	65.5
WP_069600622.1\|3135001_3135982_-	class 1b ribonucleoside-diphosphate reductase subunit beta	R4TBI6	Mycobacterium_phage	7.3e-147	80.1
WP_069600623.1\|3136128_3138291_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	5.3e-214	52.8
WP_009881978.1\|3138260_3138674_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A0K2FM04	Brevibacillus_phage	2.2e-12	40.8
WP_009881976.1\|3138675_3138924_-	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	1.8e-17	53.3
WP_009881973.1\|3139512_3140508_+	AAA domain-containing protein	NA	NA	NA	NA
WP_069600624.1\|3140520_3141405_+	DUF58 domain-containing protein	NA	NA	NA	NA
WP_069600625.1\|3141391_3141844_+	hypothetical protein	NA	NA	NA	NA
WP_069600626.1\|3141834_3142809_+	VWA domain-containing protein	NA	NA	NA	NA
WP_069600627.1\|3142805_3143882_+	VWA domain-containing protein	NA	NA	NA	NA
WP_069600628.1\|3143878_3144673_+	hypothetical protein	NA	NA	NA	NA
WP_009881963.1\|3144696_3145806_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_069600629.1\|3145818_3147300_-	PucR family transcriptional regulator	NA	NA	NA	NA
WP_009881961.1\|3147435_3148446_+	agmatinase	NA	NA	NA	NA
WP_069600630.1\|3148448_3150137_+	acetolactate synthase	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	2.7e-16	23.3
WP_069600631.1\|3150186_3151710_+	sodium:solute symporter	NA	NA	NA	NA
WP_069600632.1\|3151946_3153599_+	thiamine pyrophosphate-binding protein	NA	NA	NA	NA
WP_009881955.1\|3154209_3154680_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	8.4e-32	45.8
WP_009881954.1\|3154868_3156098_-	peptidoglycan DD-metalloendopeptidase family protein	A0A1D6X855	Bacillus_phage	1.2e-21	39.1
WP_009881953.1\|3156099_3157014_-	ABC transporter permease	NA	NA	NA	NA
WP_009881952.1\|3157010_3157700_-	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	1.1e-29	37.5
WP_069600633.1\|3157867_3158986_-	peptide chain release factor 2	NA	NA	NA	NA
WP_069600634.1\|3159122_3160349_-	hemin transporter	NA	NA	NA	NA
WP_069600636.1\|3161473_3161797_-	hypothetical protein	NA	NA	NA	NA
WP_147271731.1\|3161796_3162126_-	hypothetical protein	NA	NA	NA	NA
WP_069600638.1\|3162136_3162973_-\|capsid	phage major capsid protein	NA	NA	NA	NA
WP_069600639.1\|3163091_3163574_-	hypothetical protein	NA	NA	NA	NA
WP_069600640.1\|3163575_3164964_-\|portal	phage portal protein	A0A2H4JAT8	uncultured_Caudovirales_phage	1.4e-50	35.7
WP_069600641.1\|3164968_3166441_-\|terminase	terminase	A0A2K9VGS4	Pontimonas_phage	1.2e-47	32.9
3171292:3171306	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage