CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP017078	Novosphingobium resinovorum strain SA1 plasmid pSA3, complete sequence	0 crisprs	csa3	2
NZ_CP017079	Novosphingobium resinovorum strain SA1 plasmid pSA4, complete sequence	0 crisprs	NA	0
NZ_CP017075	Novosphingobium resinovorum strain SA1, complete genome	2 crisprs	RT,cas3,DEDDh,csa3,WYL	7
NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	0 crisprs	DEDDh,WYL	2
NZ_CP017077	Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence	0 crisprs	csa3,WYL,RT	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

91137 : 98371

uncultured_Caudovirales_phage(83.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069710282.1\|91137_92322_-	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	2.4e-104	61.3
WP_069710283.1\|92492_93407_+	hydrogen peroxide-inducible genes activator	NA	NA	NA	NA
WP_069710284.1\|93556_94951_+	voltage-gated chloride channel family protein	A0A1X9I5Z9	Streptococcus_phage	6.1e-38	33.3
WP_069710285.1\|94950_95334_+	hypothetical protein	NA	NA	NA	NA
WP_083274940.1\|95378_95702_+	YnfA family protein	A0A2H4JF35	uncultured_Caudovirales_phage	5.2e-25	60.0
WP_069710286.1\|95798_96128_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_083274941.1\|96030_96660_+	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	4.1e-26	41.9
WP_069710288.1\|96656_97085_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	8.4e-31	51.1
WP_069710289.1\|97084_98371_+	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	5.1e-172	74.8

DBSCAN-SWA_2

241848 : 301784

Escherichia_phage(16.67%)

transposase,integrase

attL 241764:241790|attR 247660:247686

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
241764:241790	attL	NA	NA	NA	NA
WP_037094399.1\|241848_242841_-\|integrase	site-specific integrase	A0A1B1IQT7	uncultured_Mediterranean_phage	3.1e-12	32.9
WP_037094402.1\|242837_243782_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_037094406.1\|245249_246071_+	sulfurtransferase	NA	NA	NA	NA
WP_037094409.1\|246070_247438_+	chromate efflux transporter	A0A219VHC2	Ochrobactrum_phage	7.6e-33	72.9
WP_083274958.1\|247644_248316_-	DUF1738 domain-containing protein	A0A1V0EEV1	Caulobacter_phage	4.1e-48	48.2
247660:247686	attR	NA	NA	NA	NA
WP_069710354.1\|248559_248745_-	hypothetical protein	NA	NA	NA	NA
WP_069710355.1\|249270_249858_-	hypothetical protein	NA	NA	NA	NA
WP_155276029.1\|250487_252212_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_069710356.1\|252997_253981_+	DUF2971 domain-containing protein	NA	NA	NA	NA
WP_069710357.1\|254742_256002_-	adenosylmethionine--8-amino-7-oxononanoate transaminase	NA	NA	NA	NA
WP_069710358.1\|255998_256640_-	ATP-dependent dethiobiotin synthetase BioD	NA	NA	NA	NA
WP_156800082.1\|257423_257690_-	hypothetical protein	NA	NA	NA	NA
WP_069710403.1\|257821_258733_-	glutaminase	NA	NA	NA	NA
WP_083274970.1\|259241_259565_+	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_069710360.1\|259561_260782_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_069710361.1\|261597_262629_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_069710362.1\|264026_264368_-	5-carboxymethyl-2-hydroxymuconate isomerase	NA	NA	NA	NA
WP_069710363.1\|264499_265939_-	glutamine synthetase	NA	NA	NA	NA
WP_069710364.1\|265963_267322_-	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_083274960.1\|268167_269016_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-38	40.3
WP_083274961.1\|269331_270390_-	maleylacetate reductase	NA	NA	NA	NA
WP_083274962.1\|270889_271642_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_083274963.1\|271709_272105_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_069710366.1\|272101_272449_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	2.0e-27	54.9
WP_069709383.1\|273979_275203_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.4e-41	45.1
WP_156800083.1\|275389_275575_+	hypothetical protein	NA	NA	NA	NA
WP_069710404.1\|275766_276597_+	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	2.2e-11	25.7
WP_083274964.1\|276659_277409_+	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_155276029.1\|277532_279257_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_051796732.1\|279332_279818_+	phosphatidylglycerophosphatase A	NA	NA	NA	NA
WP_035228575.1\|279826_280264_-	EamA family transporter	NA	NA	NA	NA
WP_080723360.1\|280273_280651_-	fluoride efflux transporter CrcB	A0A2H4PQR0	Staphylococcus_phage	8.0e-09	34.1
WP_035228572.1\|280913_281654_-	hypothetical protein	NA	NA	NA	NA
WP_069710368.1\|281662_285088_-	Ti-type conjugative transfer relaxase TraA	NA	NA	NA	NA
WP_035228567.1\|285352_285646_+	hypothetical protein	NA	NA	NA	NA
WP_127601168.1\|286176_286581_+	hypothetical protein	NA	NA	NA	NA
WP_080723359.1\|286934_287255_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A2R2Z2Y1	Escherichia_phage	2.3e-17	44.9
WP_035228560.1\|287251_287527_-	type II toxin-antitoxin system ParD family antitoxin	A0A0N7C055	Escherichia_phage	1.2e-14	50.6
WP_035228558.1\|287973_288633_-	ParA family protein	B0ZSI1	Halomonas_phage	1.0e-14	32.7
WP_156800087.1\|289063_289528_-	replication protein RepA	NA	NA	NA	NA
WP_001389365.1\|289648_290413_+\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_083274965.1\|290384_290852_-	hypothetical protein	NA	NA	NA	NA
WP_069710372.1\|291099_292110_-	ParB/RepB/Spo0J family partition protein	A0A240F4U0	Ochrobactrum_phage	5.6e-09	36.3
WP_069710373.1\|292106_292847_-	ParA family protein	B0ZSI1	Halomonas_phage	1.1e-06	26.1
WP_069710374.1\|292850_293042_-	hypothetical protein	NA	NA	NA	NA
WP_069710406.1\|293337_293658_-	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_069710375.1\|294192_295029_-	RNA replicase	NA	NA	NA	NA
WP_069710376.1\|295465_296326_-	RepB family plasmid replication initiator protein	A0A0K1Y6J9	Rhodobacter_phage	9.3e-29	30.9
WP_069710377.1\|296625_297216_+	recombinase family protein	A0A286S1P7	Klebsiella_phage	8.0e-48	57.4
WP_069710378.1\|297212_297401_+	hypothetical protein	NA	NA	NA	NA
WP_006961816.1\|297618_298485_-	recombinase family protein	E5FFF9	Burkholderia_phage	4.8e-25	40.0
WP_036531279.1\|299526_300294_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	1.0e-42	39.7
WP_081799279.1\|300290_301784_-\|transposase	IS21 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP017076

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

833023 : 948168

Bacillus_phage(12.5%)

coat,integrase,transposase

attL 889068:889086|attR 957701:957716

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008828678.1\|833023_833581_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_069709436.1\|833612_834140_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_083274788.1\|834158_834944_+	molecular chaperone	NA	NA	NA	NA
WP_083274789.1\|835055_837347_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_069709439.1\|837337_838372_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_083274790.1\|838380_839238_-	shikimate 5-dehydrogenase	NA	NA	NA	NA
WP_069709440.1\|839234_840242_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_069709582.1\|840385_842896_+	phosphoenolpyruvate--protein phosphotransferase	NA	NA	NA	NA
WP_069709441.1\|842895_843864_+	1-phosphofructokinase	NA	NA	NA	NA
WP_069709442.1\|843860_845561_+	PTS fructose transporter subunit IIBC	NA	NA	NA	NA
WP_008831515.1\|845608_846925_+	carbohydrate porin	NA	NA	NA	NA
WP_008831514.1\|846969_848232_-	TolC family protein	NA	NA	NA	NA
WP_069709443.1\|848228_851318_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	6.4e-72	25.1
WP_008831512.1\|851326_852415_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_008831511.1\|852516_853188_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.8e-22	31.4
WP_081799263.1\|853180_854569_+	sensor histidine kinase	W8CYF6	Bacillus_phage	1.3e-19	26.1
WP_081799262.1\|854693_855527_-	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	2.3e-08	27.6
WP_069709444.1\|855546_856884_-	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_036530941.1\|856991_857660_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_008831849.1\|857873_858260_+	hypothetical protein	NA	NA	NA	NA
WP_008831848.1\|858453_859707_-	amidohydrolase family protein	NA	NA	NA	NA
WP_008831847.1\|859703_861149_-	amidohydrolase family protein	NA	NA	NA	NA
WP_036530940.1\|861145_861742_-	FMN-binding negative transcriptional regulator	NA	NA	NA	NA
WP_036530939.1\|861934_863407_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	4.3e-18	26.9
WP_036530938.1\|863504_864005_+	hypothetical protein	NA	NA	NA	NA
WP_008831843.1\|864027_865689_+	amidohydrolase	NA	NA	NA	NA
WP_036530935.1\|865955_868172_+	TonB-dependent receptor	NA	NA	NA	NA
WP_008833401.1\|868242_868494_-	hypothetical protein	NA	NA	NA	NA
WP_036530932.1\|868680_868899_+	hypothetical protein	NA	NA	NA	NA
WP_069709445.1\|869366_870362_-	hypothetical protein	NA	NA	NA	NA
WP_069709583.1\|871093_872053_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_008831620.1\|872415_875151_-	TonB-dependent receptor	NA	NA	NA	NA
WP_083274805.1\|875424_877197_+	dihydroxy-acid dehydratase family protein	NA	NA	NA	NA
WP_008831622.1\|877196_878066_+	SMP-30/gluconolactonase/LRE family protein	NA	NA	NA	NA
WP_008831623.1\|878202_879342_+	galactose mutarotase	NA	NA	NA	NA
WP_069709446.1\|879355_880504_+	cellulase family glycosylhydrolase	NA	NA	NA	NA
WP_008831626.1\|881113_882148_-	family 43 glycosylhydrolase	NA	NA	NA	NA
WP_008831627.1\|882144_882780_-	2-dehydro-3-deoxy-6-phosphogalactonate aldolase	NA	NA	NA	NA
WP_036530969.1\|882776_883646_-	2-dehydro-3-deoxygalactonokinase	NA	NA	NA	NA
WP_008831629.1\|883642_885229_-	sodium/solute symporter	A0A240F3J2	Aeromonas_phage	5.4e-83	38.7
WP_008831630.1\|885443_886520_+	family 43 glycosylhydrolase	NA	NA	NA	NA
WP_036530980.1\|886711_887428_+	FadR family transcriptional regulator	NA	NA	NA	NA
WP_036530970.1\|887515_888442_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
889068:889086	attL	NA	NA	NA	NA
WP_051587245.1\|889194_890055_+\|integrase	tyrosine-type recombinase/integrase	A0A1P8DJJ6	Virus_Rctr41k	5.1e-27	30.4
887738:887753	attL	NA	NA	NA	NA
WP_051587245.1\|889194_890055_+\|integrase	tyrosine-type recombinase/integrase	A0A1P8DJJ6	Virus_Rctr41k	5.1e-27	30.4
WP_036530972.1\|890142_891678_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_156799947.1\|893465_893609_+	hypothetical protein	NA	NA	NA	NA
WP_069709447.1\|893807_894839_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_069709448.1\|895119_895380_-	hypothetical protein	NA	NA	NA	NA
WP_036531096.1\|895913_897107_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_036531095.1\|897110_898022_-\|integrase	tyrosine-type recombinase/integrase	A0A1P8DJJ6	Virus_Rctr41k	1.2e-31	31.8
WP_036531082.1\|898216_900994_-	relaxase domain-containing protein	NA	NA	NA	NA
898131:898149	attR	NA	NA	NA	NA
WP_051587252.1\|900994_902851_-	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
898131:898149	attR	NA	NA	NA	NA
WP_155986507.1\|902880_903291_-	hypothetical protein	NA	NA	NA	NA
WP_036531077.1\|903515_903887_+	hypothetical protein	NA	NA	NA	NA
WP_036531074.1\|903883_904891_+	hypothetical protein	NA	NA	NA	NA
WP_036531071.1\|904871_905363_+	hypothetical protein	NA	NA	NA	NA
WP_155986506.1\|905717_906320_+	hypothetical protein	NA	NA	NA	NA
WP_036531068.1\|906451_906736_-	hypothetical protein	NA	NA	NA	NA
WP_036531066.1\|906732_907620_-	DUF1738 domain-containing protein	A0A1V0EEV1	Caulobacter_phage	1.3e-49	38.9
WP_069709449.1\|908452_908929_+	MucR family transcriptional regulator	A0A1P8VVG0	Erythrobacter_phage	9.1e-26	46.9
WP_036531062.1\|909027_909282_+	hypothetical protein	NA	NA	NA	NA
WP_036530815.1\|909518_909938_-\|transposase	IS200/IS605 family transposase	G9CU69	Helicobacter_phage	1.7e-20	37.4
WP_037520338.1\|910709_912194_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_156799948.1\|912247_913561_+	hypothetical protein	NA	NA	NA	NA
WP_069709450.1\|913553_914069_+	hypothetical protein	NA	NA	NA	NA
WP_036528180.1\|914065_915961_+	AAA family ATPase	NA	NA	NA	NA
WP_036528181.1\|916188_916977_-	hypothetical protein	NA	NA	NA	NA
WP_036528183.1\|921813_922056_-	hypothetical protein	NA	NA	NA	NA
WP_036528184.1\|922188_923082_-	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	9.2e-64	47.0
WP_036528209.1\|923522_923969_+	PA2169 family four-helix-bundle protein	NA	NA	NA	NA
WP_036528186.1\|924154_925606_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_156799959.1\|925667_926333_-	transcriptional initiation protein Tat	NA	NA	NA	NA
WP_036528187.1\|927051_927360_-	hypothetical protein	NA	NA	NA	NA
WP_051587028.1\|927540_928161_-	urea carboxylase-associated family protein	NA	NA	NA	NA
WP_036528216.1\|929534_930092_+	PRC-barrel domain-containing protein	NA	NA	NA	NA
WP_051587029.1\|930249_930780_+	hemerythrin	NA	NA	NA	NA
WP_036528191.1\|930820_931360_+	hypothetical protein	NA	NA	NA	NA
WP_051587030.1\|931403_932981_-	PAS domain S-box protein	NA	NA	NA	NA
WP_036528192.1\|932980_933349_-	response regulator	NA	NA	NA	NA
WP_036528221.1\|933386_934796_-	serine/threonine protein kinase	NA	NA	NA	NA
WP_036528194.1\|935126_936062_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	1.4e-30	32.4
WP_036528196.1\|936273_938784_-	DNA ligase D	A0A291AUP8	Sinorhizobium_phage	8.1e-57	40.7
WP_036528198.1\|938878_939289_-	low affinity iron permease family protein	NA	NA	NA	NA
WP_036528199.1\|939351_940008_-	hypothetical protein	NA	NA	NA	NA
WP_036528201.1\|940078_940684_-	cysteine hydrolase	NA	NA	NA	NA
WP_081799133.1\|940732_940921_-	DUF3606 domain-containing protein	NA	NA	NA	NA
WP_036528202.1\|941039_941954_+	NAD(P)/FAD-dependent oxidoreductase	A0A2I2L5E1	Orpheovirus	2.6e-13	26.2
WP_081799134.1\|942030_944616_-	PAS domain-containing protein	B5LWN8	Feldmannia_species_virus	2.7e-07	26.4
WP_036528223.1\|945057_946632_-	hypothetical protein	NA	NA	NA	NA
WP_069709452.1\|946848_948168_-\|integrase	site-specific integrase	NA	NA	NA	NA
957701:957716	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1533856 : 1575053

Lactococcus_phage(20.0%)

integrase,protease,transposase

attL 1523502:1523518|attR 1568577:1568593

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1523502:1523518	attL	NA	NA	NA	NA
WP_069709531.1\|1533856_1535938_+\|protease	BREX system Lon protease-like protein BrxL	NA	NA	NA	NA
WP_069709532.1\|1536062_1538609_+	PD-(D/E)XK nuclease family protein	NA	NA	NA	NA
WP_069709533.1\|1538605_1541812_+	UvrD-helicase domain-containing protein	NA	NA	NA	NA
WP_069709534.1\|1541811_1543026_+	hypothetical protein	NA	NA	NA	NA
WP_036531279.1\|1543515_1544283_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	1.0e-42	39.7
WP_081799279.1\|1544279_1545773_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_069709536.1\|1547334_1549875_+	helicase	NA	NA	NA	NA
WP_069709537.1\|1550281_1551601_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_069709538.1\|1552124_1552499_-	nuclease	A0A0R6PHV6	Moraxella_phage	4.8e-06	29.7
WP_036526662.1\|1553595_1554069_+	Hsp20 family protein	A0A0C5AE28	Cyanophage	6.5e-24	44.7
WP_156799952.1\|1554631_1554817_-	hypothetical protein	NA	NA	NA	NA
WP_036526658.1\|1555190_1555478_+	hypothetical protein	NA	NA	NA	NA
WP_008831856.1\|1555991_1556186_+	hypothetical protein	NA	NA	NA	NA
WP_081799054.1\|1556874_1557186_+	integration host factor subunit alpha	Q2A099	Sodalis_phage	1.5e-08	36.0
WP_036526656.1\|1557188_1557371_-	hypothetical protein	NA	NA	NA	NA
WP_081799052.1\|1557369_1558047_+	DUF3320 domain-containing protein	NA	NA	NA	NA
WP_051586903.1\|1558029_1558353_-	hypothetical protein	NA	NA	NA	NA
WP_051586902.1\|1558344_1558659_+	hypothetical protein	NA	NA	NA	NA
WP_155986287.1\|1558957_1559776_-	hypothetical protein	NA	NA	NA	NA
WP_081799051.1\|1559779_1561699_-	AAA family ATPase	NA	NA	NA	NA
WP_081799050.1\|1561893_1563141_+\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	3.8e-39	42.2
WP_081799049.1\|1563481_1563697_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_036526652.1\|1564213_1564858_+	membrane protein	NA	NA	NA	NA
WP_156799953.1\|1564934_1565108_+	hypothetical protein	NA	NA	NA	NA
WP_036526650.1\|1565748_1566018_+	UPF0149 family protein	NA	NA	NA	NA
WP_036526648.1\|1566049_1566241_+\|transposase	transposase	NA	NA	NA	NA
WP_069709540.1\|1566738_1569375_+	TonB-dependent receptor	NA	NA	NA	NA
1568577:1568593	attR	NA	NA	NA	NA
WP_051586911.1\|1569404_1570505_+	hypothetical protein	NA	NA	NA	NA
WP_069709541.1\|1570506_1571691_+	hypothetical protein	NA	NA	NA	NA
WP_036526643.1\|1571769_1572186_-	VOC family protein	NA	NA	NA	NA
WP_051586899.1\|1572276_1573011_+	YafY family transcriptional regulator	NA	NA	NA	NA
WP_155986285.1\|1573347_1574349_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_036526716.1\|1574231_1575053_-\|transposase	IS5 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP017077

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

205633 : 247276

Acidithiobacillus_phage(22.22%)

integrase,transposase

attL 193376:193391|attR 253934:253949

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
193376:193391	attL	NA	NA	NA	NA
WP_037520338.1\|205633_207118_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_156799978.1\|207718_209818_-	PAS domain S-box protein	NA	NA	NA	NA
WP_069709746.1\|210186_211080_-	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	2.8e-60	45.2
WP_083274829.1\|211835_212276_+	DUF3597 domain-containing protein	NA	NA	NA	NA
WP_069709749.1\|212713_214384_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_036530018.1\|214380_214893_+	DUF1543 domain-containing protein	A0A2I2L4Z6	Orpheovirus	2.1e-20	36.7
WP_155986472.1\|214946_215198_-	hypothetical protein	NA	NA	NA	NA
WP_036530020.1\|215443_216262_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_069709750.1\|216529_217288_+	hypothetical protein	NA	NA	NA	NA
WP_036530022.1\|217327_218716_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_036530023.1\|218724_219819_+	alkene reductase	NA	NA	NA	NA
WP_069709751.1\|219917_220211_+	plasmid stabilization protein	NA	NA	NA	NA
WP_036530026.1\|220232_220814_+	flavin reductase family protein	NA	NA	NA	NA
WP_069709752.1\|221247_222357_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_083274830.1\|222737_223433_+\|transposase	transposase	NA	NA	NA	NA
WP_156799979.1\|223440_223902_-	response regulator	NA	NA	NA	NA
WP_156799980.1\|223828_224122_-	response regulator	NA	NA	NA	NA
WP_069709754.1\|225095_225971_+	phosphatidylserine decarboxylase	NA	NA	NA	NA
WP_156799981.1\|226389_226704_+	hypothetical protein	NA	NA	NA	NA
WP_156799982.1\|226779_227373_+	hypothetical protein	NA	NA	NA	NA
WP_069709757.1\|227379_227727_+	PAS domain-containing protein	NA	NA	NA	NA
WP_156799983.1\|227723_228122_+	hypothetical protein	NA	NA	NA	NA
WP_083274833.1\|228427_228673_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_069709759.1\|228849_229146_+	hypothetical protein	NA	NA	NA	NA
WP_069709760.1\|229386_229692_+	hypothetical protein	NA	NA	NA	NA
WP_083274834.1\|229723_230977_-	chloride channel protein	NA	NA	NA	NA
WP_069710188.1\|231006_232554_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	9.9e-122	44.3
WP_069709762.1\|232563_233304_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	3.3e-59	49.6
WP_069709763.1\|233456_233912_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_069709764.1\|234002_234449_+	hypothetical protein	NA	NA	NA	NA
WP_156799984.1\|234572_237374_-	EAL domain-containing protein	G3MA91	Bacillus_virus	8.0e-13	26.9
WP_083274923.1\|238097_238835_+	GGDEF domain-containing protein	G3MA91	Bacillus_virus	2.9e-23	33.7
WP_069709767.1\|239202_241230_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.3e-36	36.6
WP_069709768.1\|242882_244154_-\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	6.4e-10	40.4
WP_069709769.1\|244536_246609_-	recombinase family protein	A0A1B2LRQ3	Wolbachia_phage	2.1e-10	23.1
WP_069709770.1\|246598_246793_-	hypothetical protein	NA	NA	NA	NA
WP_083274838.1\|247135_247276_+\|integrase	integrase catalytic subunit	NA	NA	NA	NA
253934:253949	attR	NA	NA	NA	NA

DBSCAN-SWA_2

775246 : 870598

Acidithiobacillus_phage(14.29%)

integrase,protease,transposase

attL 779495:779510|attR 875393:875408

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069710076.1\|775246_776794_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	4.0e-123	44.9
WP_069710077.1\|776804_777545_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	1.9e-59	50.0
WP_008829143.1\|777940_778435_-	nucleoside deaminase	NA	NA	NA	NA
WP_156800036.1\|779131_779389_-	hypothetical protein	NA	NA	NA	NA
779495:779510	attL	NA	NA	NA	NA
WP_008833389.1\|779970_780726_-	hypothetical protein	NA	NA	NA	NA
779495:779510	attL	NA	NA	NA	NA
WP_008833390.1\|780886_781144_+	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_008833391.1\|781140_781437_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_069710079.1\|782186_782768_-	hypothetical protein	NA	NA	NA	NA
WP_156800037.1\|782980_783424_+	hypothetical protein	NA	NA	NA	NA
WP_083274899.1\|783563_783824_-	hypothetical protein	NA	NA	NA	NA
WP_069710080.1\|784143_784572_+	DUF983 domain-containing protein	NA	NA	NA	NA
WP_069710081.1\|784573_784912_+	hypothetical protein	NA	NA	NA	NA
WP_069710082.1\|784949_786338_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_037522013.1\|786589_787039_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_069710083.1\|787090_787837_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.7e-18	34.6
WP_069710084.1\|787964_788873_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_037517261.1\|789036_789594_-	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_037517263.1\|789714_790263_-	hypothetical protein	NA	NA	NA	NA
WP_069710085.1\|790367_790979_-	lytic transglycosylase	NA	NA	NA	NA
WP_069710086.1\|790968_793926_-	relaxase domain-containing protein	NA	NA	NA	NA
WP_008827966.1\|793922_795932_-	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_008827967.1\|795928_796228_-	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_083274900.1\|796796_798047_+\|integrase	site-specific integrase	A0A221SAN4	Ralstonia_phage	7.9e-21	26.1
WP_083274901.1\|798003_799230_+\|integrase	tyrosine-type recombinase/integrase	A0A221SAN4	Ralstonia_phage	7.3e-27	30.0
WP_069710089.1\|799226_799484_+	hypothetical protein	NA	NA	NA	NA
WP_069710090.1\|799547_800477_+	HEPN domain-containing protein	NA	NA	NA	NA
WP_156800038.1\|800519_801227_+	hypothetical protein	NA	NA	NA	NA
WP_156800039.1\|801223_802090_+	hypothetical protein	NA	NA	NA	NA
WP_156800040.1\|802412_803641_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	6.0e-98	62.0
WP_083274902.1\|804013_805237_+\|protease	26S protease regulatory subunit	E5ESM9	Bathycoccus_sp._RCC1105_virus	4.2e-35	40.1
WP_156800041.1\|805208_806621_+	hypothetical protein	NA	NA	NA	NA
WP_008827974.1\|806817_807177_+\|transposase	transposase	NA	NA	NA	NA
WP_069710093.1\|807173_807521_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	1.7e-29	52.8
WP_069710094.1\|807609_809256_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	2.6e-96	40.3
808298:808313	attR	NA	NA	NA	NA
WP_069710095.1\|810465_810690_-	hypothetical protein	NA	NA	NA	NA
808298:808313	attR	NA	NA	NA	NA
WP_069710096.1\|811091_811517_+	hypothetical protein	NA	NA	NA	NA
WP_008832418.1\|811702_812023_-	DUF736 family protein	NA	NA	NA	NA
WP_069710097.1\|812484_812772_-	putative addiction module antidote protein	NA	NA	NA	NA
WP_069710098.1\|812768_813098_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	6.5e-23	56.8
WP_008831236.1\|813342_815172_-	ParB/RepB/Spo0J family partition protein	A0A1C9EHW0	Gordonia_phage	2.8e-06	29.2
WP_008831237.1\|815263_815674_-	DUF2958 domain-containing protein	NA	NA	NA	NA
WP_008831238.1\|815670_816690_-	DUF1738 domain-containing protein	A0A1V0EEV1	Caulobacter_phage	2.8e-56	39.5
WP_069710099.1\|817189_817585_+	thermonuclease family protein	NA	NA	NA	NA
WP_069710242.1\|817960_818209_+	hypothetical protein	NA	NA	NA	NA
WP_156800042.1\|818232_818451_-	hypothetical protein	NA	NA	NA	NA
WP_069710101.1\|818842_820081_+	hypothetical protein	NA	NA	NA	NA
WP_156800043.1\|820452_820806_+	hypothetical protein	NA	NA	NA	NA
WP_156800044.1\|820907_821081_-	hypothetical protein	NA	NA	NA	NA
WP_069710102.1\|821168_822650_-	alginate export family protein	NA	NA	NA	NA
WP_008833632.1\|822736_824044_-	MFS transporter	NA	NA	NA	NA
WP_008833631.1\|824155_825421_-	gallate dioxygenase	NA	NA	NA	NA
WP_008833630.1\|825489_826608_-	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_008833629.1\|826628_827600_-	oxidoreductase	NA	NA	NA	NA
WP_008833628.1\|827744_828950_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_008833627.1\|829013_830033_-	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_083274904.1\|830049_831186_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_008833625.1\|831215_832406_-	lactonase family protein	NA	NA	NA	NA
WP_008833624.1\|832402_833521_-	xylose isomerase	NA	NA	NA	NA
WP_069710103.1\|833522_833990_-	hypothetical protein	NA	NA	NA	NA
WP_008833622.1\|834023_835283_-	nucleoside:proton symporter	NA	NA	NA	NA
WP_008833621.1\|835310_836975_-	GMC family oxidoreductase	NA	NA	NA	NA
WP_008833620.1\|837040_839191_-	TonB-dependent receptor	NA	NA	NA	NA
WP_083274905.1\|839381_840743_+	ROK family transcriptional regulator	NA	NA	NA	NA
WP_008833618.1\|840739_841483_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_156800045.1\|841536_842850_-	MFS transporter	NA	NA	NA	NA
WP_069710104.1\|843045_845190_+	TonB-dependent receptor	NA	NA	NA	NA
WP_069710105.1\|845310_847296_+	glycoside hydrolase family 3 protein	NA	NA	NA	NA
WP_008833614.1\|847310_848345_-	4-oxalomesaconate tautomerase	NA	NA	NA	NA
WP_008833613.1\|848424_849099_-	4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase	NA	NA	NA	NA
WP_037522464.1\|849197_850361_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_008833610.1\|850428_851286_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_008833609.1\|851289_852315_+	amidohydrolase	NA	NA	NA	NA
WP_156800046.1\|854016_854349_+	hypothetical protein	NA	NA	NA	NA
WP_008828813.1\|854411_854651_+	hypothetical protein	NA	NA	NA	NA
WP_008828812.1\|854869_855829_-	DUF2493 domain-containing protein	G1DB78	Mycobacterium_phage	4.7e-05	33.3
WP_156800004.1\|856057_857116_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_008828811.1\|857684_857900_-	hypothetical protein	NA	NA	NA	NA
WP_008828810.1\|857899_858898_-	DUF2493 domain-containing protein	NA	NA	NA	NA
WP_008828809.1\|858966_859428_-	DUF736 domain-containing protein	NA	NA	NA	NA
WP_008828807.1\|859886_860309_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_008828806.1\|860308_860572_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_008828805.1\|860821_861217_+	hypothetical protein	NA	NA	NA	NA
WP_008828804.1\|861277_861835_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2D1GQP4	Pseudomonas_phage	7.6e-24	41.1
WP_008828803.1\|861831_862146_-	hypothetical protein	NA	NA	NA	NA
WP_156800047.1\|862229_862379_-	hypothetical protein	NA	NA	NA	NA
WP_037518161.1\|862371_862620_-	hypothetical protein	NA	NA	NA	NA
WP_156800048.1\|862716_863220_-	hypothetical protein	NA	NA	NA	NA
WP_083274934.1\|863413_863872_-	hypothetical protein	NA	NA	NA	NA
WP_037518151.1\|863855_865664_-\|integrase	integrase	NA	NA	NA	NA
WP_069710107.1\|865668_867489_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_069710108.1\|867481_868624_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_069710109.1\|869028_869466_-	hypothetical protein	NA	NA	NA	NA
WP_156800049.1\|869538_870598_-\|transposase	IS630 family transposase	NA	NA	NA	NA
875393:875408	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP017075

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP017075_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017075_1

1040637-1040731

Orphan

Consensus_repeat	Method
GCCCCTCCCGCAAGCGGGAGGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP017075_1

>merge|NZ_CP017075|1|1040637-1040731|CRISPRCasFinder
GCCCCTCCCGCAAGCGGGAGGGGGACCGACCATTTCGCCCCTCCCGCAAGCGGGAGGGGGACCGACCATTTCGCCCCTCCCGCAAGCGGGAGGGG

>NZ_CP017075|1|1|1040637-1040731|CRISPRCasFinder
GCCCCTCCCGCAAGCGGGAGGGG	GACCGACCATTTCGCCCCTCCCGCAAGCGGGAGGGGGACCGACCATTTC
GCCCCTCCCGCAAGCGGGAGGGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017075.1\|WP_008833354.1\|1052414_1053461_-\|dihydrodipicolinate-reductase	unknown	unknown	gnl\|CDD\|226326
NZ_CP017075.1\|WP_008829498.1\|1036740_1037601_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|372651
NZ_CP017075.1\|WP_008832182.1\|1044188_1044440_+\|translation-initiation-factor-IF-1	unknown	unknown	gnl\|CDD\|178954
NZ_CP017075.1\|WP_008832185.1\|1046007_1046199_+\|DNA-gyrase-inhibitor-YacG	unknown	unknown	gnl\|CDD\|234943
NZ_CP017075.1\|WP_083274733.1\|1035661_1036744_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379214
NZ_CP017075.1\|WP_081798955.1\|1040754_1041360_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|240291
NZ_CP017075.1\|WP_008829499.1\|1037697_1037919_+\|DUF2061-domain-containing-protein	unknown	unknown	gnl\|CDD\|378262
NZ_CP017075.1\|WP_037518833.1\|1038633_1040577_-\|excinuclease-ABC-subunit-UvrC	unknown	unknown	gnl\|CDD\|234792
NZ_CP017075.1\|WP_069707735.1\|1051011_1052424_+\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|273830
NZ_CP017075.1\|WP_008829492.1\|1029852_1030506_+\|ATP-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|234971
NZ_CP017075.1\|WP_008829494.1\|1031791_1032235_+\|transcription-antitermination-factor-NusB	unknown	unknown	gnl\|CDD\|234686
NZ_CP017075.1\|WP_051211564.1\|1046623_1047802_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|184990
NZ_CP017075.1\|WP_156799765.1\|1053553_1055824_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|238657
NZ_CP017075.1\|WP_008832184.1\|1045036_1046011_+\|ribonuclease	unknown	unknown	gnl\|CDD\|224447
NZ_CP017075.1\|WP_008829500.1\|1037926_1038541_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017075.1\|WP_008829493.1\|1030505_1031795_+\|histidinol-dehydrogenase	unknown	unknown	gnl\|CDD\|234853
NZ_CP017075.1\|WP_008832187.1\|1047808_1051015_+\|multidrug-efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|273335
NZ_CP017075.1\|WP_081798954.1\|1044420_1045044_+\|septum-formation-protein-Maf	unknown	unknown	gnl\|CDD\|376812
NZ_CP017075.1\|WP_008829496.1\|1033359_1035453_+\|sodium-translocating-pyrophosphatase	unknown	unknown	gnl\|CDD\|234827
NZ_CP017075.1\|WP_008829495.1\|1032250_1033210_+\|thiamine-phosphate-kinase	unknown	unknown	gnl\|CDD\|100030

Protein	Function_ID	Function_description	E-value
NZ_CP017075.1\|WP_008833354.1\|1052414_1053461_-\|dihydrodipicolinate-reductase	gnl\|CDD\|226326	COG3804, COG3804, Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown].	9.996e-59
NZ_CP017075.1\|WP_008829498.1\|1036740_1037601_+\|transcriptional-regulator	gnl\|CDD\|372651	pfam13621, Cupin_8, Cupin-like domain. This cupin like domain shares similarity to the JmjC domain.	8.96261e-05
NZ_CP017075.1\|WP_008832182.1\|1044188_1044440_+\|translation-initiation-factor-IF-1	gnl\|CDD\|178954	PRK00276, infA, translation initiation factor IF-1; Validated.	6.18733e-46
NZ_CP017075.1\|WP_008832185.1\|1046007_1046199_+\|DNA-gyrase-inhibitor-YacG	gnl\|CDD\|234943	PRK01343, PRK01343, zinc-binding protein; Provisional.	7.9349e-12
NZ_CP017075.1\|WP_083274733.1\|1035661_1036744_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379214	pfam13480, Acetyltransf_6, Acetyltransferase (GNAT) domain. This family contains proteins with N-acetyltransferase functions.	1.13739e-17
NZ_CP017075.1\|WP_081798955.1\|1040754_1041360_-\|TonB-dependent-receptor	gnl\|CDD\|240291	PTZ00146, PTZ00146, fibrillarin; Provisional.	0.00427715
NZ_CP017075.1\|WP_008829499.1\|1037697_1037919_+\|DUF2061-domain-containing-protein	gnl\|CDD\|378262	pfam09834, DUF2061, Predicted membrane protein (DUF2061). This domain, found in various prokaryotic proteins, has no known function.	1.52232e-16
NZ_CP017075.1\|WP_037518833.1\|1038633_1040577_-\|excinuclease-ABC-subunit-UvrC	gnl\|CDD\|234792	PRK00558, uvrC, excinuclease ABC subunit UvrC.	0
NZ_CP017075.1\|WP_008829492.1\|1029852_1030506_+\|ATP-phosphoribosyltransferase	gnl\|CDD\|234971	PRK01686, hisG, ATP phosphoribosyltransferase catalytic subunit; Reviewed.	3.90037e-106
NZ_CP017075.1\|WP_008829494.1\|1031791_1032235_+\|transcription-antitermination-factor-NusB	gnl\|CDD\|234686	PRK00202, nusB, transcription antitermination factor NusB.	1.5726e-41
NZ_CP017075.1\|WP_051211564.1\|1046623_1047802_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|184990	PRK15030, PRK15030, multidrug efflux RND transporter periplasmic adaptor subunit AcrA.	9.55304e-96
NZ_CP017075.1\|WP_156799765.1\|1053553_1055824_-\|TonB-dependent-receptor	gnl\|CDD\|238657	cd01347, ligand_gated_channel, TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel. Energy (proton-motive force) and TonB-dependent conformational alteration of channel (parts of plug, and loops 7 and 8) allow passage of ligand. FepA residues 12-18 form the TonB box, which mediates the interaction with the TonB-containing inner membrane complex. TonB preferentially interacts with ligand-bound receptors. Transport thru the channel may resemble passage thru an air lock. In this model, ligand binding leads to closure of the extracellular end of pore, then a TonB-mediated signal facillitates opening of the interior side of pore, deforming the N-terminal plug and allowing passage of the ligand to the periplasm. Such a mechanism would prevent the free diffusion of small molecules thru the pore.	1.07216e-41
NZ_CP017075.1\|WP_008832184.1\|1045036_1046011_+\|ribonuclease	gnl\|CDD\|224447	COG1530, CafA, Ribonucleases G and E [Translation, ribosomal structure and biogenesis].	1.40978e-07
NZ_CP017075.1\|WP_069707735.1\|1051011_1052424_+\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	1.18688e-81
NZ_CP017075.1\|WP_008829493.1\|1030505_1031795_+\|histidinol-dehydrogenase	gnl\|CDD\|234853	PRK00877, hisD, bifunctional histidinal dehydrogenase/ histidinol dehydrogenase; Reviewed.	0
NZ_CP017075.1\|WP_008832187.1\|1047808_1051015_+\|multidrug-efflux-RND-transporter-permease-subunit	gnl\|CDD\|273335	TIGR00915, Probable_aminoglycoside_efflux_pump, The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family. Proteins scoring above the trusted cutoff (1000) form a tight clade within the RND (Resistance-Nodulation-Cell Division) superfamily. Proteins scoring greater than the noise cutoff (100) appear to form a larger clade, cleanly separated from more distant homologs that include cadmium/zinc/cobalt resistance transporters. This family is one of several subfamilies within the scope of pfam00873. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Unknown substrate].	0
NZ_CP017075.1\|WP_081798954.1\|1044420_1045044_+\|septum-formation-protein-Maf	gnl\|CDD\|376812	pfam02545, Maf, Maf-like protein. Maf is a putative inhibitor of septum formation in eukaryotes, bacteria, and archaea.	1.41458e-77
NZ_CP017075.1\|WP_008829496.1\|1033359_1035453_+\|sodium-translocating-pyrophosphatase	gnl\|CDD\|234827	PRK00733, hppA, membrane-bound proton-translocating pyrophosphatase; Validated.	0
NZ_CP017075.1\|WP_008829495.1\|1032250_1033210_+\|thiamine-phosphate-kinase	gnl\|CDD\|100030	cd02194, ThiL, ThiL (Thiamine-monophosphate kinase) plays a dual role in de novo biosynthesis and in salvage of exogenous thiamine. Thiamine salvage occurs in two steps, with thiamine kinase catalyzing the formation of thiamine phosphate, and ThiL catalyzing the conversion of this intermediate to thiamine pyrophosphate. The N-terminal domain of ThiL binds ATP and is related to the ATP-binding domains of hydrogen expression/formation protein HypE, the AIR synthases, FGAM synthase and selenophosphate synthetase (SelD).	7.97075e-91

>NZ_CP017075.1|WP_037518833.1|1038633_1040577_-|excinuclease-ABC-subunit-UvrC
MARTPAGTPEQPNHLERFNEERATYTVRGSDQPDLQAGVEVIRDTVRTLPAKPGVYRMQDARGDVLYVGKARVLRNRVANYTQWERLPGRLQRMVSQTRSMTIVTTNSEAEALLLEAQLIKRFRPAYNVLLRDDKSFPFILLRTDHEFPRIMKHRGARRMKGNYYGPFASAGSVNTTINALQKLFLLRSCTDSFFARRDRPCLLYQIKRCSAPCVDRIDEAGYKELVQEAKDFLGGKSNAVQRKIEAQMAEAAADLDFERAAMLRDRLRAATFIQGSQAINAEGLDNADIFAMASKGGQVGVQAFFIRGGQNWGHRAFFPTHTEGLSEEEVMQAFLAQFYEEVPPARCILVDRELPEAELIAEALRESAGGKVEISVPQRGNRRNLMMQATRNAVEALDRRQAERGTQAKVWREMADFLELPDLPQRVEVYDNSHISGTKALGAMVVAGPEGFQTSQYRKFNIKSAQTDDDYAMMREVMTRRFGRVQAEDPERTGGTWPDLVLIDGGKGQMNAVKDALEELGIEDVNLIAIAKGPHHGREGREVFHFPDGREKMLPVNSPVLFHLQRLRDEVHRFVIGAHRAKRSRAITASPLDEIPGIGPARKRALLLHFGTAGKVRAASLEDLRRAPGVSVAVAQTIYDFYHPNG
>NZ_CP017075.1|WP_008829500.1|1037926_1038541_-|hypothetical-protein
MVTLSPLAIAVGVIALAVLVGVVVTVMRSRHTARLRDRFGDEYDRTIDQSGSTYEAETVLYEREQRVAAFDIRPLEPARREAFVRAWLEVQAQFVDDPAGAVQRADVLLADVMTARGYPVADFDQRYEDLSVDHGEVVAHYRTGHHIAASHARGEAGTEELRRAMIHYRALFDDLVNEPEDFSPVIEHHGGRVHDLRKETTRRS
>NZ_CP017075.1|WP_008829499.1|1037697_1037919_+|DUF2061-domain-containing-protein
MTRDFAKTLSFLALHLMVGFTVAYLVTGSVTMAGGIALIEPMVNAVVFFFHERAWRSGDTSFTALRRHRHAAV
>NZ_CP017075.1|WP_008829498.1|1036740_1037601_+|transcriptional-regulator
MNVPTLLQASPVFADTARHDFASHYPEVPHKLTHALGAHPLMELEALARLAEVLPPASVEYNASDQPIGIEGKPGPTGIPIGETIRHIETTRSWAVLKNVEQDPAYAALLEALLAEIRPAIEARTGRMLKTQAFVFVTSAGGVTPYHFDPEHNILMQVRGSKVMTQFPAGDPTFAPDEIHETYHTGGGRELKWRDDLLAGGREFPLAPGEALYVPVMAPHFVRNGPEPSVSLSITWRSEWSFAEADARAFNGLLRRCGLKPTAPGRWPDRNRTKATGWRIARKLGL
>NZ_CP017075.1|WP_083274733.1|1035661_1036744_+|GNAT-family-N-acetyltransferase
MPWRALESEVDAWDRLTGNASEPNPFFESWYLLPSLRHLPDTDAVTILRFEQDGQLVGLLPVAPSRRYYRWPMPHLSSWLHANCFCGVPLVARGAEVPFWQAVLSWADTRPDAALFMHLRGMMLGGPLHAALDAVAAQDARQIEIVHREARAMLASDLSPETYLEAALSSKKRKELRRQANRLAEEGAIAFEHSTDARDVARWCTDFLALEAAGWKGKAGSALASSERTERMFRESLEGAALRGRLERLSLTLDGRPVAMLATFLTAPGAYSYKTAFDETYARFSPGVLLQRENLAMLDRADIAWTDSCASADHPMIDHLWRERRDIGRLSIAIGGRLRRAAFRQFVRAETARHPAGHRP
>NZ_CP017075.1|WP_008829496.1|1033359_1035453_+|sodium-translocating-pyrophosphatase
MNLITIAIVLGLLAIVYGFVTSRQVLSAPAGSEKMQEIAAAIQEGAQAYLKRQYSTIAVVGVIVAIILAFTLGAISATGFVIGAILSGFAGFIGMNISVRANVRTAAAAQKGLQEGLTLAFRAGAITGMLVAGLALLAIAVFYWYLTGPAGHTVGGDDRTVVEALTALAFGASLISIFARLGGGIFTKAADVGADLVGKVEAGIPEDDPRNPAVIADNVGDNVGDCAGMAADLFETYVVTVGATMVLTALLLKGAGNLSAMMALPLLIGGVCIVTSIIGTYFVRLGSSQNIMGAMYKGFLVTAVLSIPAIWWAISHALGDMEAVIGNGDLNGRTLFYCALVGLAITGLIIWITEYYTGTDYRPVRSIAKASVTGHGTNVIQGLAISLEATALPTIVIVAGIIIAYQLAGLLGIAYAATAMLALAGMVVALDAYGPVTDNAGGIAEMAGLDDAVREKTDALDAVGNTTKAVTKGYAIGSAGLAALVLFAAYTTDLKEFFPALNVDFSLENPYVIVGLLLGALLPYLFGAMGMTAVGRAAGDVVVDVREQFREKPGIMTYAEKPDYARTVDLVTKAAIKEMIVPSLLPVLAPIVVYFVITAVAGRENGFAALGALLLGVIVSGLFVALSMTSGGGAWDNAKKFIEDGNYGGKGSEAHKAAVTGDTVGDPYKDTAGPAVNPMIKITNIVALLLLAAMAAG
>NZ_CP017075.1|WP_008829495.1|1032250_1033210_+|thiamine-phosphate-kinase
MTGEAAFIHALRAIATAPAARRLADDAAVLRIGGEALVLTMDTVVEGVHYLPNDPPQDVAWKLVAVNVSDLSAKGATPAGCLYSHALGASAWDTAFLAGLDEACRRFAIPLLGGDTVRMPDGAPRSFSLTALGTGAKGCPVPSRTAARPGDRVWVSGTIGDAGLGLKAALGDLDGDASALTALLARYRRPAPEPRLGVALAPLVHAMMDVSDGLMVDASRMAEASAVGVTLDVGAVPLSAAFRAVAGEVLEVRLAAMAAGDDYELLFTAPLENTARILEAASTLNRQVTAIGTIEAGAGLSLHHEGAALPLPERLGYQH
>NZ_CP017075.1|WP_008829494.1|1031791_1032235_+|transcription-antitermination-factor-NusB
MSNPKQKRAAARLAAVQALYQFDMEGTPMASLLDEFHRHRLGMEIDDAQFAQAEVAFFDDVVKGTIARRDEIDELLASKLTEGWSLGRLDKTMLQIMRAGAYELMARADIPTGAAISEYLDVCHAFFDPREAKFLNGVLDSVAKSVR
>NZ_CP017075.1|WP_008829493.1|1030505_1031795_+|histidinol-dehydrogenase
MLRLSAKDPGFAEAFARVVSDRRESAVDVAADVAAILRDVRERGDAALADLTAKFDGHDLDQTGWNVDAATCKAAFDALEPTLRAALELAAERIRAYHAAQLPENRDYTDAAGVRLGATWNAVDAAGLYVPGGRAAYPSSLLMNAIPAKVAGVERLVVVTPTPKGEVNPLVLAAAHLAGVDEVWRVGGAHAVGALAYGTDRIAPVDVVTGPGNAWVAEAKRQLYGVVGIDMVAGPSEILVIADAKNEPRRIAADLLSQAEHDPTSQSILITDDAAYADAVAEAVELELAALATEKTARESWNVNGVIIDVASFDEAPALANALAAEHVEIATDDPESLMRRIRHAGSVFLGRMTPEAVGDYVAGPNHVLPTGRRARFSSGLSVLDFMKRTSFIQLDAAALEAIGPAAVALAEAEGLPAHARSISVRLNS
>NZ_CP017075.1|WP_008829492.1|1029852_1030506_+|ATP-phosphoribosyltransferase
MPTPLTFAVPKGRILDEALPLMARAGVTPEAEFHDKKSRALSFACENSDMRLIRVRAFDVATFVAHGAAQVGIVGSDVVEEFAYSDLYAPVDLNIGHCRLSVAEKVGETGGALPSHLRIASKYPNLTRRHFEKLGVQAEVVKLNGAMELAPCLGLSSRIVDLVSTGRTLKENGLVETSRILDISARLIVNRAALKTDERVAALVEAFRALVAEKEAA
>NZ_CP017075.1|WP_081798955.1|1040754_1041360_-|TonB-dependent-receptor
MASNAGERGAGGTRAESGGRGPGGGPGGPPGGGFGPPGGRNGSRWNLSIYHTWRFTDTILIAPGVPVLDQLNGNSTSAGGTPRHTIEAEGGLFKNGYGLRLKGEWNAPARVDGSGAPGSQDLRFGSTFDVSLRIFADLGRNEDLVSKMPFFKGSRLSLKANNLLDSRQKVTDQNGLTPIAYQPAYREPQGRVLGIDFRKMF
>NZ_CP017075.1|WP_008832182.1|1044188_1044440_+|translation-initiation-factor-IF-1
MAKEELLEMRGRVVELLPNAMFRVELENGHEILGHTAGKMRKNRIRVLVGDEVLCELTPYDLTKGRITYRFMPGRGGPGQFGS
>NZ_CP017075.1|WP_081798954.1|1044420_1045044_+|septum-formation-protein-Maf
MASSGPDLTAADLSAGHGAPRLVLASASPRRRELLSRIGMSDFTVEAADIDETAHPREVPRDYARRMAREKALALPPGDAFVLAGDTVVACGRRVLPKAEDEKTARECLALLSGRRHRVLSAIALRAPGGTLHERLNETIVRFKQLSKDEVEAYIAGGEWEGKAGGYAIQGSAEGLIAWISGSHSGVVGLPLFETRALLKGAGFPIG
>NZ_CP017075.1|WP_008832184.1|1045036_1046011_+|ribonuclease
MAEWLVEEGIGETRAILVDNGHVLAARLEWPGRLTAGEVADAVLVSRRAGASRGTVRFDSGEEAFVDGLPKSASEGARQRVLVTRAAMAETGRYKLAQTRASDLAPRPAPTLAESLRGGGLPVRKVRRFPDDPWPEIVAEALDGVIAFEGGSLVVTPTPAMTLIDIDGILPLAALALAAVPAIADAVGRLDLAGSIGIDFPSLERKDDRRAVDEALAEALDHWPHQRTAVNGFGFVQLVARLERPSIPQRVRAAPVAAAARLLMRSAEHVAEPGALLLTAHPAVRAATSEEWLADLARRTGRTIRWQEERTLALAAGFAQAVPL
>NZ_CP017075.1|WP_008832185.1|1046007_1046199_+|DNA-gyrase-inhibitor-YacG
MTLSERKCPICRKPRAAEFTPFCSKQCRDRDLLKWLDDGYALPGQPHDPEDFVGQEKNNPQDD
>NZ_CP017075.1|WP_051211564.1|1046623_1047802_+|efflux-RND-transporter-periplasmic-adaptor-subunit
MPVAALALAGVSLAACSGESSKGQQQRTAEVGYIVAQTSSVPLSATLSGRTVAFETSEVRPQVTGVIKRRFFTEGSTVKAGQPLFEIDPSLYRAAVNQAQANLASARATADAASVKAERYRPLADMEAVAKQDYTDALAASRTAKAAIAQNAATLDTAKINLRFTTVPAPISGKIGRQLFTVGALVSATQADPLAVIQRMDPIYVDMQQSAAELTSLRQRLAAGGVTPGSTEVHLMLDGGIRYPQAGTVQFSEVTVDQTTGTVTLRARFPNPDGLLLPGMFVTAMFDQASDPNAFLIPQNAVQRDFDGSAYVMLVGADNKATRRKVTADRTYNEFAVVTGGLKKGDKVIIQGLNGLRQGAPIKPVVSTAPQKVEPRKEGQGAETAQSGHKRG
>NZ_CP017075.1|WP_008832187.1|1047808_1051015_+|multidrug-efflux-RND-transporter-permease-subunit
MSRIFIDRPIFAWVLAIIVMLTGLGALNFLPNEQYPDIAPTQVNIRATYQGASAQTIENSVTQIIEQQLTGIDGLLYFSSESSNRGQATISATFAKGTDPDIAQVQVQNKVQSAIPRLPQTVQARGVTVTKSNADQLLLVAVYDETDQRSNQDVSDYLASNIQDPLSRVQGVGDVNVFGAPHAMRIWLDPRKLAAVALMPSDVTSAITAQNTEVAAGEIGGTPAVDDQAINAVVTAGSRLQTADQFRAIVLKTNPDGSVVTIGDVARVEIGADNYTAVSRVNGHPGAGISISLAPGADALRTAEAVKAKMQDLSAEMPDGLTYIYGSDSTTFIKLSVEEVEKALFEAIILVVIVMFVFLQSWRATLIPAIAVPVVLLGTFAVFYVMGFSINTMTLFGLVLAIGLLVDDAIVVVENVERLLEENPGMSPRDATIKSMEEIQVALVAIALVLSAVFLPMAFFGGSTGVIYRQFSLTIVTAMVLSVLVALILSPALTATLLKAKKPHGEEDHEPNWIERHLPWLARGWEKFHTWFNRSFERVTDAYVRKVDVVVAHKWRWLALFAVTCVGTFLLFQRLPTGFLPNEDQGNISVQWRLPAGTPRSRTEQVQREIEKYFTTYEKHNVAGMFSVAGGGRGASGQNSGQGFINLTDWSQRTDPKDSADAIVQRASAAFRSLRDAQVFVLVPGSVRGLGDSAGFTMELQNASGLSDDKFMAAREKLLAAASANDQLSGVRLSNLPDVSTLKINTDIRALTAFGLTPGNVNSTLSTAWGGTYVNDFIDKGRVKRVYVQGDAQFRSRPEDLAQWFVRGSGGQMAPFSAFSTVGWSTAPSSTSRFNGLPAYEFSGNAGSGVSSGTAMNVMEQLVSDIPGVSVAWAGASYQERLSSGQGPILYALSLLVVFLCLAALYESWSIPVAVILVIPLGLLGAIAFVTLRGLENDVYLQIGLLTTMGLAAKNAILMIEFAEQAERQGKRVIDAALEAAKIRLRPILMTSFAFIFGVLPLAIATGAGANSRVAIGTAVVGGMLTATILAIFYIPLFFVLVRRSVRDGLAAAHEKLQQRRGRSGDAA
>NZ_CP017075.1|WP_069707735.1|1051011_1052424_+|efflux-transporter-outer-membrane-subunit
MKRMSIRLMAGVLPALALGACSLAPKYVQPDLPVPASWPVGDAYLQQSEASLPVVSYKDIFRDPRLQSLVEEALANNRDLRVAAANVAAARAQVRVTRANQFPAVGISGSATDTETGGGFGLNGMSYSVQGGISSFELDLFGKLANATRSDRDTALATESAARTVRLGLVADLAQAWATYAADTDLLKLAQATAANAKDSVRLSSARLKGGVAARTELRQAEQVLETANGDLATQTAALAQDINAIRLLVGAEFDRALLPTGIDEVNSSLGEVPAGLSTQVLLRRPDVVQAEYQLRAANADIGVARAQLFPTISLSALIGFASQSLSSLFDTASRTTTLGADGSWSVFNAGGRKANVEVTKAQRDAALATYEKAIQTAFRETADALADQGTLTERLRAATAFTSAAQDAATLTEASYRRGIVGSLDNLVAQRSLYSARQAEIAVRLTQAGNRIALYRVLGGDQATAPAQP
>NZ_CP017075.1|WP_008833354.1|1052414_1053461_-|dihydrodipicolinate-reductase
MSQDANRTWRVVQWATGNVGSRALRMVIEHPRMELVGLWVNSAEKVGKDAGELCGLAETGIKATNSLDEIVALDADCVLFMPQGTDWDALCALLASGKNVVTTRCDFHYPPLIDPGNRARIEEACAAGGTSIHSTGSSPGFVTEALAIPLLSLQRGHGLLTIDEYGDVSSRNSPDMLFNIMGFAAPMAPFDQHRAEHLKGDFGSSLSQIAEAIGLPCDEIEAVGELSAARHDVEIAAGRIPAGTVGAMRTTITCMHKGRPILRFRANWYATTDIEHDWNLRESGWRVTTEGDTPVKVDITFPVAEEDYAAYTPGLTAHRPINAIPAVCAAAPGIRTTVELPQIVPLYG
>NZ_CP017075.1|WP_156799765.1|1053553_1055824_-|TonB-dependent-receptor
MEHVTTSCSLASKADGRDIVKTAGTFASIFALAVVAPVSVHAQEAQNAAAADEGAIIVTAQRRAEAQVDVPISITNLSSDALKTASVQQLADIGKVTPALRFDFAGGFFQPTIRGIGTAVTTSGGGGNVGIYIDGFYSPNPLAADFDLISVNSIQVLKGPQGTLFGRNTTGGAILVTTREPSTSGNAFEGRVTYGRYNEAKAEAFTNYVISDRVALSLEGQYRRGNGWQRDISNDDRRVGDYENWSFRLGLKAELTDTVDVLLRYKHGQVDDPSTMLASSLDTSDFGLGAPFGGVPGTYTTAKNRIASGSVPEVFRSNTDVVQGTIRADLGFADLTSYSQYRSENSFMSQDLDYSGLDLFQLGLPNLNETWSQELLLTSKAGPKLQWTAGLFYFQNTDTYITYINNGGNAPDQRIRLGGSSTTVRSYAAFLDATYEITPQLFLTAGARYSIDKIVDAYWNQQFLLTEMPVPNISNNKLTPRVVLRYKPTDRTSIYASFTKGYKAAISDVGGSCQIPDTNYTCNRVQPEDINAYEVGFKYEDRGLSFEAAGFYYDYKNLQVSIYRTGTAEIINAATSEIYGLEGALHYQVTPAFQINAGASYVHARYKRFNNAPVYVRCSELGEETAATCAANGITFVVVPTTLEDVTMQRTPEFTGFVGARYETDLAGGELALSGNLFYSSSFFFGPSGVQFKQGGYETLALRAQWNAPDDKFHVAVFGDNVTNSRYLTQAQYSSFGIGANWSKPVTYGVEFGVKF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP017075_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017075_2

2945632-2945764

Orphan

Consensus_repeat	Method
CGGCCAGCGGTCCCAGCCTTCGCTGGGATGACGAGCGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP017075_2

>merge|NZ_CP017075|2|2945632-2945764|CRISPRCasFinder
CGGCCAGCGGTCCCAGCCTTCGCTGGGATGACGAGCGTTTTTGAGCGGACGTTGCGTGCTTGCCGCATACGCCCAGCCCGCAGCGTTCAGCACGGCGGCCAGCGGTCCCAGCCTTCGCTGGGATGACGGGCGT

>NZ_CP017075|2|2|2945632-2945764|CRISPRCasFinder
CGGCCAGCGGTCCCAGCCTTCGCTGGGATGACGAGCGT	TTTTGAGCGGACGTTGCGTGCTTGCCGCATACGCCCAGCCCGCAGCGTTCAGCACGG
CGGCCAGCGGTCCCAGCCTTCGCTGGGATGACGGGCGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017075.1\|WP_036525606.1\|2944838_2945057_-\|DUF1192-domain-containing-protein	unknown	unknown	gnl\|CDD\|369041
NZ_CP017075.1\|WP_069708641.1\|2946908_2947910_+\|NAD(P)H-quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|176180
NZ_CP017075.1\|WP_069708634.1\|2937882_2938443_+\|gamma-carbonic-anhydrase-family-protein	unknown	unknown	gnl\|CDD\|100051
NZ_CP017075.1\|WP_069708637.1\|2939304_2940897_-\|cisplatin-damage-response-ATP-dependent-DNA-ligase	unknown	unknown	gnl\|CDD\|274993
NZ_CP017075.1\|WP_008831383.1\|2952906_2953308_+\|ribosome-silencing-factor	unknown	unknown	gnl\|CDD\|272901
NZ_CP017075.1\|WP_069708638.1\|2941095_2942100_-\|ligase-associated-DNA-damage-response-exonuclease	unknown	unknown	gnl\|CDD\|274995
NZ_CP017075.1\|WP_156799926.1\|2952127_2952793_+\|nicotinate-nucleotide-adenylyltransferase	unknown	unknown	gnl\|CDD\|234611
NZ_CP017075.1\|WP_036525608.1\|2942292_2944665_-\|ATP-dependent-Clp-protease-ATP-binding-subunit-ClpA	unknown	unknown	gnl\|CDD\|274241
NZ_CP017075.1\|WP_069708640.1\|2945806_2946724_-\|VacJ-family-lipoprotein	unknown	unknown	gnl\|CDD\|377309
NZ_CP017075.1\|WP_083274678.1\|2935645_2937886_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017075.1\|WP_008831385.1\|2950829_2952119_+\|glutamate-5-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|234685
NZ_CP017075.1\|WP_069708636.1\|2938864_2939260_-\|group-II-truncated-hemoglobin	unknown	unknown	gnl\|CDD\|381282
NZ_CP017075.1\|WP_008831382.1\|2953420_2953846_+\|23S-rRNA-(pseudouridine(1915)-N(3))-methyltransferase-RlmH	unknown	unknown	gnl\|CDD\|349954
NZ_CP017075.1\|WP_008831388.1\|2948110_2948818_+\|DUF1013-domain-containing-protein	unknown	unknown	gnl\|CDD\|368812
NZ_CP017075.1\|WP_008831387.1\|2948987_2949434_-\|polymer-forming-cytoskeletal-protein	unknown	unknown	gnl\|CDD\|377376
NZ_CP017075.1\|WP_069708635.1\|2938442_2938721_+\|DUF167-domain-containing-protein	unknown	unknown	gnl\|CDD\|376843
NZ_CP017075.1\|WP_081799009.1\|2949435_2950518_-\|M23-family-metallopeptidase	unknown	unknown	gnl\|CDD\|366703
NZ_CP017075.1\|WP_069708633.1\|2934914_2935496_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
NZ_CP017075.1\|WP_083274681.1\|2953845_2954223_+\|reverse-transcriptase-like-protein	unknown	unknown	gnl\|CDD\|260011
NZ_CP017075.1\|WP_083274679.1\|2945206_2945491_+\|GIY-YIG-nuclease-family-protein	unknown	unknown	gnl\|CDD\|198395

Protein	Function_ID	Function_description	E-value
NZ_CP017075.1\|WP_036525606.1\|2944838_2945057_-\|DUF1192-domain-containing-protein	gnl\|CDD\|369041	pfam06698, DUF1192, Protein of unknown function (DUF1192). This family consists of several short, hypothetical, bacterial proteins of around 60 residues in length. The function of this family is unknown.	3.16455e-11
NZ_CP017075.1\|WP_069708641.1\|2946908_2947910_+\|NAD(P)H-quinone-oxidoreductase	gnl\|CDD\|176180	cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase. PIG3 p53-inducible quinone oxidoreductase, a medium chain dehydrogenase/reductase family member, acts in the apoptotic pathway. PIG3 reduces ortho-quinones, but its apoptotic activity has been attributed to oxidative stress generation, since overexpression of PIG3 accumulates reactive oxygen species. PIG3 resembles the MDR family member quinone reductases, which catalyze the reduction of quinone to hydroxyquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	0
NZ_CP017075.1\|WP_069708634.1\|2937882_2938443_+\|gamma-carbonic-anhydrase-family-protein	gnl\|CDD\|100051	cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E. coli paaY protein, and similar proteins. CAs are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionary distinct groups - alpha, beta and gamma carbonic anhydrases - which show no significant sequence identity or structural similarity. Gamma CAs are trimeric enzymes with left-handed parallel beta helix (LbH) structural domain.	9.57229e-72
NZ_CP017075.1\|WP_069708637.1\|2939304_2940897_-\|cisplatin-damage-response-ATP-dependent-DNA-ligase	gnl\|CDD\|274993	TIGR04120, DNA_ligase, DNA ligase, ATP-dependent, PP_1105 family. This model describes a family of ATP-dependent DNA ligases present in about 12 % of prokaryotic genomes. It occurs as part of a four-gene system with an exonuclease, a helicase and a phosphoesterase, with all four genes clustered or at least the first two and last two paired. This family resembles DNA ligase I (see TIGR00574 and pfam01068), and its presumed function may be in DNA repair, replication, or recombination.	0
NZ_CP017075.1\|WP_008831383.1\|2952906_2953308_+\|ribosome-silencing-factor	gnl\|CDD\|272901	TIGR00090, rsfS_iojap_ybeB, ribosome silencing factor RsfS/YbeB/iojap. This model describes a widely distributed family of bacterial proteins related to iojap from plants. It includes RsfS(YbeB) from E. coli. The gene iojap is a pattern-striping gene in maize, reflecting a chloroplast development defect in some cells. The conserved function of this protein is to silence ribosomes by binding the ribosomal large subunit and impairing joining with the small subunit in response to nutrient stress. Note that RsfS (starvation) is an author-endorsed change from the published symbol RsfA, which conflicted with previously published gene symbols. [Protein synthesis, Translation factors].	3.1076e-49
NZ_CP017075.1\|WP_069708638.1\|2941095_2942100_-\|ligase-associated-DNA-damage-response-exonuclease	gnl\|CDD\|274995	TIGR04122, hypothetical_protein, putative exonuclease, DNA ligase-associated. Members of this protein family frequently are found annotated as a putative exonuclease involved in mRNA processing. This protein is found, exclusively in bacteria, associated with three other proteins: an ATP-dependent DNA ligase, a helicase, and putative phosphoesterase.	1.54888e-170
NZ_CP017075.1\|WP_156799926.1\|2952127_2952793_+\|nicotinate-nucleotide-adenylyltransferase	gnl\|CDD\|234611	PRK00071, nadD, nicotinate-nucleotide adenylyltransferase.	1.74543e-61
NZ_CP017075.1\|WP_036525608.1\|2942292_2944665_-\|ATP-dependent-Clp-protease-ATP-binding-subunit-ClpA	gnl\|CDD\|274241	TIGR02639, ATP-dependent_Clp_protease_subunit, ATP-dependent Clp protease ATP-binding subunit clpA. [Protein fate, Degradation of proteins, peptides, and glycopeptides].	0
NZ_CP017075.1\|WP_069708640.1\|2945806_2946724_-\|VacJ-family-lipoprotein	gnl\|CDD\|377309	pfam04333, MlaA, MlaA lipoprotein. MlaA is a component of the Mla pathway, an ABC transport system that functions to maintain the asymmetry of the outer membrane. MlaA is required for the intercellular spreading of Shigella flexneri. It is attached to the outer membrane by a lipid anchor.	2.82035e-72
NZ_CP017075.1\|WP_008831385.1\|2950829_2952119_+\|glutamate-5-semialdehyde-dehydrogenase	gnl\|CDD\|234685	PRK00197, proA, gamma-glutamyl phosphate reductase; Provisional.	0
NZ_CP017075.1\|WP_069708636.1\|2938864_2939260_-\|group-II-truncated-hemoglobin	gnl\|CDD\|381282	cd14773, TrHb2_PhHbO-like_O, Truncated hemoglobins, group 2 (O); Pseudoalteromonas haloplanktis PhHbO like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). TrHb2's belonging to this group include Pseudoalteromonas haloplanktis PhHbO (encoded by the PSHAa0030 gene) which appears to be involved in oxidative and nitrosative stress resistance.	4.92207e-44
NZ_CP017075.1\|WP_008831382.1\|2953420_2953846_+\|23S-rRNA-(pseudouridine(1915)-N(3))-methyltransferase-RlmH	gnl\|CDD\|349954	cd18081, RlmH-like, 23S-rRNA-pseudouridine1915-N3-methyltransferase RlmH. 23S rRNA (pseudouridine1915-N3)-methyltransferase RlmH catalyzes the addition of a methyl group at the N-3 position of pseudouridine Psi1915 in 23S rRNA to form m(3)Psi1915. This family of proteins belongs to the SPOUT methyltransferases. The SPOUT methyltransferase superfamily is a large class of S-adenosyl-L-methionine (AdoMet or SAM)-dependent RNA MTases which are structurally characterized by a deep trefoil knot.	3.18016e-55
NZ_CP017075.1\|WP_008831388.1\|2948110_2948818_+\|DUF1013-domain-containing-protein	gnl\|CDD\|368812	pfam06242, DUF1013, Protein of unknown function (DUF1013). Family of uncharacterized proteins found in Proteobacteria.	1.52056e-84
NZ_CP017075.1\|WP_008831387.1\|2948987_2949434_-\|polymer-forming-cytoskeletal-protein	gnl\|CDD\|377376	pfam04519, Bactofilin, Polymer-forming cytoskeletal. This is a family of bactofilins, a functionally diverse class of cytoskeletal, polymer-forming, proteins that is widely conserved among bacteria. In the example species C. crescentus, two bactofilins assemble into a membrane-associated laminar structure that shows cell-cycle-dependent polar localization and acts as a platform for the recruitment of a cell wall biosynthetic enzyme involved in polar morphogenesis. Bactofilins display distinct subcellular distributions and dynamics in different bacterial species, suggesting that they are versatile structural elements that have adopted a range of different cellular functions.	3.63974e-26
NZ_CP017075.1\|WP_069708635.1\|2938442_2938721_+\|DUF167-domain-containing-protein	gnl\|CDD\|376843	pfam02594, DUF167, Uncharacterized ACR, YggU family COG1872.	6.73117e-21
NZ_CP017075.1\|WP_081799009.1\|2949435_2950518_-\|M23-family-metallopeptidase	gnl\|CDD\|366703	pfam01551, Peptidase_M23, Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.	3.21225e-44
NZ_CP017075.1\|WP_069708633.1\|2934914_2935496_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	2.78396e-25
NZ_CP017075.1\|WP_083274681.1\|2953845_2954223_+\|reverse-transcriptase-like-protein	gnl\|CDD\|260011	cd09279, RNase_HI_like, RNAse HI family that includes archaeal, some bacterial as well as plant RNase HI. Ribonuclease H (RNase H) is classified into two evolutionarily unrelated families, type 1 (prokaryotic RNase HI, eukaryotic RNase H1 and viral RNase H) and type 2 (prokaryotic RNase HII and HIII, and eukaryotic RNase H2). RNase H is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner. RNase H is involved in DNA replication, repair and transcription. RNase H is widely present in various organisms, including bacteria, archaea and eukaryotes and most prokaryotic and eukaryotic genomes contain multiple RNase H genes. Despite the lack of amino acid sequence homology, type 1 and type 2 RNase H share a main-chain fold and steric configurations of the four acidic active-site (DEDD) residues and have the same catalytic mechanism and functions in cells. One of the important functions of RNase H is to remove Okazaki fragments during DNA replication. Most archaeal genomes contain only type 2 RNase H (RNase HII); however, a few contain RNase HI as well. Although archaeal RNase HI sequences conserve the DEDD active-site motif, they lack other common features important for catalytic function, such as the basic protrusion region. Archaeal RNase HI homologs are more closely related to retroviral RNase HI than bacterial and eukaryotic type I RNase H in enzymatic properties.	1.84442e-16
NZ_CP017075.1\|WP_083274679.1\|2945206_2945491_+\|GIY-YIG-nuclease-family-protein	gnl\|CDD\|198395	cd10448, GIY-YIG_unchar_3, GIY-YIG domain of uncharacterized hypothetical protein found in bacteria. The family includes a group of uncharacterized bacterial proteins with a GIY-YIG domain that shows statistically significant similarity to the N-terminal catalytic domains of GIY-YIG family of intron-encoded homing endonuclease I-TevI and catalytic GIY-YIG domain of nucleotide excision repair endonuclease UvrC.	4.8405e-46

>NZ_CP017075.1|WP_083274679.1|2945206_2945491_+|GIY-YIG-nuclease-family-protein
MPGWTYILTNKPHGVLYIGVTADLPARMMQHRGGAGSAFCRKYGLKRLVLIEPHGRIEDAIRREKAMKAWKREWKIRLIEEANPEWADLFERLL
>NZ_CP017075.1|WP_036525606.1|2944838_2945057_-|DUF1192-domain-containing-protein
MDEEDRPLRRSSEGDFGAASHLAGESLDRYSLDELDARVALLEIEIARIRAHRNASSAHRLAADALFRPRSS
>NZ_CP017075.1|WP_036525608.1|2942292_2944665_-|ATP-dependent-Clp-protease-ATP-binding-subunit-ClpA
MPSFAQSLEKTLHSALSHASERSHEYATLEHLLLALIDDTDAAQVMQACGVDLGDLGDVVRQYLDQEYQSLKTEEKGDPAPTAGFQRVIQRAILHVQSSGKDTVTGANVLVALFSERDSYAVYFLQQQDMSRLDAVSYISHGIGKGGKRIEDRTAKGSSDETPPTPEDKAEAKASANKKDSALDQFTVNLNEKALAGKVDPLIGRGPEVDRTIQILCRRSKNNPLYVGDPGVGKTAIAEGLARKIVEGEVPEVLTEAVIYSLDMGSLLAGTRYRGDFEERLKQVVSELEKMPHAVLFIDEIHTVIGAGATSGGAMDASNLLKPALSGGTIRCIGSTTYKEFRNHFEKDRALLRRFQKIDVNEPTVEDTIKILKGLRTAFEDHHRVKYTPDAIKTAVELSARYINDRKLPDKAIDVIDEVGAMQMLLPPSRRKKTITAREIEQVIATMARIPPKSVSSDDKKALENLERDLKRVVFGQDKAIGLLATAMKLSRAGLRDPDKPIGSFLFSGPTGVGKTEVARQLASIMGIELKRFDMSEYMERHSVSRLIGAPPGYVGFDQGGLLTDAIDQNPHCVLLLDEIEKAHPDLFNILLQVMDNGRLTDHHGKTVDFRNVVLIMTTNAGASDMAKQGIGFGDTSKEDAGEEAVKQMFTPEFRNRLDAIVPFAYLAKDTISRVVDKFILQLELQLADQNVHIQFDSDARSWLGDKGYDKLYGARPMGRVIQEKVKQPLAEELLFGKLAHGGEVHVSVKENALNFELTPSAPKVSKTKKKVPVKRAKKPGPQADTNADD
>NZ_CP017075.1|WP_069708638.1|2941095_2942100_-|ligase-associated-DNA-damage-response-exonuclease
MPRDFSWIRPEPWGIHVVPADCWIDPARPVDRALVTHGHADHARGGHGATFATPETLAIMKLRYATEEGAVPVPYGTRIALPGKVHATWIPAGHVLGSAQILLEHAGERIIVTGDFKRRADPTCPPFEVTPCDVLVTEATFGLPVFRHPPVEEEIAKLLSALAANPERCVLVGAYALGKAQRLIAELRRAGHQDTIWLHGAMERMCRLYEEWGVDLGDLRLVSDASKEQLTGAVIVAPPSALNDRWSRRLPDPITAMASGWMRVRQRARQRMVELPLVISDHADWDELTQTVVDVNPAETWITHGREEAMLRWCELNQRKARALALVGYEDEDD
>NZ_CP017075.1|WP_069708637.1|2939304_2940897_-|cisplatin-damage-response-ATP-dependent-DNA-ligase
MEHFAALLDALVYTRSRNAKLKLLADYLRDTPDPDRGWALAALTDGLDFPAVKSSTIRNLLTERIDPVLWTLSREYVGDSAETASLLWPEPAEAPSPPTVSEAVDALSRMTRANVMVELPKLLDRLDANGRYALLKLATGAMRIGISARLAKTAFAQAFDVAVEDVEEHWHGQTPPYAPLFDWAAHGAEPPNSEDLPLFRPFMLAHGLEDTEVDLADYAAEWKWDGIRVQVVRAGGETRVYSRSGDDISATFPEVAEALHIDGVLDGELLVRGAHQGGEEGGAASFNALQQRLGRKTVSKKMREEYPAFVRLYDVLILEGQDLRPLPWNQRRAALEALLPRLPADQFDISTVIPAADFADLSAIRERARDDAIEGVMLKRRDSPYVAGRKTGLWYKWKRDPLLIDCVLMYAQRGSGKRSSFYSDYTFGCWDGDPDAGAELLPVGKAYFGFTDEELKWLDRHVRNHTVGRFGPVRETDKSLVFEVAFDSVHASKRHKSGVAMRFPRISRIRADKPAHEADRIETLRALIRD
>NZ_CP017075.1|WP_069708636.1|2938864_2939260_-|group-II-truncated-hemoglobin
MEQPSPVPDTPYHRLGGAPVFEAIANRFYDLMDSDPAYAELRAMHAADLTPMRASLPKFLAGWAGGPRDWFEANPGRCMMSLHAPFTIEALTANQWADAMERAITDVAPEPAEIATSMREVLGRLARGMGR
>NZ_CP017075.1|WP_069708635.1|2938442_2938721_+|DUF167-domain-containing-protein
MARPRAMLPDAEALRALVDAEGALALRVTPGAKVEALEIAGNRLTAKVRAKPEDGKANAAVRDLLARALGVAPSRLELLRGATSREKQFRVN
>NZ_CP017075.1|WP_069708634.1|2937882_2938443_+|gamma-carbonic-anhydrase-family-protein
MTDRNDITIAPFNGKAPRIHSSAFIAPGCRIIGDVEIGADASIWYNCVIRADINRVVIGARTNIQDGTVVHCDSPKPHRPEGYATIIGEDVLIGHMVMLHGCKLEDRAFIGLGAIVMDGSYVESDGMLAAGSQLTGKRIGARQLWMGRPAKYLRDLTDEAVVANQAGVKGYVLNGRLHAEALGLKG
>NZ_CP017075.1|WP_083274678.1|2935645_2937886_+|hypothetical-protein
MTDTAEHMLQTARTTPPRRGLFVATILVGSFLLFLVQPMVARMALPRLGGAPNVWNSAMLVYQALLLAGYAYAHWLGRFALKRQAMIHLALLLVAALTLPVGLIDMPRIAGLPEAAWVPLLLGASIGPVFFVVSAQAPLMQRWFAAAPEAGAPWALYAASNLGSFAGLIAYPLLAEPLLSVRLQSLAWSGGFAVLVVLVALAGFSRRTAPAPVTQAHAAERIPGRTIGLWLLLSAVPSGLMLSTTTHLTTDIFAMPLLWVIPLGLYLLSFVIAFSDRRGPATVVSRVAPVVVLFMGSYAMLSNGSGTLWAVAGTCLLLLCVATTLHARLYDLRPGEAQLTRFYLVMSAGGALGGVFTALIAPLVFDWAWEHPLLVLAAALLMPLRPLLNWRDNADMEPGMARIALGVVLAFAGFLGWELLETMLDPEEVLFSLMLTVFLVGLGIMVMAWRWGFAAVLLIAMVGQGGFWTVRATLEHERTRSYFGIYTLRDDAEGRFRTLAHGTTLHGMQALDPAHTHDALTYYGPGSGVALALAAVPAIEGPQARVGVVGLGTGSLACRSQRGQDWTFFEIDPVVLRFSTTRQFTFLKDCTPKARVVIGDARLELAHVAPRSFDVLVIDAFSSDAIPMHLLTTEALAVYRRALTPGGLLILHISNRYIDLAPVVGANARASALMALSRLDFPEDEVRYTPSRWIALSADRAVLDRLARQHPDAPWSKLEERAPEPWTDDHASILPYVRWSRLTGNP
>NZ_CP017075.1|WP_069708633.1|2934914_2935496_+|GNAT-family-N-acetyltransferase
MRRGCCVVRIETDRLILRDWGEGDIARFAEGTNTPAVMRHLGGVMDDAKVALFEERVLGFQHRLGHTFWIAQRKDDGAVLGFCGLKVIDAPGATFPGEMEIGWRFREDSWGQGYAKEAAIASLDAGFERFGAAEIFAITNIENTASWGLMLRLGMVRRAELDFVDARFEPPVGDTIVHSITAGVWRSIGRAGR
>NZ_CP017075.1|WP_069708640.1|2945806_2946724_-|VacJ-family-lipoprotein
MGVSTIALSVLLAGGGANLQDHPAIGTPGAVTTPVPEVAAQPLADHAPTIHAPAPPAGTPPPGSVPAAEDENVIIVSSSPRQIEADPFSGVNAASFAVVEAVDKVVVAPVAGTYERVVPKPIRNGLRNFLINLAEPIVFVNYLLQFKPGKAMETAGRFVINSTVGVAGLFDMAKRKPFRLPYRENGFANTFAYHGIGNGPYLFVPVLGPTTARDLVGRVLDLAVLPTLIGKPFNKPVYGLSTGIVKSMNDRVAFDEQIKANRAAADPYVATRDFYLKRRQAEVDALHSPEYRARKGIAEPGVDGK
>NZ_CP017075.1|WP_069708641.1|2946908_2947910_+|NAD(P)H-quinone-oxidoreductase
MLADLPVTMTAVGYDAPGGPEVLRPETVTVPRPGPGEVLVKVAFAGVNRPDVVQRLGNYPPPPGASPIPGLEVSGTIAALGEGVSQFLPGQEVCALVSGGGYAQYCIAKAGHCLPVPEGLSLAEAAALPETLFTVWHNVFERGLAREGEWLLVHGGTSGIGTMAAMLGRHFGLTVIVTCGSPDKCAAALKIGAHHAIDYKATDFVEEVARITGGRGVDVVLDMVAGSYVARNLKCLAPDGRHVTIAVQGGAKAEVNMAVVMTRRYTLTGSTLRPRTDAFKEAVAQEILECAWPLVEEGLLRPVMDTRFPFAEAPAAHARMEAGDHVGKIVLEV
>NZ_CP017075.1|WP_008831388.1|2948110_2948818_+|DUF1013-domain-containing-protein
MSQPTPLMPHATASWLVDVTSLTFEQIAEFCGLHMLEVQAMADDLASSKYTGRDPVRSGELTMEEIEKGQANPDYKLRMHKVPLAQNRTKGPRYTPVSKRQDKPDGIAWILRNHPEVSDAQIGKLIGTTRNTIAAIRDRSHWNIANITPKDPVTLGLCSQRELDALVAKAAKKAGIQDTGEGDERLVDDRQALIDELRAERQAQVQAASEAAQEAEVAAWLEAKRAAEAAEARGE
>NZ_CP017075.1|WP_008831387.1|2948987_2949434_-|polymer-forming-cytoskeletal-protein
MAKAFISSRASINSSSFSMLGGDTVISGDISASADLHVDGSVNGDISCKALIQGEGSEINGAVRAESVRVAGLVRGSVSAREVVILKTARIEGDVSYDTLTIEQGARLEGRLSPNGGQMPPSIARLPASAPIEVIAEEDEEELSAAAE
>NZ_CP017075.1|WP_081799009.1|2949435_2950518_-|M23-family-metallopeptidase
MRSQGQVRFIRVSARAQKIAAGAAVGVLGMWAASVGALALSQASVGSESAALAERAANVAKAEKSVAQYRRNVDSVASDLARRQQFIEQMVDAHIQELPEESGDTRPTAQTEATAKKVSAAVPGVGNLADIEAKQLALVDRLTRYADQRSDAAMASIRKLGLNPNAMISRARMAEGGPLVKLATGADGSVDPRFLTMGKSLARMDALENGLASIPQVSPAHVAYVSSSYGYRSDPFTGGAAFHAGLDFPGPMGSPIYAAAKGRVTFVGQKSGYGNCIEVTHGNGLMTRYGHLSGFRTRVGQDVDAGALIGAMGSTGRSTGPHLHFEVRVNDHPVNPRPFLEAARLQGANNSSNRGQEENH
>NZ_CP017075.1|WP_008831385.1|2950829_2952119_+|glutamate-5-semialdehyde-dehydrogenase
MTLQSTLIAEPAALSPEALVEQLARDGRAAQRVLAKLTDADKAAALRAAATALREAEGEILEANAKDIAAGEAKGLSGAMLDRLRLDAARLAGIADAVDQVAGLPDPVGEVIASSERPNGLKLSRVRIPIGLIGIIYESRPNVTADAAALCLRSGNAVLLRGGSEAIHSNHAIRAAFAKGLATVGLPEAAIQLVPTQDRAVVGAMLTAAGLIDMIVPRGGKSLVARVQADARVPVLAHLDGICHTYVHASADAGMARDLTLNAKMRRTGICGAMETLLLDTQFPESESVVAGLLDAGCELRGDARAQALDPRVLPASEEDWDTEYLDAVLAVAVVDGIEPALEHIAAHSSHHTDAIVTEDAESAERFLAEVDSAIVMVNASSQFADGGEFGLGAEIGIATGRLHARGPVALEGLTTYKWQVRGTGQARP
>NZ_CP017075.1|WP_156799926.1|2952127_2952793_+|nicotinate-nucleotide-adenylyltransferase
MRRTRTRPGPVTGLLGGSFNPAHGGHRRVTLFTVEALALDEVWWLVSPGNPLKPKAGMAPLAARMKSALRQARGARIRPTAIERELGTRYTVDTLRALLHRYPKRRFVWLMGADNLAQLHRWKDWRTLCRLMPIAVIARPGYDGAALASPAMAWLGKFRRPLTSLRGPEEWSAPALVTLRFDPDTRSATAIRQADPDWARRFSDRPSRDAVTYHLIPGTAE
>NZ_CP017075.1|WP_008831383.1|2952906_2953308_+|ribosome-silencing-factor
MPQAELQPESTGATPLPVTIESDDPLLNLVLSSLDDDQAQELVTIDLDGKSSIADFMVIASGRSTRQVASMAQKLGERLKQNGFGHPRIEGLPAADWVLVDAGSVVVHLFRPEVRTFYNLERMWGFDGPSGAA
>NZ_CP017075.1|WP_008831382.1|2953420_2953846_+|23S-rRNA-(pseudouridine(1915)-N(3))-methyltransferase-RlmH
MLLHIIARGKIARSPEGEMLDRYAKRITWPFRHSELPDVGGKVPPPAHTPVREVLLDERGKLMSSEEFAALLGRWRDEGVRECRFLIGAADGHGDEARAQADHLLCFGRMTWPHLMVRAMLAEQLWRATAILAGHPYHRSG
>NZ_CP017075.1|WP_083274681.1|2953845_2954223_+|reverse-transcriptase-like-protein
MKRLKVFFDGGCRPNPGPIEVAVVIRGVAHVFEDCGCGTNSDAEWLALIHALEVCRAQGLEHVELIGDAVEVVRQANRALRDGHGVGRHAARFLALAAQVRPARIRWIKRQQNLAGIALAARHPR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1230306 : 1238949

Bordetella_phage(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069707761.1\|1230306_1231425_-	AAA family ATPase	A0A291LA07	Bordetella_phage	8.4e-115	56.1
WP_083274586.1\|1231421_1231790_-	hypothetical protein	NA	NA	NA	NA
WP_069707762.1\|1231792_1232200_-	hypothetical protein	A0A076GCY8	Sinorhizobium_phage	3.1e-19	41.2
WP_083274587.1\|1232192_1232579_-	DUF968 domain-containing protein	R9TF58	Synechococcus_phage	5.6e-18	43.7
WP_083274588.1\|1232582_1233074_-	HNH endonuclease	A0A0B4N249	Escherichia_phage	8.8e-16	37.6
WP_069707764.1\|1233082_1233679_-	single-stranded DNA-binding protein	A0A0U2C0X4	Paracoccus_phage	4.6e-43	66.7
WP_069707765.1\|1233680_1234043_-	hypothetical protein	NA	NA	NA	NA
WP_069707766.1\|1234045_1235008_-	hypothetical protein	NA	NA	NA	NA
WP_069707767.1\|1235019_1235829_-	hypothetical protein	A0A1J0MBW0	Streptomyces_phage	9.1e-18	40.5
WP_069707768.1\|1235825_1236056_-	hypothetical protein	NA	NA	NA	NA
WP_069707769.1\|1236052_1236445_-	hypothetical protein	NA	NA	NA	NA
WP_156799770.1\|1236448_1236778_-	hypothetical protein	NA	NA	NA	NA
WP_069707772.1\|1237450_1237930_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_069707773.1\|1238014_1238209_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_069707774.1\|1238205_1238949_+	hypothetical protein	A0A1X9HWI4	Ruegeria_phage	9.1e-41	40.0

DBSCAN-SWA_2

1243811 : 1266138

Aeromonas_phage(30.0%)

terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069707784.1\|1243811_1244393_+	hypothetical protein	A0A059VJU8	Pseudomonas_phage	4.3e-46	49.7
WP_069707785.1\|1244394_1244892_+	DUF2280 domain-containing protein	A0A0S2SY97	Pseudomonas_phage	1.4e-29	54.2
WP_069707786.1\|1244997_1245630_+	hypothetical protein	NA	NA	NA	NA
WP_156799914.1\|1245847_1246000_+	hypothetical protein	NA	NA	NA	NA
WP_069707787.1\|1245996_1246266_+	hypothetical protein	NA	NA	NA	NA
WP_156799915.1\|1246331_1247771_+\|terminase	PBSX family phage terminase large subunit	A0A2R3UAK7	Myoviridae_environmental_samples	1.4e-141	53.5
WP_069707788.1\|1247920_1249819_+	DUF1073 domain-containing protein	A0A2R3UAL5	Myoviridae_environmental_samples	9.0e-101	44.7
WP_083274590.1\|1249821_1250622_+	hypothetical protein	A0A077KGU5	Edwardsiella_phage	1.7e-40	44.7
WP_069707789.1\|1250662_1251940_+	DUF2213 domain-containing protein	A0A219YCD3	Aeromonas_phage	2.7e-64	39.6
WP_069707790.1\|1251943_1252441_+	hypothetical protein	A0A2R3UAX9	Myoviridae_environmental_samples	3.1e-21	46.1
WP_069707791.1\|1252442_1253477_+	hypothetical protein	A0A219YBB0	Aeromonas_phage	1.1e-79	48.6
WP_069707792.1\|1253480_1253861_+	hypothetical protein	NA	NA	NA	NA
WP_069707793.1\|1253870_1254308_+	DUF4054 domain-containing protein	Q8HAQ1	Burkholderia_phage	1.5e-14	43.7
WP_156799776.1\|1254295_1254823_+	hypothetical protein	A0A077KC03	Edwardsiella_phage	8.5e-09	33.6
WP_083274592.1\|1254822_1255230_+	hypothetical protein	A0A077KAW7	Edwardsiella_phage	2.2e-12	34.6
WP_083274593.1\|1255226_1255790_+	hypothetical protein	H9C0W4	Aeromonas_phage	9.7e-19	35.4
WP_069707794.1\|1255791_1257279_+	DUF3383 domain-containing protein	A0A077KGV4	Edwardsiella_phage	1.5e-66	34.6
WP_069707795.1\|1257291_1257738_+	hypothetical protein	H9C0W6	Aeromonas_phage	4.4e-22	39.2
WP_156799777.1\|1258451_1259219_+	hypothetical protein	NA	NA	NA	NA
WP_069707797.1\|1259264_1260758_+	hypothetical protein	A0A0A0PL45	Bacillus_phage	1.0e-14	35.2
WP_069707798.1\|1260757_1261375_+	hypothetical protein	H9C0X3	Aeromonas_phage	3.7e-11	27.8
WP_069707799.1\|1261371_1261665_+	hypothetical protein	NA	NA	NA	NA
WP_069707800.1\|1261664_1262534_+	hypothetical protein	NA	NA	NA	NA
WP_069707801.1\|1262530_1263217_+	hypothetical protein	NA	NA	NA	NA
WP_069707802.1\|1263228_1263564_+	hypothetical protein	B7X9X8	uncultured_phage	1.5e-11	44.8
WP_069707803.1\|1263560_1264769_+	hypothetical protein	A0A077KGW9	Edwardsiella_phage	8.1e-71	40.5
WP_083274594.1\|1264765_1265398_+	DUF2612 domain-containing protein	K4HYS2	Acinetobacter_phage	1.5e-28	41.5
WP_069707804.1\|1265397_1266138_+	hypothetical protein	A0A219YBC2	Aeromonas_phage	3.1e-17	37.3

DBSCAN-SWA_3

1529973 : 1539237

Escherichia_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069707920.1\|1529973_1531500_-	DEAD/DEAH box helicase	A0A088FRR6	Escherichia_phage	7.3e-77	41.7
WP_069707921.1\|1531496_1532231_-	hypothetical protein	A0A2H5BFW5	Vibrio_phage	7.3e-91	65.9
WP_069707922.1\|1532227_1532482_-	hypothetical protein	NA	NA	NA	NA
WP_069707923.1\|1532478_1532790_-	hypothetical protein	NA	NA	NA	NA
WP_069707924.1\|1532835_1534905_-	hypothetical protein	M4QRH3	Loktanella_phage	8.8e-126	39.8
WP_083274744.1\|1534901_1535708_-	hypothetical protein	Q6V7R9	Burkholderia_virus	8.7e-21	49.6
WP_069707926.1\|1536649_1536841_-	hypothetical protein	M4QP85	Synechococcus_phage	3.4e-08	44.8
WP_069707927.1\|1537112_1537832_-	DUF2815 family protein	NA	NA	NA	NA
WP_083274616.1\|1537869_1539237_-	DUF2800 domain-containing protein	A0A097EW45	Ruegeria_phage	1.7e-64	36.2

DBSCAN-SWA_4

1549915 : 1592422

Klebsiella_phage(16.13%)

portal,integrase

attL 1560992:1561007|attR 1599949:1599964

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069707945.1\|1549915_1550485_+	hypothetical protein	B4UTT6	Rhizobium_phage	2.0e-40	50.6
WP_083274745.1\|1550781_1551855_+	hypothetical protein	NA	NA	NA	NA
WP_156799801.1\|1551851_1552694_+	thymidylate synthase	L7TM66	Rhizobium_phage	1.6e-110	66.8
WP_069707948.1\|1552690_1552966_+	hypothetical protein	NA	NA	NA	NA
WP_156799802.1\|1552934_1553339_+	hypothetical protein	NA	NA	NA	NA
WP_069707950.1\|1553335_1554001_+	3'-5' exoribonuclease	W6E9Q9	Rhizobium_phage	9.1e-32	39.5
WP_156799803.1\|1553997_1554678_+	hypothetical protein	L7TJ75	Rhizobium_phage	2.5e-29	39.4
WP_069707952.1\|1554705_1555188_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_069707953.1\|1555200_1556220_+	ribonucleotide-diphosphate reductase subunit beta	A0A0K1LM33	Caulobacter_phage	1.0e-119	63.4
WP_069707954.1\|1556390_1556648_+	DUF2312 domain-containing protein	Q8W6H2	Sinorhizobium_phage	1.4e-17	59.7
WP_069707955.1\|1556650_1557034_+	hypothetical protein	NA	NA	NA	NA
WP_069707956.1\|1557030_1557693_+	hypothetical protein	A0A1V0DX34	Synechococcus_virus	9.6e-58	53.8
WP_083274618.1\|1557780_1558161_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_069707958.1\|1558212_1558479_+	hypothetical protein	NA	NA	NA	NA
WP_156799804.1\|1558742_1559348_-	hypothetical protein	D7NW86	Streptomyces_phage	2.7e-06	28.3
WP_069707959.1\|1559344_1560589_-	hypothetical protein	A0A2I7S6I0	Vibrio_phage	4.8e-103	51.5
WP_069707960.1\|1560575_1560914_-	hypothetical protein	NA	NA	NA	NA
WP_069707961.1\|1560910_1561186_-	hypothetical protein	NA	NA	NA	NA
1560992:1561007	attL	NA	NA	NA	NA
WP_156799805.1\|1561182_1561611_-	hypothetical protein	NA	NA	NA	NA
WP_069707963.1\|1561610_1561943_-	ammonia monooxygenase	A0A291AUV3	Sinorhizobium_phage	1.5e-35	57.9
WP_069707964.1\|1561942_1562539_-	N-acetylmuramidase	A0A191ZCU8	Erwinia_phage	3.8e-45	50.8
WP_069707965.1\|1562525_1562786_-	hypothetical protein	NA	NA	NA	NA
WP_069707966.1\|1562790_1563159_-	hypothetical protein	NA	NA	NA	NA
WP_156799806.1\|1563310_1564360_+	hypothetical protein	E1A2I4	Aeromonas_phage	2.9e-69	42.4
WP_069707968.1\|1564356_1564920_+	hypothetical protein	A0A060AD14	Cronobacter_phage	1.6e-21	34.3
WP_069707969.1\|1564982_1565222_+	hypothetical protein	K4F774	Cronobacter_phage	6.8e-14	55.6
WP_069707970.1\|1565280_1565583_+	hypothetical protein	NA	NA	NA	NA
WP_156799807.1\|1565579_1565951_+	hypothetical protein	NA	NA	NA	NA
WP_156799808.1\|1565947_1566205_+	hypothetical protein	NA	NA	NA	NA
WP_069707972.1\|1566283_1566955_-	DUF2793 domain-containing protein	NA	NA	NA	NA
WP_069707973.1\|1566967_1569694_-	hypothetical protein	A0A0K2FI44	Achromobacter_phage	3.6e-119	33.0
WP_069707974.1\|1569695_1569887_-	hypothetical protein	A0A248XCS8	Klebsiella_phage	1.2e-10	52.5
WP_069707975.1\|1569883_1570117_-	hypothetical protein	G8DCS0	Silicibacter_phage	5.2e-11	42.9
WP_069707976.1\|1570233_1570716_+	DnaJ domain-containing protein	NA	NA	NA	NA
WP_083274621.1\|1570874_1571843_-	DUF2163 domain-containing protein	NA	NA	NA	NA
WP_069707979.1\|1573056_1577253_-	peptidoglycan DD-metalloendopeptidase family protein	A0A248XD76	Klebsiella_phage	6.8e-24	29.7
WP_069707980.1\|1577257_1577476_-	hypothetical protein	H6WYH8	Enterobacter_phage	2.1e-09	44.4
WP_069707981.1\|1577499_1577976_-	hypothetical protein	I6NLJ1	Burkholderia_phage	1.5e-12	34.0
WP_069707982.1\|1577989_1578760_-	hypothetical protein	A0A1V0DX22	Synechococcus_virus	7.2e-73	54.7
WP_069707983.1\|1579468_1580035_-	hypothetical protein	A0A097EW19	Ruegeria_phage	8.5e-23	41.3
WP_069707984.1\|1580034_1580655_-	hypothetical protein	A0A0K2FI54	Achromobacter_phage	7.6e-33	46.0
WP_069707985.1\|1580651_1581017_-	hypothetical protein	A0A248XD53	Klebsiella_phage	6.5e-08	36.5
WP_069707986.1\|1581024_1581330_-	hypothetical protein	NA	NA	NA	NA
WP_069707987.1\|1581388_1582504_-	hypothetical protein	M4QRI3	Loktanella_phage	4.8e-86	44.9
WP_069707988.1\|1582539_1583022_-	hypothetical protein	NA	NA	NA	NA
WP_069707989.1\|1583034_1584339_-	S49 family peptidase	A0A248XD65	Klebsiella_phage	1.4e-81	43.4
WP_083274622.1\|1584429_1586184_-\|portal	phage portal protein	A0A097EVZ4	Ruegeria_phage	3.8e-146	49.3
WP_069707991.1\|1586141_1586369_-	hypothetical protein	G8DCP3	Silicibacter_phage	1.9e-10	52.2
WP_083274623.1\|1586418_1588614_-	hypothetical protein	A0A248XD48	Klebsiella_phage	6.0e-189	47.7
WP_069707992.1\|1588610_1588838_-	hypothetical protein	NA	NA	NA	NA
WP_083274624.1\|1588830_1589613_-	DUF1441 family protein	A0A0K2FHW7	Achromobacter_phage	5.5e-12	27.5
WP_083274625.1\|1589971_1590148_+	DUF2158 domain-containing protein	NA	NA	NA	NA
WP_156799809.1\|1590433_1590667_-	hypothetical protein	NA	NA	NA	NA
WP_069707996.1\|1590719_1590959_-	hypothetical protein	NA	NA	NA	NA
WP_083274626.1\|1590955_1591174_-	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_069707997.1\|1591198_1592422_-\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A1B0VMI6	Pseudomonas_phage	2.9e-76	44.6
1599949:1599964	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2327181 : 2343026

Vibrio_phage(27.27%)

tail,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069709223.1\|2327181_2328696_+\|terminase	terminase	G9L6B8	Escherichia_phage	2.1e-129	51.3
WP_156799836.1\|2328682_2328865_+	hypothetical protein	NA	NA	NA	NA
WP_156799837.1\|2329021_2329540_+	hypothetical protein	NA	NA	NA	NA
WP_069708281.1\|2329577_2329841_+	DUF2829 domain-containing protein	A0A1B0VMG3	Pseudomonas_phage	3.0e-15	48.9
WP_069708282.1\|2329840_2330047_+	hypothetical protein	NA	NA	NA	NA
WP_069708283.1\|2330046_2330232_+	hypothetical protein	NA	NA	NA	NA
WP_069708284.1\|2330231_2331893_+\|tail	phage tail protein	T1S9Z7	Salmonella_phage	1.8e-73	33.5
WP_069708285.1\|2331894_2332311_+	hypothetical protein	NA	NA	NA	NA
WP_069708286.1\|2332307_2332655_+	hypothetical protein	NA	NA	NA	NA
WP_069708287.1\|2332632_2333475_+	hypothetical protein	A0A2I7QLA2	Vibrio_phage	1.8e-16	35.3
WP_069708288.1\|2333477_2334515_+	hypothetical protein	A0A2I7QL96	Vibrio_phage	1.8e-63	41.7
WP_069708289.1\|2334575_2335010_+	hypothetical protein	A0A2I7QL94	Vibrio_phage	5.9e-16	45.0
WP_069708290.1\|2335009_2335333_+	hypothetical protein	NA	NA	NA	NA
WP_069708291.1\|2335379_2335922_+	hypothetical protein	R4T8F0	Halovirus	1.5e-05	37.1
WP_156799838.1\|2335909_2336428_+	hypothetical protein	NA	NA	NA	NA
WP_156799839.1\|2336502_2336733_+	hypothetical protein	NA	NA	NA	NA
WP_069708294.1\|2336833_2337469_+	hypothetical protein	T1SAQ2	Salmonella_phage	6.7e-08	29.3
WP_069708295.1\|2337468_2338131_+	hypothetical protein	M1HLI2	Pelagibacter_phage	2.5e-21	37.0
WP_069708296.1\|2338130_2339945_+	hypothetical protein	W6MWW6	Pseudomonas_phage	1.8e-74	30.6
WP_069708297.1\|2339937_2340399_+	hypothetical protein	NA	NA	NA	NA
WP_069708298.1\|2340398_2340896_+	hypothetical protein	NA	NA	NA	NA
WP_069708299.1\|2340896_2343026_+	efflux RND transporter permease subunit	A0A076YQK7	Mesorhizobium_phage	5.5e-22	45.4

DBSCAN-SWA_6

2470127 : 2520658

Gordonia_phage(16.67%)

integrase,transposase,protease

attL 2497196:2497212|attR 2507177:2507193

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008827764.1\|2470127_2471546_+\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_008827763.1\|2471719_2472127_+	hypothetical protein	NA	NA	NA	NA
WP_069708366.1\|2472312_2472510_+	hypothetical protein	NA	NA	NA	NA
WP_069708367.1\|2472506_2472908_+	DUF393 domain-containing protein	NA	NA	NA	NA
WP_069708368.1\|2472937_2474416_+	thiol-disulfide oxidoreductase	NA	NA	NA	NA
WP_155986299.1\|2474422_2474674_-	hypothetical protein	NA	NA	NA	NA
WP_036526853.1\|2474843_2475179_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_069708369.1\|2475171_2476419_+	HipA domain-containing protein	NA	NA	NA	NA
WP_036526850.1\|2477449_2479009_-	glutamine-hydrolyzing GMP synthase	NA	NA	NA	NA
WP_069708370.1\|2479653_2480739_-	acyltransferase family protein	A0A142KBN9	Gordonia_phage	1.3e-11	27.9
WP_008827630.1\|2481027_2483562_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	2.8e-105	32.6
WP_069708371.1\|2483691_2484873_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A1X6WGT4	Pacmanvirus	4.0e-14	25.1
WP_156799845.1\|2485353_2486430_-\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_008827633.1\|2486801_2487062_-	hypothetical protein	NA	NA	NA	NA
WP_069708373.1\|2487279_2487573_-	hypothetical protein	NA	NA	NA	NA
WP_036526845.1\|2487915_2489367_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_069708374.1\|2489542_2490442_+	DMT family transporter	NA	NA	NA	NA
WP_069708375.1\|2490585_2493261_+	aconitate hydratase AcnA	NA	NA	NA	NA
WP_069708376.1\|2493344_2493797_-	hypothetical protein	NA	NA	NA	NA
WP_083274653.1\|2493956_2494625_-	FkbM family methyltransferase	NA	NA	NA	NA
WP_156799846.1\|2494585_2494909_-	hypothetical protein	NA	NA	NA	NA
WP_069708379.1\|2495076_2495547_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_069708380.1\|2495534_2496152_-	6-phosphogluconolactonase	NA	NA	NA	NA
WP_156799847.1\|2496162_2496360_-	hypothetical protein	NA	NA	NA	NA
WP_069709229.1\|2496630_2496891_+	hypothetical protein	NA	NA	NA	NA
WP_156799848.1\|2496908_2497706_+	hypothetical protein	NA	NA	NA	NA
2497196:2497212	attL	NA	NA	NA	NA
WP_069708382.1\|2497712_2499230_+	hypothetical protein	NA	NA	NA	NA
WP_069708383.1\|2500014_2501256_+\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	2.0e-93	46.9
WP_069708384.1\|2504703_2505036_+	hypothetical protein	NA	NA	NA	NA
WP_069708385.1\|2505112_2505307_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_083274654.1\|2505293_2506187_+	hypothetical protein	NA	NA	NA	NA
WP_156799849.1\|2506177_2506666_-	hypothetical protein	NA	NA	NA	NA
WP_069708387.1\|2506505_2507432_-	HEPN domain-containing protein	NA	NA	NA	NA
2507177:2507193	attR	NA	NA	NA	NA
WP_156799850.1\|2508347_2509480_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_069708390.1\|2509615_2510074_-	DNA starvation/stationary phase protection protein	NA	NA	NA	NA
WP_069708391.1\|2510162_2510720_-	hypothetical protein	NA	NA	NA	NA
WP_069708392.1\|2510764_2511517_-	HAD-IIB family hydrolase	L7RCU0	Acanthamoeba_polyphaga_moumouvirus	1.9e-06	23.6
WP_069708393.1\|2511683_2512730_-	mannose-1-phosphate guanylyltransferase	NA	NA	NA	NA
WP_036526825.1\|2512958_2513783_+	trehalose-phosphatase	NA	NA	NA	NA
WP_069708394.1\|2513779_2515594_+	glycoside hydrolase family 15 protein	NA	NA	NA	NA
WP_069708395.1\|2515683_2517174_+	alpha,alpha-trehalose-phosphate synthase (UDP-forming)	NA	NA	NA	NA
WP_083274657.1\|2518279_2518705_+\|transposase	transposase	NA	NA	NA	NA
WP_008827841.1\|2518701_2519055_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_069708397.1\|2519104_2520658_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	4.4e-45	28.7

DBSCAN-SWA_7

3302638 : 3347026

Dinoroseobacter_phage(12.5%)

capsid,tRNA,head,portal,protease,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069708827.1\|3302638_3305029_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_008829610.1\|3305048_3306185_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2I2L4E3	Orpheovirus	9.7e-26	31.2
WP_036529909.1\|3306193_3306526_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_008829612.1\|3306748_3307114_-	50S ribosomal protein L20	NA	NA	NA	NA
WP_008829613.1\|3307127_3307331_-	50S ribosomal protein L35	NA	NA	NA	NA
WP_069708828.1\|3307533_3307980_-	gamma-glutamylcyclotransferase	NA	NA	NA	NA
WP_008829615.1\|3307983_3308784_-	inositol monophosphatase family protein	NA	NA	NA	NA
WP_069708829.1\|3308963_3309866_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_008829617.1\|3310020_3310956_-	ribose-phosphate pyrophosphokinase	A0A1V0SHF7	Hokovirus	2.6e-45	36.4
WP_008829618.1\|3311566_3312547_-	class II fructose-bisphosphatase	NA	NA	NA	NA
WP_008829619.1\|3312718_3313066_+	hypothetical protein	NA	NA	NA	NA
WP_069708830.1\|3313155_3314463_-	homoserine dehydrogenase	NA	NA	NA	NA
WP_069708831.1\|3314536_3315382_-	hypothetical protein	NA	NA	NA	NA
WP_008829622.1\|3315749_3316412_+	TonB family protein	NA	NA	NA	NA
WP_008829623.1\|3316492_3317257_+	flagellar motor protein MotA	NA	NA	NA	NA
WP_036529916.1\|3317428_3317920_+	biopolymer transporter ExbD	NA	NA	NA	NA
WP_008829625.1\|3317945_3318380_+	biopolymer transporter ExbD	NA	NA	NA	NA
WP_069709294.1\|3318453_3320910_-	ligase-associated DNA damage response DEXH box helicase	NA	NA	NA	NA
WP_069709295.1\|3320989_3322387_-	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	7.4e-52	32.9
WP_008829628.1\|3322561_3324097_+	peptide chain release factor 3	A0A1S5SF82	Streptococcus_phage	2.9e-33	27.5
WP_036529918.1\|3324186_3324891_+	endonuclease	NA	NA	NA	NA
WP_008832047.1\|3325053_3325392_+	P-II family nitrogen regulator	NA	NA	NA	NA
WP_008832048.1\|3325406_3326717_+	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	8.0e-32	31.1
WP_069708832.1\|3326895_3327234_+	P-II family nitrogen regulator	NA	NA	NA	NA
WP_008832050.1\|3327282_3327708_-	TIGR01244 family phosphatase	NA	NA	NA	NA
WP_069708833.1\|3327993_3328788_+	cold-shock protein	A0A1W6JNX5	Morganella_phage	8.3e-08	51.8
WP_036529922.1\|3328976_3330167_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	1.9e-27	27.4
WP_069708834.1\|3330163_3331090_+	ornithine carbamoyltransferase	M1I6M4	Paramecium_bursaria_Chlorella_virus	4.8e-15	27.4
WP_051587186.1\|3331086_3331992_+	molecular chaperone Hsp33	NA	NA	NA	NA
WP_083274700.1\|3332188_3332500_+	hypothetical protein	NA	NA	NA	NA
WP_069708836.1\|3332565_3333273_+	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	2.9e-28	36.1
WP_008829062.1\|3333415_3334429_-	OmpA family protein	NA	NA	NA	NA
WP_008829061.1\|3334618_3335077_-	DUF2793 domain-containing protein	A0A1V0DY81	Dinoroseobacter_phage	5.5e-12	38.2
WP_069708837.1\|3335112_3337305_-	hypothetical protein	A0A1W6DWX7	Sphingobium_phage	4.8e-29	35.4
WP_069708838.1\|3337306_3337732_-	hypothetical protein	NA	NA	NA	NA
WP_069708839.1\|3337728_3338550_-	DUF2163 domain-containing protein	A0A1V0DY93	Dinoroseobacter_phage	6.4e-27	31.9
WP_069708840.1\|3338546_3340889_-	DUF2460 domain-containing protein	A0A0P1KKK5	Acinetobacter_phage	9.6e-52	35.9
WP_083274701.1\|3340900_3341458_-\|tail	tail tape measure protein	NA	NA	NA	NA
WP_069708842.1\|3341450_3341639_-\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_069708843.1\|3341635_3341944_-	gene transfer agent family protein	NA	NA	NA	NA
WP_008829053.1\|3341940_3342348_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_069708844.1\|3342535_3342925_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_156799880.1\|3342928_3343102_-	hypothetical protein	NA	NA	NA	NA
WP_069708845.1\|3343098_3343656_-	hypothetical protein	NA	NA	NA	NA
WP_069708846.1\|3343884_3345024_-\|capsid	phage major capsid protein	Q8W627	Enterobacteria_phage	1.1e-80	47.3
WP_069709296.1\|3345168_3345573_-\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	5.2e-14	39.2
WP_008829048.1\|3345572_3345881_-	hypothetical protein	NA	NA	NA	NA
WP_069708847.1\|3345877_3347026_-\|portal	phage portal protein	W8ECU7	Geobacillus_phage	1.0e-43	34.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP017078

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP017076

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP017077

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP017075

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection