CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP013679	Xanthomonas oryzae pv. oryzae strain PXO602, complete genome	2 crisprs	DinG,cas2,cas1,cas4,cas7,cas8c,cas5,cas3,DEDDh,csa3,WYL	0	42	31	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013679_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013679_1

867936-873010

TypeI

I-C

Consensus_repeat	Method
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CRISPRCasFinder
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CRT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	PILER-CR

77 spacers

cas2,cas1,cas4,cas7,cas8c,cas5,cas3

The CRISPR arrays of NZ_CP013679_1

>merge|NZ_CP013679|1|867936-873010|CRISPRCasFinder,CRT,PILER-CR
GTTTCAATCCACGCGCCCGTGAGGACGCGACGGCCAGCCTGCGCCGACACCGACCCCGGGCACTCGTTTCAATCCACGCGCCCGTGAGGACGCGACTCTGCGACGGGGTTACCAGCTCCAGCCCGTCGCGGTTTCAATCCACGCGCCCGTGAGGACGCGACGGTATCCCAGCAAAGACTTGCTCATACCCGTCGGGCGTTTCAATCCACGCGCCCGTGAGGACGCGACGGCGGACAACATTGTGGGTCTTCCGGGATGCGGTGTTTCAATCCACGCGCCCGTGAGGACGCGACTCGCACCGACAGCGCCCTGATTGAGTATGTGCAGGTTTCAATCCACGCGCCCGTGAGGACGCGACGTGGCGCGAGCGCTATAACAAGCGCTCGTTCTACGTGTTTCAATCCACGCGCCCGTGAGGACGCGACCGCTTCACGGGCCGTGGATACGTTACTACCCATGTTTCAATCCACGCGCCCGTGAGGACGCGACTTGGATCGAACCGGAGGAACGCGCCTTGAGGTCGGGTTTCAATCCACGCGCCCGTGAGGACGCGACTCCCACCGGTCGCCCAGGGCGAGCGGCTTGAACGTGTTTCAATCCACGCGCCCGTGAGGACGCGACGCGGTCGTTTCGCCTGCGACTCGACGTGGGCCACGTTTCAATCCACGCGCCCGTGAGGACGCGACCAGCAGCGTGCCCGCGCCGTTCCGCGTATAGAACGTTTCAATCCACGCGCCCGTGAGGACGCGACATGAGCATCCAGGTCGTCCCGCTCGCCCCGCGCCCGTTTCAATCCACGCGCCCGTGAGGACGCGACGACAGCGGCGCGCAAGTCACGAACGTCAGCATCCAGTTTCAATCCACGCGCCCGTGAGGACGCGACGCGGCCTTTTCAGCGATGCAGAAACGCAGATGGTGTTTCAATCCACGCGCCCGTGAGGACGCGACGCAACCTTAAGATCACCCTCCACGCTCCGTATAGTTTCAATCCACGCGCCCGTGAGGACGCGACCGTTAATCGCCGACCAGGTGATCACGCCGCGAAAGTTTCAATCCACGCGCCCGTGAGGACGCGACTGTCCACATATCCACGGTCCTTTGTGGGCGATCTAGTTTCAATCCACGCGCCCGTGAGGACGCGACCAGCACAGCCGACAACGCCTGTTCCAGCACCATCACGTTTCAATCCACGCGCCCGTGAGGACGCGACTTGCTTGCTGATCTGCGCATGCGCGCTCATGAAATGTTTCAATCCACGCGCCCGTGAGGACGCGACGCCGCGCCGATCATCACCAGCGAGGGTCCAATCTTGTTTCAATCCACGCGCCCGTGAGGACGCGACGGCCACCGGCTTATTGGGGTCGGCGCGATCTTTGGTGTTTCAATCCACGCGCCCGTGAGGACGCGACACGCGTGCAGACGCTTTGACAGCGCGCAACACCTGTTTCAATCCACGCGCCCGTGAGGACGCGACTGGTGAAATTGTAGAAGCATCCATCGTCACAACTAGTTTCAATCCACGCGCCCGTGAGGACGCGACGGCTACAGCGCCTTCGTAGAGGCTGGCCAACGTCGGGTTTCAATCCACGCGCCCGTGAGGACGCGACAGCGCCCCTACGGATAACGCTCCACACGCGCTGAGTTTCAATCCACGCGCCCGTGAGGACGCGACCAGCAATGCAACGTTTCAGAGGTTTCGCGTTGGCGTTTCAATCCACGCGCCCGTGAGGACGCGACGCCACTGCGTGGCCCTGGACCGCGCCTATTCGTGAGTTTCAATCCACGCGCCCGTGAGGACGCGACGAGGAGTTGGAGCGGGCAGGTGCCCCCTTGGCGCGGTTTCAATCCACGCGCCCGTGAGGACGCGACTGCAACCGAACGCCATCACCCTGTCGAACGATGTGTTTCAATCCACGCGCCCGTGAGGACGCGACCTACGGGGACTACAGCGCCAACGGCATGAGCAAGGCGTTTCAATCCACGCGCCCGTGAGGACGCGACGGTCATCACCGTGGCCATCACCATCACCGGGCGTGGTTTCAATCCACGCGCCCGTGAGGACGCGACGCCGGCGAAGTGGCGTATACATCTCCGGGATTAAGGTTTCAATCCACGCGCCCGTGAGGACGCGACGCAGGATGAGTCGGGTAAGTGGTGTATTCCAGACGTTTCAATCCACGCGCCCGTGAGGACGCGACAGTGGGATACCCTTGCGCTCGGCACTGTCCGTGGGTTTCAATCCACGCGCCCGTGAGGACGCGACAGGATCTGGAGCTGATGGATCAACCAATGTGACGTTTCAATCCACGCGCCCGTGAGGACGCGACGCAGGTGTATACAGTAACTGCGGACCTAACAGCAGTTTCAATCCACGCGCCCGTGAGGACGCGACTTCCGCGCTGGTCCTATGCCAACAAGATCAAGCTTGTTTCAATCCACGCGCCCGTGAGGACGCGACCCCTCCAGCAACGCGCATTGCCCTAGAGTCGGCGGTTTCAATCCACGCGCCCGTGAGGACGCGACATACGGCGCAGCCAGGGCGACAGAGTCATAGTCAGTTTCAATCCACGCGCCCGTGAGGACGCGACCCGTCGCGGTCGGTGATACGCACGCGCCACAGGTGTTTCAATCCACGCGCCCGTGAGGACGCGACCCTGCTCGATCGTCCAGTTATCGCTATAAGACCCCGGTTTCAATCCACGCGCCCGTGAGGACGCGACTGGGGTCGGCGCGATCTTTGGTGAAGTAATGCACGTTTCAATCCACGCGCCCGTGAGGACGCGACCCATCACCGGGCGTGGAAGGTGGCGCGTCACCAACAGTTTCAATCCACGCGCCCGTGAGGACGCGACACTGCTGTGCCCAATCATGCTCGGCGGGACGCCGAAGTTTCAATCCACGCGCCCGTGAGGACGCGACAATCGGGTGGGATATCTGCATATACTCTGCCACCGTTTCAATCCACGCGCCCGTGAGGACGCGACCCTGCACCGCCGCCGATACCGCCAAGCACAGTGCTGTTTCAATCCACGCGCCCGTGAGGACGCGACATGAGGGGTATTGCAAAGCTAAGGGCTGCAAGGTGTTTCAATCCACGCGCCCGTGAGGACGCGACCCTTCTGACATTCCCGCCACAGCGCCTTGCCCGCGTTTCAATCCACGCGCCCGTGAGGACGCGACCGCTGAGGCTGTTGTAATCCACGCCGAAAGCAGCAGAGTTTCAATCCACGCGCCCGTGAGGACGCGACAAAGATCTGCGCAGCCAGGTCAAAGGCGCCAACCAAGTTTCAATCCACGCGCCCGTGAGGACGCGACTTGTGCTCAACATCCCCTAAAAATGCTGCACCCAGTTTCAATCCACGCGCCCGTGAGGACGCGACTGGCTTATGATCCCCTGACGGGTGTGTTACGGTGGTTTCAATCCACGCGCCCGTGAGGACGCGACAACAGCGCTGACCTCTGCTTAGGACTTGCCCAGTTGTTTCAATCCACGCGCCCGTGAGGACGCGACTCCGCCGTCCCTCTAGCCTGAGCTTGTTTTTAGGTTTCAATCCACGCGCCCGTGAGGACGCGACCGCCACGGTCAACAGCTGTGCAGAGGCAGGCATTGTTTCAATCCACGCGCCCGTGAGGACGCGACTCAGTCTGCTTGCCACTCTCAACAAGTGACTGCACGTTTCAATCCACGCGCCCGTGAGGACGCGACGTGTGATTATGGAAGAGCCACGGAGGATAAGCACGTTTCAATCCACGCGCCCGTGAGGACGCGACGGGCTCAGGGATCAACCCACAGGGCTCGGACTTGCAGTTTCAATCCACGCGCCCGTGAGGACGCGACTCCCCAGTACCTTTCGTGTTCACGCTCAAAACCGTTTCAATCCACGCGCCCGTGAGGACGCGACCACCTCAGTGGGCGGTTCGACAAAGTGTTCGGGCAGGTTTCAATCCACGCGCCCGTGAGGACGCGACTACGGTATTTGTAGATAAACTCCTGCACCCTGAGTTTCAATCCACGCGCCCGTGAGGACGCGACCACCCATACCAGTGTCATTTTTGGGGTTGGTATAGTTTCAATCCACGCGCCCGTGAGGACGCGACTGCCATAGGTGACGACGCTGACGCTGTAACCAAGGGTTTCAATCCACGCGCCCGTGAGGACGCGACAGCGGCACACCTGAACTCTATGGGTCTTTGGAAAGTTTCAATCCACGCGCCCGTGAGGACGCGACGCTAGCCTATTGGCAAGCACGCTCGCAGACACTGTTTCAATCCACGCGCCCGTGAGGACGCGACACATGCACCCGCCTTGGCCGTCTTGCTGTCCTTGTTTCAATCCACGCGCCCGTGAGGACGCGACTATTGGCCTGTCCCTGGATCAATGCCCGCACCGTGTTTCAATCCACGCGCCCGTGAGGACGCGACCGGTGTGCAGCTAACCTTTAGCAGCACGGCAACGTTTCAATCCACGCGCCCGTGAGGACGCGACACCAACGGATTTCCTGAAGATTGCAGAGTATCCAGTTTCAATCCACGCGCCCGTGAGGACGCGACATAAGCGTCGGTTCGGGGTACTCTACGAACATCCAGTTTCAATCCACGCGCCCGTGAGGACGCGACTACCCAACTACTGAGACAGAGAGACTAGACAATGTTTCAATCCACGCGCCCGTGAGGACGCGACGCATTGTTGTAGGAGACGCCGTGGGTGCTGTTGGTGTTTCAATCCACGCGCCCGTGAGGACGCGACTGCACAAACGCAAGGCCTCACCATTTGATGTCCAGTTTCAATCCACGCGCCCGTGAGGACGCGACTACGCCATCGTGGCGAAGAGGACACAGCAACGGCTTGTTTCAATCCACGCGCCCGTGAGGACGCGACAGGGGGTGCAGCTGACCTTTAGCAGCACGACGACGTTTCAATCCACGCGCCCGTGAGGACGCGACTGTGGGCCTACCTGGCTGCGGCGAAGTGGCAGCTGTTTCAATCCACGCGCCCGTGAGGACGCGACGAATTTTGAGTCTGTTGACCACTTGGGACGACCAGGTTTCAATCCACGCGCCCGTGAGGACGCGAC

>NZ_CP013679|1|1|867936-873010|CRISPRCasFinder
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GGCCAGCCTGCGCCGACACCGACCCCGGGCACTC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TCTGCGACGGGGTTACCAGCTCCAGCCCGTCGCG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GGTATCCCAGCAAAGACTTGCTCATACCCGTCGGGC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GGCGGACAACATTGTGGGTCTTCCGGGATGCGGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TCGCACCGACAGCGCCCTGATTGAGTATGTGCAG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GTGGCGCGAGCGCTATAACAAGCGCTCGTTCTACGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CGCTTCACGGGCCGTGGATACGTTACTACCCAT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TTGGATCGAACCGGAGGAACGCGCCTTGAGGTCGG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TCCCACCGGTCGCCCAGGGCGAGCGGCTTGAACGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCGGTCGTTTCGCCTGCGACTCGACGTGGGCCAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CAGCAGCGTGCCCGCGCCGTTCCGCGTATAGAAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ATGAGCATCCAGGTCGTCCCGCTCGCCCCGCGCCC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GACAGCGGCGCGCAAGTCACGAACGTCAGCATCCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCGGCCTTTTCAGCGATGCAGAAACGCAGATGGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCAACCTTAAGATCACCCTCCACGCTCCGTATA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CGTTAATCGCCGACCAGGTGATCACGCCGCGAAA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGTCCACATATCCACGGTCCTTTGTGGGCGATCTA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CAGCACAGCCGACAACGCCTGTTCCAGCACCATCAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TTGCTTGCTGATCTGCGCATGCGCGCTCATGAAAT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCCGCGCCGATCATCACCAGCGAGGGTCCAATCTT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GGCCACCGGCTTATTGGGGTCGGCGCGATCTTTGGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ACGCGTGCAGACGCTTTGACAGCGCGCAACACCT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGGTGAAATTGTAGAAGCATCCATCGTCACAACTA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GGCTACAGCGCCTTCGTAGAGGCTGGCCAACGTCGG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AGCGCCCCTACGGATAACGCTCCACACGCGCTGA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CAGCAATGCAACGTTTCAGAGGTTTCGCGTTGGC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCCACTGCGTGGCCCTGGACCGCGCCTATTCGTGA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GAGGAGTTGGAGCGGGCAGGTGCCCCCTTGGCGCG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGCAACCGAACGCCATCACCCTGTCGAACGATGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CTACGGGGACTACAGCGCCAACGGCATGAGCAAGGC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GGTCATCACCGTGGCCATCACCATCACCGGGCGTG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCCGGCGAAGTGGCGTATACATCTCCGGGATTAAG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCAGGATGAGTCGGGTAAGTGGTGTATTCCAGAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AGTGGGATACCCTTGCGCTCGGCACTGTCCGTGG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AGGATCTGGAGCTGATGGATCAACCAATGTGAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCAGGTGTATACAGTAACTGCGGACCTAACAGCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TTCCGCGCTGGTCCTATGCCAACAAGATCAAGCTT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CCCTCCAGCAACGCGCATTGCCCTAGAGTCGGCG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ATACGGCGCAGCCAGGGCGACAGAGTCATAGTCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CCGTCGCGGTCGGTGATACGCACGCGCCACAGGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CCTGCTCGATCGTCCAGTTATCGCTATAAGACCCCG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGGGGTCGGCGCGATCTTTGGTGAAGTAATGCAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CCATCACCGGGCGTGGAAGGTGGCGCGTCACCAACA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ACTGCTGTGCCCAATCATGCTCGGCGGGACGCCGAA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AATCGGGTGGGATATCTGCATATACTCTGCCACC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CCTGCACCGCCGCCGATACCGCCAAGCACAGTGCT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ATGAGGGGTATTGCAAAGCTAAGGGCTGCAAGGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CCTTCTGACATTCCCGCCACAGCGCCTTGCCCGC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CGCTGAGGCTGTTGTAATCCACGCCGAAAGCAGCAGA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AAAGATCTGCGCAGCCAGGTCAAAGGCGCCAACCAA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TTGTGCTCAACATCCCCTAAAAATGCTGCACCCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGGCTTATGATCCCCTGACGGGTGTGTTACGGTG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AACAGCGCTGACCTCTGCTTAGGACTTGCCCAGTT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TCCGCCGTCCCTCTAGCCTGAGCTTGTTTTTAG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CGCCACGGTCAACAGCTGTGCAGAGGCAGGCATT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TCAGTCTGCTTGCCACTCTCAACAAGTGACTGCAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GTGTGATTATGGAAGAGCCACGGAGGATAAGCAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GGGCTCAGGGATCAACCCACAGGGCTCGGACTTGCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TCCCCAGTACCTTTCGTGTTCACGCTCAAAACC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CACCTCAGTGGGCGGTTCGACAAAGTGTTCGGGCAG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TACGGTATTTGTAGATAAACTCCTGCACCCTGA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CACCCATACCAGTGTCATTTTTGGGGTTGGTATA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGCCATAGGTGACGACGCTGACGCTGTAACCAAGG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AGCGGCACACCTGAACTCTATGGGTCTTTGGAAA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCTAGCCTATTGGCAAGCACGCTCGCAGACACT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ACATGCACCCGCCTTGGCCGTCTTGCTGTCCTT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TATTGGCCTGTCCCTGGATCAATGCCCGCACCGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CGGTGTGCAGCTAACCTTTAGCAGCACGGCAAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ACCAACGGATTTCCTGAAGATTGCAGAGTATCCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ATAAGCGTCGGTTCGGGGTACTCTACGAACATCCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TACCCAACTACTGAGACAGAGAGACTAGACAAT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCATTGTTGTAGGAGACGCCGTGGGTGCTGTTGGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGCACAAACGCAAGGCCTCACCATTTGATGTCCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TACGCCATCGTGGCGAAGAGGACACAGCAACGGCTT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AGGGGGTGCAGCTGACCTTTAGCAGCACGACGAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGTGGGCCTACCTGGCTGCGGCGAAGTGGCAGCT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GAATTTTGAGTCTGTTGACCACTTGGGACGACCAG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC

>NZ_CP013679|1|1|867936-873010|CRT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GGCCAGCCTGCGCCGACACCGACCCCGGGCACTC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TCTGCGACGGGGTTACCAGCTCCAGCCCGTCGCG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GGTATCCCAGCAAAGACTTGCTCATACCCGTCGGGC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GGCGGACAACATTGTGGGTCTTCCGGGATGCGGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TCGCACCGACAGCGCCCTGATTGAGTATGTGCAG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GTGGCGCGAGCGCTATAACAAGCGCTCGTTCTACGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CGCTTCACGGGCCGTGGATACGTTACTACCCAT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TTGGATCGAACCGGAGGAACGCGCCTTGAGGTCGG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TCCCACCGGTCGCCCAGGGCGAGCGGCTTGAACGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCGGTCGTTTCGCCTGCGACTCGACGTGGGCCAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CAGCAGCGTGCCCGCGCCGTTCCGCGTATAGAAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ATGAGCATCCAGGTCGTCCCGCTCGCCCCGCGCCC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GACAGCGGCGCGCAAGTCACGAACGTCAGCATCCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCGGCCTTTTCAGCGATGCAGAAACGCAGATGGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCAACCTTAAGATCACCCTCCACGCTCCGTATA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CGTTAATCGCCGACCAGGTGATCACGCCGCGAAA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGTCCACATATCCACGGTCCTTTGTGGGCGATCTA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CAGCACAGCCGACAACGCCTGTTCCAGCACCATCAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TTGCTTGCTGATCTGCGCATGCGCGCTCATGAAAT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCCGCGCCGATCATCACCAGCGAGGGTCCAATCTT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GGCCACCGGCTTATTGGGGTCGGCGCGATCTTTGGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ACGCGTGCAGACGCTTTGACAGCGCGCAACACCT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGGTGAAATTGTAGAAGCATCCATCGTCACAACTA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GGCTACAGCGCCTTCGTAGAGGCTGGCCAACGTCGG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AGCGCCCCTACGGATAACGCTCCACACGCGCTGA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CAGCAATGCAACGTTTCAGAGGTTTCGCGTTGGC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCCACTGCGTGGCCCTGGACCGCGCCTATTCGTGA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GAGGAGTTGGAGCGGGCAGGTGCCCCCTTGGCGCG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGCAACCGAACGCCATCACCCTGTCGAACGATGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CTACGGGGACTACAGCGCCAACGGCATGAGCAAGGC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GGTCATCACCGTGGCCATCACCATCACCGGGCGTG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCCGGCGAAGTGGCGTATACATCTCCGGGATTAAG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCAGGATGAGTCGGGTAAGTGGTGTATTCCAGAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AGTGGGATACCCTTGCGCTCGGCACTGTCCGTGG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AGGATCTGGAGCTGATGGATCAACCAATGTGAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCAGGTGTATACAGTAACTGCGGACCTAACAGCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TTCCGCGCTGGTCCTATGCCAACAAGATCAAGCTT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CCCTCCAGCAACGCGCATTGCCCTAGAGTCGGCG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ATACGGCGCAGCCAGGGCGACAGAGTCATAGTCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CCGTCGCGGTCGGTGATACGCACGCGCCACAGGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CCTGCTCGATCGTCCAGTTATCGCTATAAGACCCCG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGGGGTCGGCGCGATCTTTGGTGAAGTAATGCAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CCATCACCGGGCGTGGAAGGTGGCGCGTCACCAACA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ACTGCTGTGCCCAATCATGCTCGGCGGGACGCCGAA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AATCGGGTGGGATATCTGCATATACTCTGCCACC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CCTGCACCGCCGCCGATACCGCCAAGCACAGTGCT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ATGAGGGGTATTGCAAAGCTAAGGGCTGCAAGGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CCTTCTGACATTCCCGCCACAGCGCCTTGCCCGC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CGCTGAGGCTGTTGTAATCCACGCCGAAAGCAGCAGA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AAAGATCTGCGCAGCCAGGTCAAAGGCGCCAACCAA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TTGTGCTCAACATCCCCTAAAAATGCTGCACCCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGGCTTATGATCCCCTGACGGGTGTGTTACGGTG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AACAGCGCTGACCTCTGCTTAGGACTTGCCCAGTT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TCCGCCGTCCCTCTAGCCTGAGCTTGTTTTTAG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CGCCACGGTCAACAGCTGTGCAGAGGCAGGCATT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TCAGTCTGCTTGCCACTCTCAACAAGTGACTGCAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GTGTGATTATGGAAGAGCCACGGAGGATAAGCAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GGGCTCAGGGATCAACCCACAGGGCTCGGACTTGCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TCCCCAGTACCTTTCGTGTTCACGCTCAAAACC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CACCTCAGTGGGCGGTTCGACAAAGTGTTCGGGCAG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TACGGTATTTGTAGATAAACTCCTGCACCCTGA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CACCCATACCAGTGTCATTTTTGGGGTTGGTATA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGCCATAGGTGACGACGCTGACGCTGTAACCAAGG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AGCGGCACACCTGAACTCTATGGGTCTTTGGAAA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCTAGCCTATTGGCAAGCACGCTCGCAGACACT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ACATGCACCCGCCTTGGCCGTCTTGCTGTCCTT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TATTGGCCTGTCCCTGGATCAATGCCCGCACCGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CGGTGTGCAGCTAACCTTTAGCAGCACGGCAAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ACCAACGGATTTCCTGAAGATTGCAGAGTATCCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ATAAGCGTCGGTTCGGGGTACTCTACGAACATCCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TACCCAACTACTGAGACAGAGAGACTAGACAAT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCATTGTTGTAGGAGACGCCGTGGGTGCTGTTGGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGCACAAACGCAAGGCCTCACCATTTGATGTCCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TACGCCATCGTGGCGAAGAGGACACAGCAACGGCTT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AGGGGGTGCAGCTGACCTTTAGCAGCACGACGAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGTGGGCCTACCTGGCTGCGGCGAAGTGGCAGCT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GAATTTTGAGTCTGTTGACCACTTGGGACGACCAG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC

>NZ_CP013679|1|1|868066-873010|PILER-CR
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GGTATCCCAGCAAAGACTTGCTCATACCCGTCGGGC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GGCGGACAACATTGTGGGTCTTCCGGGATGCGGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TCGCACCGACAGCGCCCTGATTGAGTATGTGCAG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GTGGCGCGAGCGCTATAACAAGCGCTCGTTCTACGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CGCTTCACGGGCCGTGGATACGTTACTACCCAT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TTGGATCGAACCGGAGGAACGCGCCTTGAGGTCGG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TCCCACCGGTCGCCCAGGGCGAGCGGCTTGAACGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCGGTCGTTTCGCCTGCGACTCGACGTGGGCCAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CAGCAGCGTGCCCGCGCCGTTCCGCGTATAGAAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ATGAGCATCCAGGTCGTCCCGCTCGCCCCGCGCCC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GACAGCGGCGCGCAAGTCACGAACGTCAGCATCCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCGGCCTTTTCAGCGATGCAGAAACGCAGATGGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCAACCTTAAGATCACCCTCCACGCTCCGTATA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CGTTAATCGCCGACCAGGTGATCACGCCGCGAAA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGTCCACATATCCACGGTCCTTTGTGGGCGATCTA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CAGCACAGCCGACAACGCCTGTTCCAGCACCATCAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TTGCTTGCTGATCTGCGCATGCGCGCTCATGAAAT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCCGCGCCGATCATCACCAGCGAGGGTCCAATCTT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GGCCACCGGCTTATTGGGGTCGGCGCGATCTTTGGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ACGCGTGCAGACGCTTTGACAGCGCGCAACACCT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGGTGAAATTGTAGAAGCATCCATCGTCACAACTA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GGCTACAGCGCCTTCGTAGAGGCTGGCCAACGTCGG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AGCGCCCCTACGGATAACGCTCCACACGCGCTGA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CAGCAATGCAACGTTTCAGAGGTTTCGCGTTGGC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCCACTGCGTGGCCCTGGACCGCGCCTATTCGTGA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GAGGAGTTGGAGCGGGCAGGTGCCCCCTTGGCGCG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGCAACCGAACGCCATCACCCTGTCGAACGATGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CTACGGGGACTACAGCGCCAACGGCATGAGCAAGGC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GGTCATCACCGTGGCCATCACCATCACCGGGCGTG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCCGGCGAAGTGGCGTATACATCTCCGGGATTAAG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCAGGATGAGTCGGGTAAGTGGTGTATTCCAGAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AGTGGGATACCCTTGCGCTCGGCACTGTCCGTGG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AGGATCTGGAGCTGATGGATCAACCAATGTGAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCAGGTGTATACAGTAACTGCGGACCTAACAGCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TTCCGCGCTGGTCCTATGCCAACAAGATCAAGCTT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CCCTCCAGCAACGCGCATTGCCCTAGAGTCGGCG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ATACGGCGCAGCCAGGGCGACAGAGTCATAGTCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CCGTCGCGGTCGGTGATACGCACGCGCCACAGGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CCTGCTCGATCGTCCAGTTATCGCTATAAGACCCCG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGGGGTCGGCGCGATCTTTGGTGAAGTAATGCAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CCATCACCGGGCGTGGAAGGTGGCGCGTCACCAACA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ACTGCTGTGCCCAATCATGCTCGGCGGGACGCCGAA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AATCGGGTGGGATATCTGCATATACTCTGCCACC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CCTGCACCGCCGCCGATACCGCCAAGCACAGTGCT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ATGAGGGGTATTGCAAAGCTAAGGGCTGCAAGGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CCTTCTGACATTCCCGCCACAGCGCCTTGCCCGC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CGCTGAGGCTGTTGTAATCCACGCCGAAAGCAGCAGA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AAAGATCTGCGCAGCCAGGTCAAAGGCGCCAACCAA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TTGTGCTCAACATCCCCTAAAAATGCTGCACCCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGGCTTATGATCCCCTGACGGGTGTGTTACGGTG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AACAGCGCTGACCTCTGCTTAGGACTTGCCCAGTT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TCCGCCGTCCCTCTAGCCTGAGCTTGTTTTTAG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CGCCACGGTCAACAGCTGTGCAGAGGCAGGCATT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TCAGTCTGCTTGCCACTCTCAACAAGTGACTGCAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GTGTGATTATGGAAGAGCCACGGAGGATAAGCAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GGGCTCAGGGATCAACCCACAGGGCTCGGACTTGCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TCCCCAGTACCTTTCGTGTTCACGCTCAAAACC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CACCTCAGTGGGCGGTTCGACAAAGTGTTCGGGCAG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TACGGTATTTGTAGATAAACTCCTGCACCCTGA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CACCCATACCAGTGTCATTTTTGGGGTTGGTATA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGCCATAGGTGACGACGCTGACGCTGTAACCAAGG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AGCGGCACACCTGAACTCTATGGGTCTTTGGAAA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCTAGCCTATTGGCAAGCACGCTCGCAGACACT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ACATGCACCCGCCTTGGCCGTCTTGCTGTCCTT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TATTGGCCTGTCCCTGGATCAATGCCCGCACCGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	CGGTGTGCAGCTAACCTTTAGCAGCACGGCAAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ACCAACGGATTTCCTGAAGATTGCAGAGTATCCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	ATAAGCGTCGGTTCGGGGTACTCTACGAACATCCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TACCCAACTACTGAGACAGAGAGACTAGACAAT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GCATTGTTGTAGGAGACGCCGTGGGTGCTGTTGGT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGCACAAACGCAAGGCCTCACCATTTGATGTCCA
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TACGCCATCGTGGCGAAGAGGACACAGCAACGGCTT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	AGGGGGTGCAGCTGACCTTTAGCAGCACGACGAC
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	TGTGGGCCTACCTGGCTGCGGCGAAGTGGCAGCT
GTTTCAATCCACGCGCCCGTGAGGACGCGAC	GAATTTTGAGTCTGTTGACCACTTGGGACGACCAG
GTTTCAATCCACGCGCCCGTGAGGACGCGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013679.1\|WP_011257750.1\|882456_883032_-\|septum-formation-inhibitor-Maf	unknown	unknown	gnl\|CDD\|234855
NZ_CP013679.1\|WP_011407650.1\|863954_865112_-\|phosphotransferase	unknown	unknown	gnl\|CDD\|270702
NZ_CP013679.1\|WP_011407652.1\|865722_866562_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|224137
NZ_CP013679.1\|WP_069959729.1\|856402_858712_+\|type-II-secretion-system-secretin-GspD	unknown	unknown	gnl\|CDD\|274175
NZ_CP013679.1\|WP_011407647.1\|855596_856406_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236138
NZ_CP013679.1\|WP_011257743.1\|874539_875172_-\|CRISPR-associated-protein-Cas4	cas4	cd09637_cas4_CAS-I:CAS-II:CAS-V	gnl\|CDD\|273040
NZ_CP013679.1\|WP_011407659.1\|883144_883654_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224317
NZ_CP013679.1\|WP_011407648.1\|860805_861381_-\|nicotinamide-mononucleotide-transporter	unknown	unknown	gnl\|CDD\|377432
NZ_CP013679.1\|WP_011407646.1\|854953_855607_+\|general-secretion-pathway-protein-GspM	unknown	unknown	gnl\|CDD\|371216
NZ_CP013679.1\|WP_011257733.1\|859971_860700_-\|UTRA-domain-containing-protein	unknown	unknown	gnl\|CDD\|132380
NZ_CP013679.1\|WP_011407645.1\|853848_854970_+\|PilN-domain-containing-protein	unknown	unknown	gnl\|CDD\|377469
NZ_CP013679.1\|WP_011257732.1\|858708_859548_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224137
NZ_CP013679.1\|WP_011407656.1\|878697_880989_-\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	COG1203_cas3_CAS-I	gnl\|CDD\|350688
NZ_CP013679.1\|WP_011407655.1\|873502_874537_-\|type-I-C-CRISPR-associated-endonuclease-Cas1	cas1	cd09721_cas1_CAS-I-C	gnl\|CDD\|188360
NZ_CP013679.1\|WP_129593129.1\|881100_882066_+\|IS1595-like-element-ISXo5-family-transposase	unknown	unknown	gnl\|CDD\|372298
NZ_CP013679.1\|WP_011257744.1\|875191_876058_-\|type-I-C-CRISPR-associated-protein-Cas7/Csd2	cas7	cd09689_cas7_CAS-I-C	gnl\|CDD\|377458
NZ_CP013679.1\|WP_011257746.1\|877895_878570_-\|type-I-C-CRISPR-associated-protein-Cas5	cas5	cd09752_cas5_CAS-I-C	gnl\|CDD\|187534
NZ_CP013679.1\|WP_011407649.1\|861756_863919_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|273805
NZ_CP013679.1\|WP_011257741.1\|873197_873488_-\|CRISPR-associated-endonuclease-Cas2	cas2	cd09725_cas2_CAS-I:CAS-II:CAS-III:CAS-V	gnl\|CDD\|187856
NZ_CP013679.1\|WP_011257745.1\|876054_877899_-\|type-I-C-CRISPR-associated-protein-Cas8c/Csd1	cas8c	cd09757_cas8c_CAS-I-C	gnl\|CDD\|187887

Protein	Function_ID	Function_description	E-value
NZ_CP013679.1\|WP_011257750.1\|882456_883032_-\|septum-formation-inhibitor-Maf	gnl\|CDD\|234855	PRK00884, PRK00884, Maf-like protein; Reviewed.	2.06105e-108
NZ_CP013679.1\|WP_011407650.1\|863954_865112_-\|phosphotransferase	gnl\|CDD\|270702	cd05153, HomoserineK_II, Type II Homoserine Kinase. This subfamily is composed of unusual homoserine kinases, from a subset of bacteria, which have a Protein Kinase fold. These proteins do not bear any similarity to the GHMP family homoserine kinases present in most bacteria and eukaryotes. Homoserine kinase catalyzes the transfer of the gamma-phosphoryl group from ATP to L-homoserine producing L-homoserine phosphate, an intermediate in the production of the amino acids threonine, methionine, and isoleucine. The Type II homoserine kinase subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	1.42743e-23
NZ_CP013679.1\|WP_011407652.1\|865722_866562_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|224137	COG1216, COG1216, Predicted glycosyltransferases [General function prediction only].	2.90859e-50
NZ_CP013679.1\|WP_069959729.1\|856402_858712_+\|type-II-secretion-system-secretin-GspD	gnl\|CDD\|274175	TIGR02517, Putative_type_II_secretion_system_protein_D, type II secretion system protein D. In Gram-negative bacteria, proteins that have first crossed the inner member by Sec-dependent protein transport can be exported across the outer membrane by type II secretion, also called the main terminal branch of the general secretion pathway. Members of this family are general secretion pathway protein D. In Yersinia enterocolitica, a second member of this family is part of a novel second type II secretion system specifically associated with virulence (See ). This family is closely homologous to the type IV pilus outer membrane secretin PilQ (TIGR02515) and to the type III secretion system pore YscC/HrcC (TIGR02516). [Protein fate, Protein and peptide secretion and trafficking].	0
NZ_CP013679.1\|WP_011407647.1\|855596_856406_+\|hypothetical-protein	gnl\|CDD\|236138	PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated.	6.23179e-05
NZ_CP013679.1\|WP_011257743.1\|874539_875172_-\|CRISPR-associated-protein-Cas4	gnl\|CDD\|273040	TIGR00372, conserved_hypothetical_protein, CRISPR-associated protein Cas4. This model represents a family of proteins associated with CRISPR repeats in a wide set of prokaryotic genomes. This scope of this model has been broadened since it was first built to describe an archaeal subset only. The function of the protein is undefined. Distantly related proteins, excluded from this model, include ORFs from Mycobacteriophage D29 and Sulfolobus islandicus filamentous virus and a region of the Schizosaccharomyces pombe DNA replication helicase Dna2p.	9.31308e-45
NZ_CP013679.1\|WP_011407659.1\|883144_883654_+\|hypothetical-protein	gnl\|CDD\|224317	COG1399, COG1399, Predicted metal-binding, possibly nucleic acid-binding protein [General function prediction only].	1.32394e-27
NZ_CP013679.1\|WP_011407648.1\|860805_861381_-\|nicotinamide-mononucleotide-transporter	gnl\|CDD\|377432	pfam04973, NMN_transporter, Nicotinamide mononucleotide transporter. Members of this family are integral membrane proteins that are involved in transport of nicotinamide mononucleotide.	3.50772e-50
NZ_CP013679.1\|WP_011407646.1\|854953_855607_+\|general-secretion-pathway-protein-GspM	gnl\|CDD\|371216	pfam10741, T2SSM_b, Type II secretion system (T2SS), protein M subtype b. The T2SMb family is conserved in Proteobacteria and Actinobacteria, and differs from the T2SM proteins in Vibrio spp. (pfam04612).	2.03402e-25
NZ_CP013679.1\|WP_011257733.1\|859971_860700_-\|UTRA-domain-containing-protein	gnl\|CDD\|132380	TIGR03337, phnR, phosphonate utilization transcriptional regulator PhnR. This family of proteins are members of the GntR family (pfam00392) containing an N-terminal helix-turn-helix (HTH) motif. This clade is found adjacent to or inside of operons for the degradation of 2-aminoethylphosphonate (AEP) in Salmonella, Vibrio Aeromonas hydrophila, Hahella chejuensis and Psychromonas ingrahamii. [Regulatory functions, DNA interactions].	2.56156e-73
NZ_CP013679.1\|WP_011407645.1\|853848_854970_+\|PilN-domain-containing-protein	gnl\|CDD\|377469	pfam05137, PilN, Fimbrial assembly protein (PilN).	6.88927e-16
NZ_CP013679.1\|WP_011257732.1\|858708_859548_+\|hypothetical-protein	gnl\|CDD\|224137	COG1216, COG1216, Predicted glycosyltransferases [General function prediction only].	0.000236087
NZ_CP013679.1\|WP_011407656.1\|878697_880989_-\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|350688	cd17930, DEXHc_cas3, DEXH/Q-box helicase domain of Cas3. CRISPR-associated (Cas) 3 is a nuclease-helicase responsible for degradation of dsDNA. The two enzymatic units of Cas3, a histidine-aspartate (HD) nuclease and a Superfamily 2 (SF2) helicase, may be expressed from separate genes as Cas3' (SF2 helicase) and Cas3'' (HD nuclease) or may be fused as a single HD-SF2 polypeptide. The nucleolytic activity of most Cas3 enzymes is transition metal ion-dependent. Cas3 is a member of the DEAD-like helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.	5.31942e-58
NZ_CP013679.1\|WP_011407655.1\|873502_874537_-\|type-I-C-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|188360	TIGR03640, cas1_DVULG, CRISPR-associated endonuclease Cas1, subtype I-C/DVULG. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the DVULG subtype of CRISPR/Cas system.	0
NZ_CP013679.1\|WP_129593129.1\|881100_882066_+\|IS1595-like-element-ISXo5-family-transposase	gnl\|CDD\|372298	pfam12762, DDE_Tnp_IS1595, ISXO2-like transposase domain. This domain probably functions as an integrase that is found in a wide variety of transposases, including ISXO2.	1.22964e-34
NZ_CP013679.1\|WP_011257744.1\|875191_876058_-\|type-I-C-CRISPR-associated-protein-Cas7/Csd2	gnl\|CDD\|377458	pfam05107, Cas_Cas7, CRISPR-associated protein Cas7. CRISPR-associated protein Cas7 is one of the components of the type I-B cascade-like antiviral defense complex. In Haloferax volcanii, Cas5, Cas6 and Cas7 form a small complex that aids the stability of CRISPR-derived RNA.	1.65943e-155
NZ_CP013679.1\|WP_011257746.1\|877895_878570_-\|type-I-C-CRISPR-associated-protein-Cas5	gnl\|CDD\|187534	cd09752, Cas5_I-C, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex; in subtype I-C this protein might be the endoribonuclease that generates crRNAs; also known as DevS family.	1.09825e-123
NZ_CP013679.1\|WP_011407649.1\|861756_863919_-\|TonB-dependent-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	1.69902e-175
NZ_CP013679.1\|WP_011257741.1\|873197_873488_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|187856	cd09725, Cas2_I_II_III, CRISPR/Cas system-associated protein Cas2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas2 is present in majority of CRISPR/Cas systems along with Cas1; RNAse specific to U-rich regions; Possesses an RRM/ferredoxin fold.	8.3562e-35
NZ_CP013679.1\|WP_011257745.1\|876054_877899_-\|type-I-C-CRISPR-associated-protein-Cas8c/Csd1	gnl\|CDD\|187887	cd09757, Cas8c_I-C, CRISPR/Cas system-associated protein Cas8c. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Zn-finger domain containing protein, distant homologs of Cas8 proteins; signature gene for I-C subtype; also known as Csd1 family.	0

>NZ_CP013679.1|WP_011407652.1|865722_866562_+|glycosyltransferase-family-2-protein
MTAVQIAAVVVTYQSSSTIDACLSRLRAAEGISEIRVVDNASSDDTLEVVQRHALADARLHFIANPDNPGFATACNQGARDSQAPWLVFINPDLMVARDTLLQLCDRAAGHPAVLLGVEQVDEQGRPDMAVRRRDPDFAAMLRAPRAAANLTVPADPSRALQPVDAISGALMLMQRSLFDRLDGWDGSYRLHAEDLDLCRRARQAGALVAVANDLQVVHVRGVSSRARPFFVEWHKHRGLWRYFRKFEARHRGLMTQLGVWLAIWTHAAAQVPRLLQKK
>NZ_CP013679.1|WP_011407650.1|863954_865112_-|phosphotransferase
MNVPHQVHGMSLELALPDWPVLTTDEIHRVLHGCAAAGRLIAVRWQSARPFSAAACVDAESGPVIVKRHHRSVRSVAALREEHNFIAHLRWAGAPVAEVLHDAQGCTALTYDEWVYEVQRVGAGRDLYRDALSWTPFTDVAHARAAGAALAQLHSAAQGFDAPVRSTSVLVANLRLFAQADPLQALHDALPTRPHLAAALQYRPWQHDLATHLLPWHARAWPLLSAPGALPPLWTHGDWHASNLLWDTDDGHTRVSAIFDFGLSDCSSALFDLATAIERNLIPWLRLDTGARAQAELAQLDALLDGYAQHRPLDANQLRRLAALLPIVHADFALSEIEYFAGITRSPTNADIAYHRYLLGHADWFTSADGQHLLEHLHARARRLP
>NZ_CP013679.1|WP_011407649.1|861756_863919_-|TonB-dependent-receptor
MSATFPLLSRCPLALVLALCCTPALAQQQPDANAVELDAVNVRGERVETSTALSGFGATRLLDAPASIALIDRQQLLDRQARVLSEVLRADASAGDAYAPIGYYENFVVRGYSLNAANSYRINGMSAVGEQSIALENKQQVQLLKGLAGLQSGVNEPAGLIDYRTKRPEHVRSVTLGTDEQGSRYLAADLGDWFGAERTLGVRINAAREDIDSDVDHADGYRNFLSLAGDWKITPQALLQLDVEYQHRQQRSVPGYQLLGGTQVPRDIDVHRLLGYQPWARPVEMDSLNAQFRYAYQFNDDWRATADASRSRSTINDFSAFAWGCYGAASCADFATPNFFSAQGEYDVYDYRSPDDTRVHNQLRATLEGRVATGALEHRLSVGGEWLRRTIDRFGSVNAFVGSGSIDRDPEVFAQTDVPLAPKQRRLDSRQRALVLADRIGLGAQWELSLGGRYVQLDERSFDRDGLLERRMRKDTVLPQAALLFKPQQNVSLYASYAKSLAAGGTAPWFADNADEILPPTNAYQLETGAKIDLQSLRLGAALFDIRQAYQFTQPQADGGLLYVQQGRLHNRGLELSADGAATRQLRLFASIAAIRARAEDTDIAEYEGHQAINVPKLRASVQADYSVPGVDGLALLAGVQYSGRKFADRLGNASVPAYAVANLGARYATALGGLATTWRLNVDNVFDKRYWRDSGEYQGDAYLFPGAPRTARLTVQVDF
>NZ_CP013679.1|WP_011407648.1|860805_861381_-|nicotinamide-mononucleotide-transporter
MSLLESIAVAINLLGVWLTARRIRWCWPVGIVAVALYAWLFYQWKLYSDMLLQGVYVLTQLYGWWHWQRGSPADTRIRPLPMPVMECWLSLCIGAAFAASLGAYMHYRTDAALPWLDAALASFSLVASLWAARKRIANWVLWIVLDCVYVGVFISKGLHPTAALYAGFVALAVYGWRSWKTQQNPNLASAR
>NZ_CP013679.1|WP_011257733.1|859971_860700_-|UTRA-domain-containing-protein
MSVSRQHTITEAISAQIAAGEWGQDQRLPVERALAERFGCTRITLREALQQLEAEGRIYRENRRGWFVSASRVRYDPTSIAGFMQYVAAQGRKPRTELLSATRQVAGAAYAAALRLDSPYDEVFVLQRRRWIDRRAVLLETNVVLAAWAPGLLEHDLAGSLSTVFNQQLGLFLSRAQLSMHPAGLDAAQAMLLQSAPGTPCFRLQRISFAEDGRAVELDIESWRHDAVDVVVRTEAPTRSAL
>NZ_CP013679.1|WP_011257732.1|858708_859548_+|hypothetical-protein
MSAALPVVLVPVGTDEEALDACLGALDAATPAGTRVWLADDAQAGPRGRAVIEHWLVRTQLQAHHTRRQRMLGEVAHLDEMLIACGDADVVVLGVDARPLPGWLQQLTACFARDAAIATATPWSNVGEACSWPRLGELNPMPDATERLAAACAAMPPLHPELPSAIGHAVLLRGAARRKAGGLDASSYGSWYAALVDLSLRMGGLGWRNVLCGTAFVASPHEGRPADGDMDALATRWPAWHARLANFLMHDPLRAQRDQLTHLLADLPPPDPQRALFDA
>NZ_CP013679.1|WP_069959729.1|856402_858712_+|type-II-secretion-system-secretin-GspD
MSERMTPRLFPVSLLIGLLAGCATTPPPDVRRDARLDPNVGAAGATQTTAEQSADGKASAKPSPVIRRGSGTMINQSAASAPAPTLGMASSGSATFNFEGESVQAVVKAILGDMLGQNYVIAPGVQGTVTLATPNPVSPAQALNLLEMVLGWNNARMVFSGGRYNIVPADQALAGTVAPSTASPSAARGFEVRVVPLKYISASEMKKVLEPYARPNAIVGTDPARNVITLGGTRAELENYLRTVQIFDVDWLSGMSVGVFPIQSGKAEKVSADLEKVFGEQSKTPSAGMFRFMPLENANALLVITPQPRYLDQIQQWLDRIDSAGGGVRLFSYELKYIKAKDLADRLSEVFGGHSSGGDSNASLVPGSETSVLGGALGNRDSSMGGSSGMTGGSIGDSGDGSSSGSSFGSSGGGSSGGLGNGSLQLSPRSNGNGAVTLDVAGDKVGVSAVAETNTLLVRSTPQAWSSIRDVIEKLDVMPMQVHIEAQVAEVNLTGKLQYGVNWYFENSVNAAADSAANSTGIGAGAGLASAAGRNIWGDIAGKITGEKGAQWTFLGKNAASIIHALDEVTNVRLLQTPSVFVRNNAEATLNVGSRIAINSTSINTGLGSDSSFSSVQYIDTGVILKVRPRVTKDGMVFLDIVQEVSSPGDRPAACTSATATVNAAACNVDINTRRVKTEAAVQSGDTIMLAGLIDDTTSDGSNGIPFLSKLPVVGALFGSKSRNSARREVIVLITPSIVRNPQEARNLTDEYGQKFKAMEPLKPSQKPQ
>NZ_CP013679.1|WP_011407647.1|855596_856406_+|hypothetical-protein
MRLDMIGLRTWLLATVVGWAMLVCALAVAGLGKRVELLPDDPALVQRLPTLPAPAPERLGAFEKYSEIAAHPAFAEDRLPHPFFLSGNDGSGAASTVRLTGVLLTDTFKMATLSLDPQDSVRVQLGGDAVKGWRLLALQPRSATIEGPSGTQTLELHVFNGQGGQPPTANAAARGAGTATAPVPSPDAAAVAVPPPQQQQPQPQPQSVPPVQQPGWQALPTVQPQRSDGAQEAPRPSDDQMRAIRERIEARRRQLQQQRQSGSPPGQTQ
>NZ_CP013679.1|WP_011407646.1|854953_855607_+|general-secretion-pathway-protein-GspM
MPRSVKRDRWIALGLLLLVLGVAYLVLVHPWFTQPMIAVQDDLQALRERELRVRVQLQQATEVSKRLRQARQTLESRPGFLPETSAELASAGLVQRLERAVVEASPGNRSCAISNRSPLQPESKNRFTRVAVQVRLRCGTPELASVLYSLENGTPRLFVDNLNVMAQRYQLSPNESGNGLDIAFELAGYLRPGASAAPLNNETAPAAPNAAEASNAP
>NZ_CP013679.1|WP_011407645.1|853848_854970_+|PilN-domain-containing-protein
MTAWRDTLGRIGVRAMPGAGGFWRWWQQSLLAWLPQRWQWQLGLSQARLLLQQDGDALQLLRQRDHSCDSVASLPWPVHPQEVNSLLPTALESLPRHWLLPAAHALRRPLRLPAAAAARLQDVARFEIDRQTPFTADQVYFDARVLDVREDGQFDAELVVVPRRMIDGPAGVPDAWNSALSGIDVTDAKGLPLGVNLLPPARRLRRSDPMQRWNLLLAASALVLLAVAGWLLLDNRRQAADDLRAKVQANAARARQVAAERQQLMDLVEGARFFQQQRATRPTSVEIWDELSRRLPGGTYLEKFSVEGGQLQLIGLSNEASSLVRRLEGSPLWRTPSLTGVLQSDAGRNVDRFTITAELAGPDAKEAADATQR
>NZ_CP013679.1|WP_011257741.1|873197_873488_-|CRISPR-associated-endonuclease-Cas2
MMVLISYDVSTSSPGGEKRLRKVAKACRDLGQRVQYSVFEVEVEPAQWAELRQRLCDLIDPSVDSLRFYHLGAKWEARVEHVGAKPSLDFKGPLIF
>NZ_CP013679.1|WP_011407655.1|873502_874537_-|type-I-C-CRISPR-associated-endonuclease-Cas1
MRRQLNTLYATTDGAWLRKDGANIVMEVERQERARLPVHMLESLVCIGRVAVSPQLLGFCSEHGISICYLTPQGRFLARVEGPVSGNVLLRRAQYRRSDDPAGCAAIVRHLLAGKIHNQRAVLARGWRDHGDCLTDVAAFQHSLKRLKRIPQRVLVETDVDVLRGLEGEAAQSYFGVFGQLVRADKPLLRFGGRNRRPPRDAFNALLSFLYTLLTHDCRSALESVGLDPAVGFLHRDRPGRPSLALDLAEEFRPLLGERLALSLINRRQLNERDFQVFDNGAVLLKDDSRKTVLIAYQERKREQLQHAFLGEKVDIGLLPFVQAQLLARHLRGDLDGYPAFFWK
>NZ_CP013679.1|WP_011257743.1|874539_875172_-|CRISPR-associated-protein-Cas4
MDDADLIPLSALQHYLYCPRQCALIHVEQQWAENRQTAEGRLLHQRADAPQAERRRGVRTVTAMPLLALELGITGKADVVEFHRDGDGEVAFPVEYKRGHPKVHRADEVQLCAQALCLEHMLGRAVPTGALFYGQTRRRKDVAFDAALRALTLDTIADTRAMLHDSDTPAARYDAKRCDACSLIDVCQPRLLDRGSVDQWVRRQLNADED
>NZ_CP013679.1|WP_011257744.1|875191_876058_-|type-I-C-CRISPR-associated-protein-Cas7/Csd2
MSAIANRYEFVYLFDVINGNPNGDPDAGNLPRLDPETNRGLVTDVALKRKIRNYVALEQEAQAGYAIYMQEKSVLNNQHKQAYAALGIEHEAKKLPKDEAKARELTSWMCKNFFDVRTFGAVMTTEVNSGQVRGPVQLAFASSVEPVLPLEVSITRVAVTNEKDLEKERTMGRKHILPYGLYRAHGFISAKLAERTGFSEDDLQLLWRALTNLFEHDRSAARGEMSARKLIVFKHEHQMGNAPAHVLFDKVTVERVAEVDAGPARSFADYRVTIDRALPAGVSVEELF
>NZ_CP013679.1|WP_011257745.1|876054_877899_-|type-I-C-CRISPR-associated-protein-Cas8c/Csd1
MILSALADYYQRLLDDPESGISAPGYSREKIGYTVVLATNGNVISVDDEHRADGKKRLPKSVSVPASFKRPGTGAKSFFLWDKTSYVLGISASSKRSEQEHAAFKALHYQALSDTDDPGLHALLAFIERWTPDGYVDHPAFAPHSEALLDANLVFRLEGDSCYLHERPAARAAWDGQQGRGADGVSGLCLVSGTMAPLARLHPAIKGVNGAQSAGASIVSFNLDAFTSYGKQQGENAPVSEQAAFAYTTALNHLLRRDPHNRQRVQIGDTTVVFWAQASTPMRSQNAEDIFADFMRGSDADDPAIADGQATRRLELVMKQVRQARPLRDLDDSLDDDARIFVLGLAPNASRLSIRFWETQSLAGFAKRLADHYDDLALEPPAWKRPPTPAYLALQTAPVYGEHGKPKAEDVSPLLAGELTRAILTGIRYPQSLLGSIVMRFRADGQLTPLRIALCRAVLARDARLCRQQGLSTDPKEPPMSLDTGNTDPGYLLGRLFASLENLQRAALGDRINATIRDRYYGAASATPASIFPVLLRSAQNHFGKLRKEKAGLAVNLEKEIGQIIDALPPSFPRSLPIQEQGRFAIGYYHQTQARFARNDGPDAPDTASEGETA
>NZ_CP013679.1|WP_011257746.1|877895_878570_-|type-I-C-CRISPR-associated-protein-Cas5
MSYGVRLHVWGERALFTRPEMKVERVSYDIITPSAARGILEAIHWKPAIRWVVDSIQVLKPICFESIRRNEVGSKLSAASISKAIKAGRTDELVKYVEEDRQQRAATVLREVGYIIAAHFEMTDKAGPDDNVGKHLDIFNRRARRGQCFQAPCLGTREFPASFALLGDDDTPPASDPALSGERDLGWMLHDIDFADGMTPRFFRARMVDGLVAVPPPQDGGVRA
>NZ_CP013679.1|WP_011407656.1|878697_880989_-|CRISPR-associated-helicase/endonuclease-Cas3
MAFYAHSTQRRDHSDWQGLAEHLNGVGERASVHAEAFGGQVMARVAGQLHDLGKYTEKFQARLAGDPTRVDHATWGARKACELYRSGGTLLAYGIAGHHAGLADGRRDDLTSRPSLHERLSDEYCAHALPPLLPDWEREVMLPAKLELPTGFRGHPRTERRAFQMTVLARMLFSCLVDADFVDTDDFYRRVEGRKTRAEQAGTRLTLEELRERLDSHLAGLSSEHGINPIRATILHQARSKAHARIGLFSLTVPTGGGKTLASLAFALDHAIAHGLRRVIYVIPFTSIVDQTAQVFRKALGVQDRDDVVLEHHSAFFDDPAKALQAIDKRKLAMENWDAPIVVTTSVQFFESLFADRPSRCRKLHNIAGSVVILDEAQTLPQTLLRPCVALLDELARNYRVSPVLCTATQPALRQDQGFPGGLEQVEELVAEPKVLYAQLRRVRVRHVGALEDDALAEELRQRTQVLCIVNNRRHARALFDAIAEQPGAHHLTTLMHARHRSAALTRVREELKAGRPCRLVATSLIEAGVDVDFPTVLRAEAGLDSVAQAAGRCNREGRRPTDASEVLVFSPVNWQPPQELKVFTEVFREIERTHSGDLLAMEAIHAYFQRLYRRLGDNLLDDEAILTQLRTADLGDLPFDTLAQKFRMIQTTMRPLIVPYAPYVTDRNAAEREVAEVNEVLRQLEHADRIGVAGAARRLQPWLVQVPEQAYRALWQASAIAPIAPERYGEQFVCLRNSRLYDARFGLHWEDPQFLDAQALCP
>NZ_CP013679.1|WP_129593129.1|881100_882066_+|IS1595-like-element-ISXo5-family-transposase
MAMNRVQLQAGLSLPAFLKRYGNAQQCEQALEISRWPQGFVCPRCAATAHSRFQRHGTTYWQCTACYRQTSLRSGTVMDNSKLPLRTWLLGMYLLGQSKTNLSALELMRHLGVSYPTAWPMKHKLMQAMTQREANRKLGGIVQLDDAYLGGERNGGKAGRGSENKRPFVIAVETTEDGRPLRAVMDPVPGFTKAALSEWIGQRLHPGADVYSDGLGAFRTLEAEHAHTVIEGSGRSRCEAENARWVNVVLSNLKRSLDGAYHAFKFAKYAQRYLAETMWRFNRRFDLTRLVPSLLAAAAASKPWSERALRDVTMFTAESAC
>NZ_CP013679.1|WP_011257750.1|882456_883032_-|septum-formation-inhibitor-Maf
MMPRLILASTSAYRRQLLSRLQLEFDTGRPEVDEQPQSGEAPSALASRLAAEKAAAVAVRLPGAWVIGSDQVADLDGQALGKPGTRAQAQAQLTAMSGRTVRFHTAVSLIGPERELHALDLTEVQLRALTPAEIERYLDAEPALDCAGSFKCEGLGISLFDAIRSQDPTALVGLPLIALARLLREAGFHLP
>NZ_CP013679.1|WP_011407659.1|883144_883654_+|hypothetical-protein
MSANVPEMLDAWRMVAARRRFDGRIPLSAMTRLQGSLVDTEGECVYSLQFDEDTLLKVAYVELSIDVELPLACQRSLQRFLYPVHVRQRLGLIRDEADEAALPADYEALLVPEDGMLRVVDMVEDELVLSVPVVPMAPGSEAIDAEWVPTQEEQDKASPFAALAALKKQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013679_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013679_2

4130342-4130514

Orphan

Consensus_repeat	Method
CGGCGGTCGTCACGGCGGTCGTC	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP013679_2

>merge|NZ_CP013679|2|4130342-4130514|CRISPRCasFinder
TTGCGGTCGTAACGACGGTCCTGGTAACGGGCGTCGCGATAACCATCACGGTAGCCGTTGCTGTAGTAACGGCGGTCCTGACGCCACTCGCGGCGGTCGTCACGGCGGTCGTCACGGCGGTCGTCACGGCGGTCGTCACGGCGGTCGTCACGGCGGTCGTCACGGCGATCGTC

>NZ_CP013679|2|2|4130342-4130514|CRISPRCasFinder
TTGCGGTCGTAACGACGGTCCTG	GTAACGGGCGTCGCGATAACCATCACGGTAGCCG
TTGCTGTAGTAACGGCGGTCCTG	ACGCCACTCGCGGCGGTCGTCA
CGGCGGTCGTCACGGCGGTCGTC	ACGGCGGTCGTCACGGCGGTCGTCA
CGGCGGTCGTCACGGCGATCGTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013679.1\|WP_011409398.1\|4133070_4133403_-\|DUF4386-domain-containing-protein	unknown	unknown	gnl\|CDD\|379558
NZ_CP013679.1\|WP_011260261.1\|4124591_4125116_-\|transcriptional-repressor-NrdR	unknown	unknown	gnl\|CDD\|234774
NZ_CP013679.1\|WP_011260267.1\|4132729_4133074_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013679.1\|WP_011260272.1\|4137783_4138884_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340831
NZ_CP013679.1\|WP_011409400.1\|4135449_4136559_-\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176260
NZ_CP013679.1\|WP_011260257.1\|4121161_4121764_-\|riboflavin-synthase	unknown	unknown	gnl\|CDD\|236455
NZ_CP013679.1\|WP_011409395.1\|4125115_4125631_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013679.1\|WP_012444166.1\|4133560_4133788_-\|DUF4386-family-protein	unknown	unknown	gnl\|CDD\|379558
NZ_CP013679.1\|WP_094187845.1\|4129715_4129985_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013679.1\|WP_042465749.1\|4139022_4139742_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP013679.1\|WP_011409404.1\|4139738_4141238_+\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP013679.1\|WP_011260269.1\|4133917_4134748_-\|S-formylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|131868
NZ_CP013679.1\|WP_010367724.1\|4130893_4132555_+\|energy-dependent-translational-throttle-protein-EttA	unknown	unknown	gnl\|CDD\|236992
NZ_CP013679.1\|WP_011260263.1\|4125644_4126898_-\|serine-hydroxymethyltransferase	unknown	unknown	gnl\|CDD\|234571
NZ_CP013679.1\|WP_011260271.1\|4136623_4136899_-\|metal/formaldehyde-sensitive-transcriptional-repressor	unknown	unknown	gnl\|CDD\|197388
NZ_CP013679.1\|WP_041182269.1\|4127083_4129438_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|238657
NZ_CP013679.1\|WP_011260256.1\|4120025_4121165_-\|3,4-dihydroxy-2-butanone-4-phosphate-synthase	unknown	unknown	gnl\|CDD\|237587
NZ_CP013679.1\|WP_011260258.1\|4122324_4122948_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|275096
NZ_CP013679.1\|WP_011260260.1\|4124109_4124595_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379228
NZ_CP013679.1\|WP_011260259.1\|4123003_4124113_-\|bifunctional-diaminohydroxyphosphoribosylaminopyrimidine-deaminase/5-amino-6-(5-phosphoribosylamino)uracil-reductase-RibD	unknown	unknown	gnl\|CDD\|182729

Protein	Function_ID	Function_description	E-value
NZ_CP013679.1\|WP_011409398.1\|4133070_4133403_-\|DUF4386-domain-containing-protein	gnl\|CDD\|379558	pfam14329, DUF4386, Domain of unknown function (DUF4386). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 214 and 245 amino acids in length.	5.05334e-12
NZ_CP013679.1\|WP_011260261.1\|4124591_4125116_-\|transcriptional-repressor-NrdR	gnl\|CDD\|234774	PRK00464, nrdR, transcriptional repressor NrdR.	8.49506e-86
NZ_CP013679.1\|WP_011409404.1\|4139738_4141238_+\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	3.05334e-51
NZ_CP013679.1\|WP_011260272.1\|4137783_4138884_-\|glycosyltransferase	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	2.2429e-09
NZ_CP013679.1\|WP_011409400.1\|4135449_4136559_-\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	gnl\|CDD\|176260	cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	0
NZ_CP013679.1\|WP_011260257.1\|4121161_4121764_-\|riboflavin-synthase	gnl\|CDD\|236455	PRK09289, PRK09289, riboflavin synthase.	8.69783e-106
NZ_CP013679.1\|WP_012444166.1\|4133560_4133788_-\|DUF4386-family-protein	gnl\|CDD\|379558	pfam14329, DUF4386, Domain of unknown function (DUF4386). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 214 and 245 amino acids in length.	8.78319e-05
NZ_CP013679.1\|WP_042465749.1\|4139022_4139742_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	2.52335e-74
NZ_CP013679.1\|WP_011260269.1\|4133917_4134748_-\|S-formylglutathione-hydrolase	gnl\|CDD\|131868	TIGR02821, S-formylglutathione_hydrolase, S-formylglutathione hydrolase. This model describes a protein family from bacteria, yeast, and human, with a conserved critical role in formaldehyde detoxification as S-formylglutathione hydrolase (EC 3.1.2.12). Members in eukaryotes such as the human protein are better known as esterase D (EC 3.1.1.1), an enzyme with broad specificity, although S-formylglutathione hydrolase has now been demonstrated as well. [Cellular processes, Detoxification].	4.57619e-145
NZ_CP013679.1\|WP_010367724.1\|4130893_4132555_+\|energy-dependent-translational-throttle-protein-EttA	gnl\|CDD\|236992	PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed.	0
NZ_CP013679.1\|WP_011260263.1\|4125644_4126898_-\|serine-hydroxymethyltransferase	gnl\|CDD\|234571	PRK00011, glyA, serine hydroxymethyltransferase; Reviewed.	0
NZ_CP013679.1\|WP_011260271.1\|4136623_4136899_-\|metal/formaldehyde-sensitive-transcriptional-repressor	gnl\|CDD\|197388	cd10153, RcnR-FrmR-like_DUF156, Transcriptional regulators RcnR and FrmR, and related domains; this domain family was previously known as part of DUF156. This domain family includes various transcriptional regulators that respond to different stressors. It includes Escherichia coli RncR (formally known as YohL, nickel and cobalt-sensitive), and E. coli FrmR (formally known as YaiN, formaldehyde sensitive). Escherichia coli RncR represses expression of the gene encoding the nickel and cobalt-efflux protein RcnA; RcnA may act through modulating NikR, to repress the NIkABCDE nickel transporter. In vitro, purified RncR binds to the rncA promoter DNA fragment in the absence of Ni2+ or Co2+, and the affinity of RncR for this promoter is reduced in the presence of excess nickel. Escherichia coli FrmR regulates the formaldehyde degradation frmRAB operon. This family belongs to a larger superfamily that includes CsoRs (copper-sensitive operon repressors). CsoRs form homotetramers (dimer of dimers). In Mycobacterium tuberculosis CsoR, within each dimer, two Cys residues on opposite subunits, along with a His residue, bind the Cu(I) ion (forming a triagonal S2N coordination complex, C-H-C). These residues are conserved in the majority of members of this superfamily. In this family, however, not all these residues are conserved; in E.coli RcnR and FrmR there is a His or a Thr instead of the second Cys (C-H-H or C-H-T) respectively. For E. coli FrmR, an N-terminal His residue, not conserved in all members of this family, is also involved in metal binding (H-C-H-H). A conserved Tyr and a Glu residue that facilitate allosteric regulation of DNA binding for CsoRs are poorly conserved in this family.	2.47171e-40
NZ_CP013679.1\|WP_041182269.1\|4127083_4129438_-\|TonB-dependent-receptor	gnl\|CDD\|238657	cd01347, ligand_gated_channel, TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel. Energy (proton-motive force) and TonB-dependent conformational alteration of channel (parts of plug, and loops 7 and 8) allow passage of ligand. FepA residues 12-18 form the TonB box, which mediates the interaction with the TonB-containing inner membrane complex. TonB preferentially interacts with ligand-bound receptors. Transport thru the channel may resemble passage thru an air lock. In this model, ligand binding leads to closure of the extracellular end of pore, then a TonB-mediated signal facillitates opening of the interior side of pore, deforming the N-terminal plug and allowing passage of the ligand to the periplasm. Such a mechanism would prevent the free diffusion of small molecules thru the pore.	5.56255e-31
NZ_CP013679.1\|WP_011260256.1\|4120025_4121165_-\|3,4-dihydroxy-2-butanone-4-phosphate-synthase	gnl\|CDD\|237587	PRK14019, PRK14019, bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II.	0
NZ_CP013679.1\|WP_011260258.1\|4122324_4122948_+\|hypothetical-protein	gnl\|CDD\|275096	TIGR04273, activator_of_XA21-mediated_immunity_Ax21, sulfation-dependent quorum factor, Ax21 family. This family consists of proteins closely related to Ax21 (Activator of XA21-mediated immunity), a protein that is secreted by a type I secretion system (RaxABC), and that appears to be sulfated on an N-terminal region tryosine in a motif LSYN. Ax21 acts in a quorum-sensing system. Homologous peptide-mediated quorum-sensing systems appear to exist in other species, such as the emerging opportunistic pathogen Stenotrophomonas maltophilia. Intriguingly, the rice genome encodes a receptor (XA21) for this protein that triggers innate immunity. [Cellular processes, Pathogenesis].	9.07965e-22
NZ_CP013679.1\|WP_011260260.1\|4124109_4124595_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379228	pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	2.10784e-14
NZ_CP013679.1\|WP_011260259.1\|4123003_4124113_-\|bifunctional-diaminohydroxyphosphoribosylaminopyrimidine-deaminase/5-amino-6-(5-phosphoribosylamino)uracil-reductase-RibD	gnl\|CDD\|182729	PRK10786, ribD, bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD.	6.15427e-145

>NZ_CP013679.1|WP_094187845.1|4129715_4129985_+|hypothetical-protein
MASTINELTQAQRARLQMTETRERMRNGVHVAALPPGLVNLGDAARQSAGNASHAGSRKCSRHRRRQQHQHVLQYVVSIKQSRRVSADC
>NZ_CP013679.1|WP_041182269.1|4127083_4129438_-|TonB-dependent-receptor
MNKALVSPAVMAVLYAAAVTAFAQDAAGTDAVPRGSFTTTSTTTTTTTSNTTTSNTTNSNATQRALQLDAVKVTGSSVSLGSGNMEVQSAPKAVSTISRQAIIRGVPGANFTQMLSSIPGAIAATNDMTGLSDGSFTVRGFTADEIGVTLNGVPLNDSGDYTIYATEYGDTENMGDITVEQGYPGVTSPVIGAAGGNIAWVTVDPTADAGLDVSQSLGSNHYRRTFLRYNTGDSGPVRSWFSYSNNQADQWRGDGQSTVTKIDAKSVWTLDDGDAITGALQYTRHVRNGYRNLTKEQIAATGYDFGYVQSYKSADASDWVGTQTNPFRSWIANLDGEFTLSDSLHLSVVPYFVYGYGGGGYGYASTYVFYTFDTFRPGIHVKFKQDVGMRDSLEYGMLVERPREQGSNVFLPADPQGHPADVWGHDSRYYYKNANGSPQVAYRFYSTTPTYRAFATNTWTPNDQWTLTVGGAYTWVQRKGWYSTWPGADLGIDLATPGNSSLYASGANTYKKFTPTGGVKFQLDEQNQLFLGVGKTSRAPINTAALYDFWNAAYASAIGSQTSISDAEPEQALTADLGWRYYGDNLSTVLDLYATNFEHKQFSGADPMTHAPVYYQLGSVQMRGVNAELSYKVNDLWSVYASYAYNKSQMKSDVALGATTYATDGKTLVNAPRNVGYASVNYTGQALWASLSVNAQSRIWGTFLNAGGSDAGGFATVNLNSGYNFHDIGNLKKPYLKVNLFNLGNRKALIFSATTALDATASAASWQLLQDRTLMVTFGGSFAL
>NZ_CP013679.1|WP_011260263.1|4125644_4126898_-|serine-hydroxymethyltransferase
MFSRDVRLETYDPELAKAIAAEAGRQEDHVELIASENYCSQLVMEAQGSQLTNKYAEGYPGKRYYGGCAFVDIAEQLAIDRIKQVFDADYANVQPHSGSQANQAVYLALLQPGDTILGMSLAHGGHLTHGAKANVSGKLFNAVQYGVNEQGLIDYDEVQRLATEHTPKMVVAGFSAYSQKIDWARFRAIADSVGAYLFVDMAHIAGLVAAGVYPSPMEHAHVVTSTTHKTLRGPRGGIIVAKGASEELQKKLQSIVFPGIQGGPLMHVIAAKAVAFKEALEPAFKTYQQQVVKNAQAMANTLIARGYKIVSGGTENHLMLVDMIGRDVSGKDAEAALGKAHITVNKNAVPNDPRSPFVTSGLRLGTPAITTRGYKEPDSIDLANWIADVLDAPTDEAVLAKVRDAVTAQCKRYPVYG
>NZ_CP013679.1|WP_011409395.1|4125115_4125631_-|hypothetical-protein
MALIARRLGAASKYDHLACVRAAGLRCEVDLPRQGILPHDLIHLWVESRLGLSDGFIGLVAKGADIDYAGKGLHRHVDPERQMQAGQAESVVEALQSQLWSGQFDEAMFHYGPAQACSMRGVMPPELEGIAPEEDLFIPLTRSGAAWNAMAAGMEWRLAFARQPGMLEEHR
>NZ_CP013679.1|WP_011260261.1|4124591_4125116_-|transcriptional-repressor-NrdR
MHCPFCQHSDTRVIDSRVSEDGTTIRRRRECEACGERFSTLETIELKLPTVVKSDGGREAFDARKLRTSFDRALQKRPVAEEQIEAAVRSVVHQLRMSGEREVGSLRVGEYVMVELRKLDHVGYVRFASVYRSFQDVADFREEIEKLERELPVGSEQLPLLEVALERAGKPGKR
>NZ_CP013679.1|WP_011260260.1|4124109_4124595_-|GNAT-family-N-acetyltransferase
MSAMRIACVAETPAYLPEIAQAHLQAFGTLLPEWNLDEALSELCSHARDGVIPTTWVAKDEAQWLGSVSLLENDDARIRQWSPWLASLYVQPQARGQGIGEALVAHCVQAAARLCVPLLYLYCQPALVPFYQRLGWQTHAEFLLGPMHIVVMRSAPGAVTR
>NZ_CP013679.1|WP_011260259.1|4123003_4124113_-|bifunctional-diaminohydroxyphosphoribosylaminopyrimidine-deaminase/5-amino-6-(5-phosphoribosylamino)uracil-reductase-RibD
MSETAAIASADDHRWMAQALRLAERGAYTTRPNPMVGCVIVRDGVCVGEGFHQRAGGPHAEVFALRAAGELARGATAYVTLEPCAHYGRTPPCALALIEAGVTRVVAAMADPFPQVNGGGFALLRDAGIEVLSGVMHAQARTLNQGFLSRVERGRPWLRVKLGASLDGRTALASGQSKWITGADARADVQRWRARAGAILTGAGTVLADDPSMTVRLGDDIACVPPLRVVLDAGLRTLACKNIRNGDAPTLYLHGDAVAATALDGAECAALPLHVGRFDLSAVLALLAERGINEVHVEAGATLSGALLQAGLVDELLVYMAPVLLGDTARPLLAGLGIETMAQRYELQLRDVRQLGQDLRLRYAPSAVV
>NZ_CP013679.1|WP_011260258.1|4122324_4122948_+|hypothetical-protein
MCKTLILAALLAAAPFAASAEGLSYNYVEGGWNRTDVNVNNDNEGSNGGYLRGSWQIAQPVYVFAGYQLATKDYNLGAGFTIDGTLTQANAGIGYRQEMTERVEFIADISALRTKVDVDLRQSGRSLGSSSDSSTLGWANLGLRGKPSPRTEAWVKAGYIDGSNVDKGEFVGTLGGQVNFTQTWGLVGEAQFIDNANQYRIGVRASF
>NZ_CP013679.1|WP_011260257.1|4121161_4121764_-|riboflavin-synthase
MFTGIIEGVGQLAARQPQGGDVRFTFATGTLPFESVQLGESIAVNGVCLTVVAFDAASFQADASTETLSLTTLGALPEGALLNLERAMRPIDRLGGHLVSGHVDGLGQVQSVHDDARAQRWRFAAPPAVLRYVAKKGSICVDGVSLTVNEVDEEGFEAALIPHTMANTAFAQTAVGATVNLEIDLVARYVERLLGTRGTA
>NZ_CP013679.1|WP_011260256.1|4120025_4121165_-|3,4-dihydroxy-2-butanone-4-phosphate-synthase
MNFAPVPALLEELRAGRMVVIVDDEDRENEGDLIMAAELVTPSDINFMVTHARGLVCLSLTGERCAQLGLAPMVRNNTAQFQTNFTVSIEAAEGVTTGISAYDRAHTVRTAVRPDAKPQDLSQPGHIFPLISQPGGVLTRAGHTEAASDLSMLAGLEPAGVLVEVLNPDGSMARRPQLEVFAREHGLKMGSIADLIAYRLANEHTVERVDERDITTEFGPFKLVTYRDRIAHDLHFALVRGSADPHTPTLVRVQVENPLADLLHWQRDDFGVAATDALRAIAAEGQGVMVVLSAPRDSESLLARLRQQPEAAANAKDVSQWRRHGAGAQILAELGLGKLRVLGTSRRQVGVAGFGLEVVEYLECHAGEGVRSVPPSAVS
>NZ_CP013679.1|WP_010367724.1|4130893_4132555_+|energy-dependent-translational-throttle-protein-EttA
MSQYIYTMNRVSKVVPPKRQIIKDISLSFFPGAKIGLLGLNGAGKSTVLKIMAGVDTDFEGEARPQAGIKVGYLAQEPQLNPEHTVREAVEEGVGDVLQAQAALDAVYLAYAEEGADFDALAKEQERLEAILAAGDAHTLENQLDVAADALRLPPWEAIVGKLSGGEKRRVALCRLLLQKPDMLLLDEPTNHLDAESVEWLEQFLARYTGTVVAVTHDRYFLDNAAEWILELDRGRGIPWKGNYTDWLTQKDERLKQEDNQEKSRQKAIQKELEWSRQNAKGGRTKGKARLARLEELQSVDYQKRNETNEIFIPPGERLGNAVMEFKNVSKKFGDRLLIDNLSMIVPPGAIVGIIGPNGAGKSTLFKMITGQEKPDSGEIVVGPTVQLSYVDQSRDALEGNHNVFQEIAGGLDILNINGIEIQSRAYIGRFNFKGQDQQKMVGSLSGGERGRLHMAKTLLQGGNVLLLDEPSNDLDIETLRALEDALLEFPGNTFVISHDRWFLDRIATHILAFEGDSHVEFFQGNYREYEEDKRRRMGDDAGPKRLRFKALK
>NZ_CP013679.1|WP_011260267.1|4132729_4133074_+|hypothetical-protein
MHMPVSYSISLPDPKLARGSAPSVSFTANGADAFAEQLQSALRDPAWFDRWRQLQPDPDEVDPSLGITDPAATVTGRQHDLRIDLVATTSIPGALFKQRMQALAGAHWEMRDVR
>NZ_CP013679.1|WP_011409398.1|4133070_4133403_-|DUF4386-domain-containing-protein
MGSRWHQWHCWATASRSIAPIFSGAACLVSDSVIYRSTYLPRTVGVLMLLAGISYLIAAFAQQLAPEFAATINPGILLPVLVGGTTLCLWLLLKGVNRARRDARVSESSA
>NZ_CP013679.1|WP_012444166.1|4133560_4133788_-|DUF4386-family-protein
MAHDIHARPQFYARLAGALYLAVIVLAGWAEGYVSNALIVAGDDQATLRSIVAHAALWKMWLGANLVVPLRAVVQ
>NZ_CP013679.1|WP_011260269.1|4133917_4134748_-|S-formylglutathione-hydrolase
MERIEHRACFGGWQDVYRHQSQTLDCRMHVGVYLPPQAADGPLPVLYWLSGLTCTEQNFISKAGAQRYAAEHGVILVAPDTSPRGDDIADADGYDIGKGAGFYLDATQAPWAAHYRMYDYVVNELPALIEAHFATTGVRAISGHSMGGHGALTIALKNPGRYRSVSAFSPIVAPSQVPWGEKAFSQYLGDDRATWNAYDATALIADAQERLPLLIDQGDADEFLQNQLKTVLFEDAAKAAGYPVTVRLQPGYDHSYYFISSFMGEHIAHHAAALRG
>NZ_CP013679.1|WP_011409400.1|4135449_4136559_-|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase
MKSRAAVAFGPGKPLEMVEIDVAPPKAGEVLVRITHTGVCHTDAFTLSGDDPEGIFPSVLGHEGGGIVEQVGEGVTSVKVGDHVIPLYTAECRKCKFCLSGKTNLCQAVRATQGKGLMPDGTTRFSYNGEPIYHYMGCSTFSEYTVVPEISLAVVNPEAPLEKVCLLGCGVTTGIGAVHNTAKVKPGESVAVFGLGGIGLAVIQGAVQAKAGRILAIDTNPGKFDLARSMGATDCINPKDYDKPIQEVIVELTDGGVDFSFECIGNVNVMRSALECCHKGWGESVIIGVAGAGQEISTRPFQLVTGRVWRGSAFGGVKGRTQLPGMVEQSMKGEIDLDPFITHTMPLEEINEAFHLMHEGKSIRTVIHF
>NZ_CP013679.1|WP_011260271.1|4136623_4136899_-|metal/formaldehyde-sensitive-transcriptional-repressor
MPHSPHEKKRALARVRRLRGQCDALERALQAGADCAPVLQQIAAIRGAVNGLMSQVLQAHIREDFGHAAASDAQRAERVQDLLGLVRSYLK
>NZ_CP013679.1|WP_011260272.1|4137783_4138884_-|glycosyltransferase
MIERDIVQETTASTRCRSTGACAHDKAFPMMRVISRDNGVGLTRDMVLMAETLRAGGVPVQEVGFTSQRLHDTGREVRLWASRVLFGQVPLQIFSERVYRRCLLLGQINLLVPNPEWLLPKWLPLLPRFDAVLCKTHHAERIFRSLGCATRFIGFTSPDRYDARVFRQRAFFHLAGRSTAKGTRVLLETWQRHPEWPLLTVVQNPRTAGKPVVAPNIDHRVGYLDDAELRRMQNAHLFHLCPSEAEGFGHYLMEALSVGAVTLATDGEPMNELIKPEHGVLIPVAEVRQRHLASYYYVDAAGIAQAVESALALPQAQLDQLSANARAFYQANDAAFAARFRNAVLASLPGHAVDPVAIVARAAAEN
>NZ_CP013679.1|WP_042465749.1|4139022_4139742_+|response-regulator-transcription-factor
MDLQPPCVLVVDDDPDLRKLIGEFLSAHGYQVDMAENVAEMRSVMAQRRPDLIVLDVMMPGEDGLSAARTLASERGSPAVIMLSALGNDTDRIIGLEVGADDYLAKPCNPHELLARVRALLRRSQSSNEQSDQRGNVYEFAGWRLDVVRRDLRDPTGIFINLSDGEFALLRTFVEHPQRVLSRDQLLECARGRDTDVYDRAIDSQISRLRRKINERVHTELIRTVRNEGYMLLPSVSRL
>NZ_CP013679.1|WP_011409404.1|4139738_4141238_+|HAMP-domain-containing-histidine-kinase
MSKPARRGLSIFARTFVLLAVALLTAQAVGIALLVMHTPVYEPPVHPPEVVALLSTRMPAGTRTLKVHDSAQAPMPPIGQVRDPFAEMLLAHWLDVPAAQVRFYRHANDREAPQPGMLPPQRWSTQERAVDAEGVADERAGAQGLPPFPHNWPRDGQPGALSGTGPGPDEMPGAWESERLTPGVPLLDGFTAALQQPDGRWRTVESPRRRLSGEFKTHVVLLFLAGLLANVPLAWWFSRALSAPIKRFAEAADRLGRNPDAAALQRSGPPEIVRAADSFNAMQARLNRLINERTHMVAAIAHDLRTPLARLSFRLNGLQPPLRDKALADIDEMKAMISAALHFIHNDSHRTPRSPLDFRLLVESVVDDARDTGADVSLHAGQAITLDGDPLSLRRMVMNLVENALKYGKRARLHLRRDATECVLWIDDDGPGIDPNQQEKLFLPFFRGENSRNRDTGGIGLGLSVAHSTVLAHGGEIELNNRPESGLRVCVTLPCQAST

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	CP030170	Xanthomonas citri pv. punicae strain BD0025 plasmid unnamed, complete sequence	53776-53811	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP019227	Xanthomonas oryzae pv. oryzae strain IX-280 plasmid pXOO43, complete sequence	21099-21134	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_KR071788	Xanthomonas oryzae pv. oryzicola strain GX01 plasmid pXOCgx01, complete sequence	23876-23911	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	CP030162	Xanthomonas citri pv. punicae strain BD0023 plasmid unnamed, complete sequence	102754-102789	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP030165	Xanthomonas citri pv. punicae strain LMG7439 plasmid unnamed, complete sequence	3287-3322	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP030165	Xanthomonas citri pv. punicae strain LMG7439 plasmid unnamed, complete sequence	125418-125453	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP018860	Xanthomonas citri pv. citri strain LH201 plasmid pLH201.2, complete sequence	79889-79924	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP018852	Xanthomonas citri pv. citri strain LJ207-7 plasmid pLJ207-7.2, complete sequence	17209-17244	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP024030	Xanthomonas citri pv. citri strain Xcc49 plasmid pXAC64, complete sequence	41885-41920	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP011963	Xanthomonas oryzae pv. oryzicola strain CFBP2286 plasmid, complete sequence	18971-19006	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP009012	Xanthomonas citri pv. citri strain JX4 plasmid pXAC64, complete sequence	42128-42163	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP008997	Xanthomonas citri pv. citri strain MN12 plasmid pXAC64, complete sequence	40937-40972	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP013664	Xanthomonas citri pv. citri strain jx-6 plasmid pXAC64, complete sequence	42136-42171	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP009000	Xanthomonas citri pv. citri strain MN11 plasmid pXAC64, complete sequence	40937-40972	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP024033	Xanthomonas citri pv. citri strain Xcc29-1 plasmid pXAC64, complete sequence	41888-41923	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP009015	Xanthomonas citri pv. citri strain GD3 plasmid pXAC64, complete sequence	42135-42170	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP008994	Xanthomonas citri pv. citri strain NT17 plasmid pXAC64, complete sequence	42136-42171	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP009009	Xanthomonas citri pv. citri strain JX5 plasmid pXAC64, complete sequence	42128-42163	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP009003	Xanthomonas citri pv. citri strain MN10 plasmid pXAC64, complete sequence	40937-40972	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP009018	Xanthomonas citri pv. citri strain GD2 plasmid pXAC64, complete sequence	42136-42171	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP009021	Xanthomonas citri pv. citri strain FB19 plasmid pXAC64, complete sequence	42136-42171	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP008988	Xanthomonas citri pv. citri strain UI7 plasmid pXAC64, complete sequence	42136-42171	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NC_020797	Xanthomonas axonopodis Xac29-1 plasmid pXAC64, complete sequence	41875-41910	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP009006	Xanthomonas citri pv. citri strain MF20 plasmid pXAC64, complete sequence	42136-42171	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP008991	Xanthomonas citri subsp. citri UI6 plasmid pXAC64, complete sequence	42136-42171	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NC_003922	Xanthomonas citri pv. citri str. 306 plasmid pXAC64, complete sequence	42136-42171	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	CP030179	Xanthomonas citri pv. punicae strain LMG 859 plasmid unnamed, complete sequence	92643-92678	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP023287	Xanthomonas citri pv. citri strain 03-1638-1-1 plasmid pP2, complete sequence	7694-7729	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	CP030160	Xanthomonas citri pv. punicae strain BD0022 plasmid unnamed, complete sequence	21840-21875	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP034651	Xanthomonas vasicola strain NCPPB 1060 plasmid pXVH45, complete sequence	37405-37440	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP018849	Xanthomonas citri pv. citri strain LL074-4 plasmid pLL074-4.2, complete sequence	6012-6047	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP018856	Xanthomonas citri pv. citri strain LH276 plasmid pLH276.2, complete sequence	62815-62850	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	CP030167	Xanthomonas citri pv. punicae strain LMG7504 plasmid unnamed1, complete sequence	21710-21745	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP023157	Xanthomonas citri pv. malvacearum strain AR81009 plasmid unnamed2, complete sequence	20431-20466	0	1.0
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	NZ_CP019227	Xanthomonas oryzae pv. oryzae strain IX-280 plasmid pXOO43, complete sequence	3593-3625	0	1.0
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	NZ_KR071788	Xanthomonas oryzae pv. oryzicola strain GX01 plasmid pXOCgx01, complete sequence	6760-6792	0	1.0
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	NZ_CP011963	Xanthomonas oryzae pv. oryzicola strain CFBP2286 plasmid, complete sequence	634-666	0	1.0
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	NZ_CP024032	Xanthomonas citri pv. citri strain Xcc29-1 plasmid pXAC33, complete sequence	20045-20077	0	1.0
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	NZ_CP024033	Xanthomonas citri pv. citri strain Xcc29-1 plasmid pXAC64, complete sequence	22563-22595	0	1.0
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	NC_020801	Xanthomonas axonopodis Xac29-1 plasmid pXAC33, complete sequence	20046-20078	0	1.0
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	NC_020797	Xanthomonas axonopodis Xac29-1 plasmid pXAC64, complete sequence	22550-22582	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	CP030179	Xanthomonas citri pv. punicae strain LMG 859 plasmid unnamed, complete sequence	91958-91992	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP017192	Xanthomonas campestris pv. vesicatoria str. 85-10 plasmid p_XCV_2, complete sequence	25442-25476	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP023287	Xanthomonas citri pv. citri strain 03-1638-1-1 plasmid pP2, complete sequence	7009-7043	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	CP030160	Xanthomonas citri pv. punicae strain BD0022 plasmid unnamed, complete sequence	21155-21189	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP034651	Xanthomonas vasicola strain NCPPB 1060 plasmid pXVH45, complete sequence	36720-36754	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP018849	Xanthomonas citri pv. citri strain LL074-4 plasmid pLL074-4.2, complete sequence	5327-5361	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP018856	Xanthomonas citri pv. citri strain LH276 plasmid pLH276.2, complete sequence	62130-62164	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	CP030167	Xanthomonas citri pv. punicae strain LMG7504 plasmid unnamed1, complete sequence	21025-21059	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	CP030168	Xanthomonas citri pv. punicae strain LMG7504 plasmid unnamed2, complete sequence	4880-4914	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	CP030170	Xanthomonas citri pv. punicae strain BD0025 plasmid unnamed, complete sequence	54462-54496	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP019227	Xanthomonas oryzae pv. oryzae strain IX-280 plasmid pXOO43, complete sequence	21785-21819	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	CP030162	Xanthomonas citri pv. punicae strain BD0023 plasmid unnamed, complete sequence	103440-103474	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP018465	Xanthomonas euvesicatoria strain LMG930 plasmid pLMG930.4, complete sequence	751-785	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP030165	Xanthomonas citri pv. punicae strain LMG7439 plasmid unnamed, complete sequence	126104-126138	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP018860	Xanthomonas citri pv. citri strain LH201 plasmid pLH201.2, complete sequence	80575-80609	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP018852	Xanthomonas citri pv. citri strain LJ207-7 plasmid pLJ207-7.2, complete sequence	17895-17929	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP011164	Xanthomonas citri pv. aurantifolii strain FDC 1609 plasmid pXfc37, complete sequence	7444-7478	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP024030	Xanthomonas citri pv. citri strain Xcc49 plasmid pXAC64, complete sequence	42571-42605	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP011963	Xanthomonas oryzae pv. oryzicola strain CFBP2286 plasmid, complete sequence	19657-19691	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP009012	Xanthomonas citri pv. citri strain JX4 plasmid pXAC64, complete sequence	42814-42848	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP008997	Xanthomonas citri pv. citri strain MN12 plasmid pXAC64, complete sequence	41623-41657	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP013664	Xanthomonas citri pv. citri strain jx-6 plasmid pXAC64, complete sequence	42822-42856	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP009000	Xanthomonas citri pv. citri strain MN11 plasmid pXAC64, complete sequence	41623-41657	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP024033	Xanthomonas citri pv. citri strain Xcc29-1 plasmid pXAC64, complete sequence	42574-42608	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP021022	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pG, complete sequence	22279-22313	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP009015	Xanthomonas citri pv. citri strain GD3 plasmid pXAC64, complete sequence	42821-42855	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NC_007506	Xanthomonas campestris pv. vesicatoria str. 85-10 plasmid pXCV38, complete sequence	37335-37369	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP008994	Xanthomonas citri pv. citri strain NT17 plasmid pXAC64, complete sequence	42822-42856	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP009009	Xanthomonas citri pv. citri strain JX5 plasmid pXAC64, complete sequence	42814-42848	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP009003	Xanthomonas citri pv. citri strain MN10 plasmid pXAC64, complete sequence	41623-41657	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP009018	Xanthomonas citri pv. citri strain GD2 plasmid pXAC64, complete sequence	42822-42856	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP009021	Xanthomonas citri pv. citri strain FB19 plasmid pXAC64, complete sequence	42822-42856	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP008988	Xanthomonas citri pv. citri strain UI7 plasmid pXAC64, complete sequence	42822-42856	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NC_020797	Xanthomonas axonopodis Xac29-1 plasmid pXAC64, complete sequence	42561-42595	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP009006	Xanthomonas citri pv. citri strain MF20 plasmid pXAC64, complete sequence	42822-42856	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP008991	Xanthomonas citri subsp. citri UI6 plasmid pXAC64, complete sequence	42822-42856	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NC_003922	Xanthomonas citri pv. citri str. 306 plasmid pXAC64, complete sequence	42822-42856	0	1.0
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP011251	Xanthomonas citri pv. aurantifolii strain FDC 1561 plasmid pXfb33, complete sequence	31318-31352	0	1.0
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP019227	Xanthomonas oryzae pv. oryzae strain IX-280 plasmid pXOO43, complete sequence	16040-16074	0	1.0
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_KR071788	Xanthomonas oryzae pv. oryzicola strain GX01 plasmid pXOCgx01, complete sequence	18817-18851	0	1.0
NZ_CP013679_1	1.14\|868819\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868819-868852	34	CP018090	Xanthomonas oryzae pv. oryzae strain YN24 plasmid pXOOYN24, complete sequence	23415-23448	0	1.0
NZ_CP013679_1	1.15\|868884\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868884-868916	33	CP018090	Xanthomonas oryzae pv. oryzae strain YN24 plasmid pXOOYN24, complete sequence	12985-13017	0	1.0
NZ_CP013679_1	1.18\|869079\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869079-869114	36	AF162859	Xanthomonas oryzae phage phiXo adsorption protein pIII (gIII) gene, complete cds	1273-1308	0	1.0
NZ_CP013679_1	1.19\|869146\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869146-869180	35	NZ_CP019227	Xanthomonas oryzae pv. oryzae strain IX-280 plasmid pXOO43, complete sequence	2305-2339	0	1.0
NZ_CP013679_1	1.23\|869410\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869410-869444	35	AF162859	Xanthomonas oryzae phage phiXo adsorption protein pIII (gIII) gene, complete cds	499-533	0	1.0
NZ_CP013679_1	1.24\|869476\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869476-869511	36	CP020973	Xanthomonas axonopodis pv. phaseoli strain CFBP6546R plasmid pC, complete sequence	43502-43537	0	1.0
NZ_CP013679_1	1.24\|869476\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869476-869511	36	NZ_CP020969	Xanthomonas phaseoli pv. phaseoli strain CFBP6164 plasmid pC, complete sequence	38062-38097	0	1.0
NZ_CP013679_1	1.24\|869476\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869476-869511	36	NZ_CP021020	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pC, complete sequence	11851-11886	0	1.0
NZ_CP013679_1	1.24\|869476\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869476-869511	36	NZ_CP012062	Xanthomonas sp. ISO98C4 plasmid pNX47, complete sequence	14552-14587	0	1.0
NZ_CP013679_1	1.24\|869476\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869476-869511	36	NZ_CP020977	Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pC	3405-3440	0	1.0
NZ_CP013679_1	1.24\|869476\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869476-869511	36	NZ_CP020977	Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pC	50345-50380	0	1.0
NZ_CP013679_1	1.24\|869476\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869476-869511	36	NZ_CP012056	Xanthomonas citri pv. fuscans strain ISO12C3 plasmid pXff45, complete sequence	8384-8419	0	1.0
NZ_CP013679_1	1.24\|869476\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869476-869511	36	NZ_CP012054	Xanthomonas citri pv. fuscans strain ISO118C1 plasmid pXff45, complete sequence	8384-8419	0	1.0
NZ_CP013679_1	1.24\|869476\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869476-869511	36	NZ_CP012052	Xanthomonas citri pv. fuscans strain ISO118C5 plasmid pXff45, complete sequence	8384-8419	0	1.0
NZ_CP013679_1	1.24\|869476\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869476-869511	36	NZ_CP012059	Xanthomonas phaseoli pv. phaseoli strain ISO98C12 plasmid pXap47, complete sequence	14553-14588	0	1.0
NZ_CP013679_1	1.24\|869476\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869476-869511	36	NZ_CP012065	Xanthomonas phaseoli pv. phaseoli strain ISO18C8 plasmid pXap48, complete sequence	15947-15982	0	1.0
NZ_CP013679_1	1.24\|869476\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869476-869511	36	NZ_CP012050	Xanthomonas phaseoli pv. phaseoli strain ISO18C2 plasmid pXap48, complete sequence	15948-15983	0	1.0
NZ_CP013679_1	1.25\|869543\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869543-869576	34	NZ_CP033195	Xanthomonas oryzae pv. oryzae strain CIAT plasmid unnamed, complete sequence	56942-56975	0	1.0
NZ_CP013679_1	1.25\|869543\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869543-869576	34	NZ_CP033202	Xanthomonas oryzae pv. oryzae strain BXO1 plasmid pBXO1-1, complete sequence	39840-39873	0	1.0
NZ_CP013679_1	1.31\|869937\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869937-869971	35	AF162859	Xanthomonas oryzae phage phiXo adsorption protein pIII (gIII) gene, complete cds	604-638	0	1.0
NZ_CP013679_1	1.43\|870721\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	870721-870756	36	AF162859	Xanthomonas oryzae phage phiXo adsorption protein pIII (gIII) gene, complete cds	583-618	0	1.0
NZ_CP013679_1	1.67\|872293\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	872293-872326	34	NC_009543	Xanthomonas phage Xop411, complete genome	12539-12572	0	1.0
NZ_CP013679_1	1.67\|872293\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	872293-872326	34	NC_004902	Xanthomonas phage Xp10, complete genome	13500-13533	0	1.0
NZ_CP013679_1	1.67\|872293\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	872293-872326	34	AY299121	Xanthomonas oryzae bacteriophage Xp10 genomic DNA, complete genome	13500-13533	0	1.0
NZ_CP013679_1	1.72\|872617\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	872617-872651	35	NC_009543	Xanthomonas phage Xop411, complete genome	41902-41936	0	1.0
NZ_CP013679_1	1.72\|872617\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	872617-872651	35	AP008979	Xanthomonas oryzae phage OP1 DNA, complete genome	41695-41729	0	1.0
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP018465	Xanthomonas euvesicatoria strain LMG930 plasmid pLMG930.4, complete sequence	65-100	1	0.972
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP011164	Xanthomonas citri pv. aurantifolii strain FDC 1609 plasmid pXfc37, complete sequence	6758-6793	1	0.972
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP021022	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pG, complete sequence	21593-21628	1	0.972
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP020978	Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pD	28134-28169	1	0.972
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP011162	Xanthomonas citri pv. aurantifolii strain FDC 1559 plasmid pXfc38, complete sequence	37506-37541	1	0.972
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NC_007506	Xanthomonas campestris pv. vesicatoria str. 85-10 plasmid pXCV38, complete sequence	36649-36684	1	0.972
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP011251	Xanthomonas citri pv. aurantifolii strain FDC 1561 plasmid pXfb33, complete sequence	30632-30667	1	0.972
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP017192	Xanthomonas campestris pv. vesicatoria str. 85-10 plasmid p_XCV_2, complete sequence	26127-26162	1	0.972
NZ_CP013679_1	1.6\|868294\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868294-868329	36	NZ_CP020966	Xanthomonas phaseoli pv. phaseoli strain CFBP412 plasmid pD, complete sequence	14208-14243	1	0.972
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NC_005240	Xanthomonas citri plasmid pXcB, complete sequence	3512-3546	1	0.971
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP011165	Xanthomonas citri pv. aurantifolii strain FDC 1609 plasmid pXfc32, complete sequence	10581-10615	1	0.971
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP023157	Xanthomonas citri pv. malvacearum strain AR81009 plasmid unnamed2, complete sequence	19746-19780	1	0.971
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP020966	Xanthomonas phaseoli pv. phaseoli strain CFBP412 plasmid pD, complete sequence	13523-13557	1	0.971
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_KR071788	Xanthomonas oryzae pv. oryzicola strain GX01 plasmid pXOCgx01, complete sequence	24562-24596	1	0.971
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP012003	Xanthomonas citri pv. aurantifolii strain 1566 plasmid unnamed, complete sequence	25839-25873	1	0.971
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP020978	Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pD	28820-28854	1	0.971
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP011162	Xanthomonas citri pv. aurantifolii strain FDC 1559 plasmid pXfc38, complete sequence	212-246	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	CP030179	Xanthomonas citri pv. punicae strain LMG 859 plasmid unnamed, complete sequence	97692-97726	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	CP030170	Xanthomonas citri pv. punicae strain BD0025 plasmid unnamed, complete sequence	48728-48762	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	CP030162	Xanthomonas citri pv. punicae strain BD0023 plasmid unnamed, complete sequence	97706-97740	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP023287	Xanthomonas citri pv. citri strain 03-1638-1-1 plasmid pP2, complete sequence	12740-12774	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	CP030160	Xanthomonas citri pv. punicae strain BD0022 plasmid unnamed, complete sequence	26889-26923	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP030165	Xanthomonas citri pv. punicae strain LMG7439 plasmid unnamed, complete sequence	120370-120404	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP034651	Xanthomonas vasicola strain NCPPB 1060 plasmid pXVH45, complete sequence	42451-42485	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP018860	Xanthomonas citri pv. citri strain LH201 plasmid pLH201.2, complete sequence	74844-74878	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP018852	Xanthomonas citri pv. citri strain LJ207-7 plasmid pLJ207-7.2, complete sequence	12164-12198	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP018849	Xanthomonas citri pv. citri strain LL074-4 plasmid pLL074-4.2, complete sequence	11058-11092	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP018856	Xanthomonas citri pv. citri strain LH276 plasmid pLH276.2, complete sequence	67861-67895	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP024030	Xanthomonas citri pv. citri strain Xcc49 plasmid pXAC64, complete sequence	36840-36874	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP011963	Xanthomonas oryzae pv. oryzicola strain CFBP2286 plasmid, complete sequence	13912-13946	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP009012	Xanthomonas citri pv. citri strain JX4 plasmid pXAC64, complete sequence	37083-37117	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP008997	Xanthomonas citri pv. citri strain MN12 plasmid pXAC64, complete sequence	35892-35926	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP013664	Xanthomonas citri pv. citri strain jx-6 plasmid pXAC64, complete sequence	37091-37125	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP009000	Xanthomonas citri pv. citri strain MN11 plasmid pXAC64, complete sequence	35892-35926	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP024033	Xanthomonas citri pv. citri strain Xcc29-1 plasmid pXAC64, complete sequence	36843-36877	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	CP030167	Xanthomonas citri pv. punicae strain LMG7504 plasmid unnamed1, complete sequence	26759-26793	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP009015	Xanthomonas citri pv. citri strain GD3 plasmid pXAC64, complete sequence	37090-37124	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP008994	Xanthomonas citri pv. citri strain NT17 plasmid pXAC64, complete sequence	37091-37125	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP009009	Xanthomonas citri pv. citri strain JX5 plasmid pXAC64, complete sequence	37083-37117	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP009003	Xanthomonas citri pv. citri strain MN10 plasmid pXAC64, complete sequence	35892-35926	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP009018	Xanthomonas citri pv. citri strain GD2 plasmid pXAC64, complete sequence	37091-37125	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP009021	Xanthomonas citri pv. citri strain FB19 plasmid pXAC64, complete sequence	37091-37125	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP008988	Xanthomonas citri pv. citri strain UI7 plasmid pXAC64, complete sequence	37091-37125	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NC_020797	Xanthomonas axonopodis Xac29-1 plasmid pXAC64, complete sequence	36830-36864	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP009006	Xanthomonas citri pv. citri strain MF20 plasmid pXAC64, complete sequence	37091-37125	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP008991	Xanthomonas citri subsp. citri UI6 plasmid pXAC64, complete sequence	37091-37125	1	0.971
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NC_003922	Xanthomonas citri pv. citri str. 306 plasmid pXAC64, complete sequence	37091-37125	1	0.971
NZ_CP013679_1	1.25\|869543\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869543-869576	34	CP020973	Xanthomonas axonopodis pv. phaseoli strain CFBP6546R plasmid pC, complete sequence	28534-28567	1	0.971
NZ_CP013679_1	1.25\|869543\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869543-869576	34	CP020974	Xanthomonas axonopodis pv. phaseoli strain CFBP6546R plasmid unnamed1, complete sequence	27402-27435	1	0.971
NZ_CP013679_1	1.25\|869543\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869543-869576	34	NZ_CP031608	Xanthomonas hortorum strain VT106 plasmid pVT106, complete sequence	18416-18449	1	0.971
NZ_CP013679_1	1.25\|869543\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869543-869576	34	NZ_CP016879	Xanthomonas hortorum strain B07-007 plasmid pB07007, complete sequence	41302-41335	1	0.971
NZ_CP013679_1	1.25\|869543\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869543-869576	34	NZ_CP020969	Xanthomonas phaseoli pv. phaseoli strain CFBP6164 plasmid pC, complete sequence	39390-39423	1	0.971
NZ_CP013679_1	1.25\|869543\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869543-869576	34	NZ_CP012062	Xanthomonas sp. ISO98C4 plasmid pNX47, complete sequence	11889-11922	1	0.971
NZ_CP013679_1	1.25\|869543\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869543-869576	34	NZ_CP020977	Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pC	2079-2112	1	0.971
NZ_CP013679_1	1.25\|869543\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869543-869576	34	NZ_CP020977	Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pC	49019-49052	1	0.971
NZ_CP013679_1	1.25\|869543\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869543-869576	34	NZ_CP012059	Xanthomonas phaseoli pv. phaseoli strain ISO98C12 plasmid pXap47, complete sequence	11889-11922	1	0.971
NZ_CP013679_1	1.25\|869543\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869543-869576	34	NZ_CP012065	Xanthomonas phaseoli pv. phaseoli strain ISO18C8 plasmid pXap48, complete sequence	13284-13317	1	0.971
NZ_CP013679_1	1.25\|869543\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869543-869576	34	NZ_CP012050	Xanthomonas phaseoli pv. phaseoli strain ISO18C2 plasmid pXap48, complete sequence	13285-13318	1	0.971
NZ_CP013679_1	1.25\|869543\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869543-869576	34	NZ_CP018733	Xanthomonas gardneri strain ICMP 7383 plasmid pICMP7383.2, complete sequence	31732-31765	1	0.971
NZ_CP013679_1	1.44\|870788\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	870788-870823	36	NC_004902	Xanthomonas phage Xp10, complete genome	4198-4233	1	0.972
NZ_CP013679_1	1.44\|870788\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	870788-870823	36	AY299121	Xanthomonas oryzae bacteriophage Xp10 genomic DNA, complete genome	4198-4233	1	0.972
NZ_CP013679_1	1.48\|871051\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	871051-871084	34	AP008979	Xanthomonas oryzae phage OP1 DNA, complete genome	29019-29052	1	0.971
NZ_CP013679_1	1.57\|871642\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	871642-871675	34	AP008979	Xanthomonas oryzae phage OP1 DNA, complete genome	29934-29967	1	0.971
NZ_CP013679_1	1.58\|871707\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	871707-871742	36	AP008979	Xanthomonas oryzae phage OP1 DNA, complete genome	26806-26841	1	0.972
NZ_CP013679_1	1.65\|872165\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	872165-872197	33	NC_004902	Xanthomonas phage Xp10, complete genome	35496-35528	1	0.97
NZ_CP013679_1	1.65\|872165\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	872165-872197	33	AY299121	Xanthomonas oryzae bacteriophage Xp10 genomic DNA, complete genome	35496-35528	1	0.97
NZ_CP013679_1	1.66\|872229\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	872229-872261	33	AP008979	Xanthomonas oryzae phage OP1 DNA, complete genome	34255-34287	1	0.97
NZ_CP013679_1	1.66\|872229\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	872229-872261	33	NC_004902	Xanthomonas phage Xp10, complete genome	33974-34006	1	0.97
NZ_CP013679_1	1.66\|872229\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	872229-872261	33	AY299121	Xanthomonas oryzae bacteriophage Xp10 genomic DNA, complete genome	33974-34006	1	0.97
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	CP030179	Xanthomonas citri pv. punicae strain LMG 859 plasmid unnamed, complete sequence	112043-112075	2	0.939
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	CP030170	Xanthomonas citri pv. punicae strain BD0025 plasmid unnamed, complete sequence	34379-34411	2	0.939
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	CP030162	Xanthomonas citri pv. punicae strain BD0023 plasmid unnamed, complete sequence	83357-83389	2	0.939
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	CP030160	Xanthomonas citri pv. punicae strain BD0022 plasmid unnamed, complete sequence	41243-41275	2	0.939
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	NZ_CP030165	Xanthomonas citri pv. punicae strain LMG7439 plasmid unnamed, complete sequence	106021-106053	2	0.939
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	NZ_CP034651	Xanthomonas vasicola strain NCPPB 1060 plasmid pXVH45, complete sequence	8788-8820	2	0.939
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	NZ_CP012003	Xanthomonas citri pv. aurantifolii strain 1566 plasmid unnamed, complete sequence	10001-10033	2	0.939
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	NC_005240	Xanthomonas citri plasmid pXcB, complete sequence	22437-22469	2	0.939
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	NZ_CP022266	Xanthomonas citri pv. vignicola strain CFBP7111 plasmid plB, complete sequence	38975-39007	2	0.939
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	NZ_CP011165	Xanthomonas citri pv. aurantifolii strain FDC 1609 plasmid pXfc32, complete sequence	1510-1542	2	0.939
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	CP022269	Xanthomonas citri pv. vignicola strain CFBP7112 plasmid plB, complete sequence	1338-1370	2	0.939
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	CP022269	Xanthomonas citri pv. vignicola strain CFBP7112 plasmid plB, complete sequence	18286-18318	2	0.939
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	CP030167	Xanthomonas citri pv. punicae strain LMG7504 plasmid unnamed1, complete sequence	41110-41142	2	0.939
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	CP030168	Xanthomonas citri pv. punicae strain LMG7504 plasmid unnamed2, complete sequence	21893-21925	2	0.939
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	NZ_CP023156	Xanthomonas citri pv. malvacearum strain AR81009 plasmid unnamed1, complete sequence	52991-53023	2	0.939
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	NZ_CP011161	Xanthomonas citri pv. aurantifolii strain FDC 1559 plasmid pXfc43, complete sequence	13875-13907	2	0.939
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	NZ_CP013005	Xanthomonas citri pv. malvacearum strain XcmH1005 plasmid pXcmH, complete sequence	59888-59920	2	0.939
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	NZ_CP013007	Xanthomonas citri pv. malvacearum strain XcmN1003 plasmid pXcmN, complete sequence	35449-35481	2	0.939
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	NZ_CP046021	Xanthomonas citri pv. malvacearum strain HD-1 plasmid unnamed2, complete sequence	1261-1293	2	0.939
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	NZ_CP011251	Xanthomonas citri pv. aurantifolii strain FDC 1561 plasmid pXfb33, complete sequence	15480-15512	2	0.939
NZ_CP013679_1	1.8\|868425\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868425-868459	35	NZ_CP030165	Xanthomonas citri pv. punicae strain LMG7439 plasmid unnamed, complete sequence	3964-3998	2	0.943
NZ_CP013679_1	1.27\|869673\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869673-869707	35	MH218848	Xanthomonas phage phiLf2, complete genome	4352-4386	2	0.943
NZ_CP013679_1	1.27\|869673\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869673-869707	35	AF018286	Xanthomonas campestris phage phi-Lf protein VI (VI) and protein I (I) genes, complete cds	1531-1565	2	0.943
NZ_CP013679_1	1.27\|869673\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869673-869707	35	MH206184	Xanthomonas phage phiLf UK variant, complete genome	4346-4380	2	0.943
NZ_CP013679_1	1.27\|869673\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869673-869707	35	MN263053	UNVERIFIED: Xanthomonas phage phiLF, complete genome	5767-5801	2	0.943
NZ_CP013679_1	1.34\|870134\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	870134-870167	34	NC_009543	Xanthomonas phage Xop411, complete genome	27516-27549	2	0.941
NZ_CP013679_1	1.41\|870589\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	870589-870624	36	NZ_CP033195	Xanthomonas oryzae pv. oryzae strain CIAT plasmid unnamed, complete sequence	60473-60508	2	0.944
NZ_CP013679_1	1.41\|870589\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	870589-870624	36	NZ_CP019227	Xanthomonas oryzae pv. oryzae strain IX-280 plasmid pXOO43, complete sequence	1813-1848	2	0.944
NZ_CP013679_1	1.41\|870589\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	870589-870624	36	NZ_CP033202	Xanthomonas oryzae pv. oryzae strain BXO1 plasmid pBXO1-1, complete sequence	36308-36343	2	0.944
NZ_CP013679_1	1.44\|870788\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	870788-870823	36	NC_009543	Xanthomonas phage Xop411, complete genome	3329-3364	2	0.944
NZ_CP013679_1	1.47\|870986\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	870986-871019	34	AP008979	Xanthomonas oryzae phage OP1 DNA, complete genome	23647-23680	2	0.941
NZ_CP013679_1	1.57\|871642\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	871642-871675	34	NC_009543	Xanthomonas phage Xop411, complete genome	29040-29073	2	0.941
NZ_CP013679_1	1.57\|871642\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	871642-871675	34	NC_004902	Xanthomonas phage Xp10, complete genome	29651-29684	2	0.941
NZ_CP013679_1	1.57\|871642\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	871642-871675	34	AY299121	Xanthomonas oryzae bacteriophage Xp10 genomic DNA, complete genome	29651-29684	2	0.941
NZ_CP013679_1	1.59\|871774\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	871774-871806	33	DQ408365	Xanthomonas oryzae phage Xo411 hypothetical proteins and lysozyme (lys411) genes, complete cds	1509-1541	2	0.939
NZ_CP013679_1	1.59\|871774\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	871774-871806	33	NC_009543	Xanthomonas phage Xop411, complete genome	21288-21320	2	0.939
NZ_CP013679_1	1.59\|871774\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	871774-871806	33	NC_004902	Xanthomonas phage Xp10, complete genome	22379-22411	2	0.939
NZ_CP013679_1	1.59\|871774\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	871774-871806	33	AY299121	Xanthomonas oryzae bacteriophage Xp10 genomic DNA, complete genome	22379-22411	2	0.939
NZ_CP013679_1	1.62\|871969\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	871969-872002	34	NC_004902	Xanthomonas phage Xp10, complete genome	7071-7104	2	0.941
NZ_CP013679_1	1.62\|871969\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	871969-872002	34	AY299121	Xanthomonas oryzae bacteriophage Xp10 genomic DNA, complete genome	7071-7104	2	0.941
NZ_CP013679_1	1.64\|872100\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	872100-872133	34	AP008979	Xanthomonas oryzae phage OP1 DNA, complete genome	37952-37985	2	0.941
NZ_CP013679_1	1.66\|872229\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	872229-872261	33	NC_009543	Xanthomonas phage Xop411, complete genome	33361-33393	2	0.939
NZ_CP013679_1	1.69\|872422\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	872422-872455	34	NC_009543	Xanthomonas phage Xop411, complete genome	29134-29167	2	0.941
NZ_CP013679_2	2.3\|4130467\|25\|NZ_CP013679\|CRISPRCasFinder	4130467-4130491	25	NZ_CP049159	Caballeronia sp. SBC1 plasmid pSBC1_3, complete sequence	435278-435302	2	0.92
NZ_CP013679_2	2.3\|4130467\|25\|NZ_CP013679\|CRISPRCasFinder	4130467-4130491	25	NZ_CP049320	Caballeronia sp. SBC2 plasmid pSBC2-4, complete sequence	364745-364769	2	0.92
NZ_CP013679_2	2.3\|4130467\|25\|NZ_CP013679\|CRISPRCasFinder	4130467-4130491	25	NZ_AP022334	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49b, complete sequence	82586-82610	2	0.92
NZ_CP013679_1	1.37\|870328\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	870328-870362	35	AP008979	Xanthomonas oryzae phage OP1 DNA, complete genome	23101-23135	3	0.914
NZ_CP013679_1	1.63\|872034\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	872034-872068	35	MH218848	Xanthomonas phage phiLf2, complete genome	4285-4319	3	0.914
NZ_CP013679_1	1.63\|872034\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	872034-872068	35	AF018286	Xanthomonas campestris phage phi-Lf protein VI (VI) and protein I (I) genes, complete cds	1464-1498	3	0.914
NZ_CP013679_1	1.63\|872034\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	872034-872068	35	MH206184	Xanthomonas phage phiLf UK variant, complete genome	4279-4313	3	0.914
NZ_CP013679_1	1.63\|872034\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	872034-872068	35	MN263053	UNVERIFIED: Xanthomonas phage phiLF, complete genome	5700-5734	3	0.914
NZ_CP013679_1	1.69\|872422\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	872422-872455	34	NC_004902	Xanthomonas phage Xp10, complete genome	29745-29778	3	0.912
NZ_CP013679_1	1.69\|872422\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	872422-872455	34	AY299121	Xanthomonas oryzae bacteriophage Xp10 genomic DNA, complete genome	29745-29778	3	0.912
NZ_CP013679_2	2.3\|4130467\|25\|NZ_CP013679\|CRISPRCasFinder	4130467-4130491	25	KX752698	Mycobacterium phage Tonenili, complete genome	103788-103812	3	0.88
NZ_CP013679_2	2.3\|4130467\|25\|NZ_CP013679\|CRISPRCasFinder	4130467-4130491	25	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	163966-163990	3	0.88
NZ_CP013679_2	2.3\|4130467\|25\|NZ_CP013679\|CRISPRCasFinder	4130467-4130491	25	NZ_CP034351	Streptomyces sp. W1SF4 plasmid p1, complete sequence	320056-320080	3	0.88
NZ_CP013679_2	2.3\|4130467\|25\|NZ_CP013679\|CRISPRCasFinder	4130467-4130491	25	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	87321-87345	3	0.88
NZ_CP013679_2	2.3\|4130467\|25\|NZ_CP013679\|CRISPRCasFinder	4130467-4130491	25	NC_047977	Microbacterium phage Hendrix, complete genome	77313-77337	3	0.88
NZ_CP013679_2	2.3\|4130467\|25\|NZ_CP013679\|CRISPRCasFinder	4130467-4130491	25	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	704970-704994	3	0.88
NZ_CP013679_1	1.16\|868948\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868948-868981	34	MG944235	Xanthomonas phage XPV2, complete genome	26165-26198	4	0.882
NZ_CP013679_2	2.3\|4130467\|25\|NZ_CP013679\|CRISPRCasFinder	4130467-4130491	25	NZ_CP050081	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence	342578-342602	4	0.84
NZ_CP013679_2	2.3\|4130467\|25\|NZ_CP013679\|CRISPRCasFinder	4130467-4130491	25	NZ_CP053206	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence	340962-340986	4	0.84
NZ_CP013679_2	2.3\|4130467\|25\|NZ_CP013679\|CRISPRCasFinder	4130467-4130491	25	NZ_CP031166	Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence	282589-282613	4	0.84
NZ_CP013679_2	2.3\|4130467\|25\|NZ_CP013679\|CRISPRCasFinder	4130467-4130491	25	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	807674-807698	4	0.84
NZ_CP013679_2	2.3\|4130467\|25\|NZ_CP013679\|CRISPRCasFinder	4130467-4130491	25	NZ_CP014942	Rhodococcus sp. BH4 plasmid, complete sequence	538396-538420	4	0.84
NZ_CP013679_1	1.39\|870459\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	870459-870492	34	NC_004902	Xanthomonas phage Xp10, complete genome	4286-4319	5	0.853
NZ_CP013679_1	1.39\|870459\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	870459-870492	34	AY299121	Xanthomonas oryzae bacteriophage Xp10 genomic DNA, complete genome	4286-4319	5	0.853
NZ_CP013679_1	1.43\|870721\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	870721-870756	36	AF069776	Xanthomonas phage phi-Xv adsorption protein (gIII) gene, complete cds	583-618	5	0.861
NZ_CP013679_1	1.43\|870721\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	870721-870756	36	MH206183	Xanthomonas phage phiXv2, complete genome	2333-2368	5	0.861
NZ_CP013679_2	2.3\|4130467\|25\|NZ_CP013679\|CRISPRCasFinder	4130467-4130491	25	NZ_CP032686	Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence	167265-167289	5	0.8
NZ_CP013679_2	2.3\|4130467\|25\|NZ_CP013679\|CRISPRCasFinder	4130467-4130491	25	NZ_CP032691	Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence	162225-162249	5	0.8
NZ_CP013679_2	2.3\|4130467\|25\|NZ_CP013679\|CRISPRCasFinder	4130467-4130491	25	NZ_CP030830	Neorhizobium sp. NCHU2750 plasmid pNCHU2750c, complete sequence	46603-46627	5	0.8
NZ_CP013679_1	1.12\|868687\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868687-868721	35	NC_011892	Methylobacterium nodulans ORS 2060 plasmid pMNOD01, complete sequence	383328-383362	7	0.8
NZ_CP013679_1	1.25\|869543\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869543-869576	34	NC_010509	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD02, complete sequence	5890-5923	7	0.794
NZ_CP013679_1	1.29\|869805\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869805-869838	34	NZ_CP054620	Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence	192600-192633	7	0.794
NZ_CP013679_1	1.30\|869870\|36\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869870-869905	36	KT803877	Burkholderia phage PE067, complete genome	7010-7045	7	0.806
NZ_CP013679_1	1.35\|870199\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	870199-870231	33	MG592561	Vibrio phage 1.191.O._10N.286.52.B4, partial genome	7379-7411	7	0.788
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	NC_042355	Corynebacterium phage phi674, complete genome	15239-15271	8	0.758
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	MG324354	Corynebacterium phage phi674	15239-15271	8	0.758
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	MG324353	Corynebacterium phage phi673	15280-15312	8	0.758
NZ_CP013679_1	1.7\|868361\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868361-868393	33	NC_042354	Corynebacterium phage phi673, complete genome	15280-15312	8	0.758
NZ_CP013679_1	1.10\|868557\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868557-868590	34	NZ_CP050090	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b4, complete sequence	109155-109188	8	0.765
NZ_CP013679_1	1.11\|868622\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868622-868655	34	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	399314-399347	8	0.765
NZ_CP013679_1	1.11\|868622\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868622-868655	34	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	649292-649325	8	0.765
NZ_CP013679_1	1.25\|869543\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869543-869576	34	MH218848	Xanthomonas phage phiLf2, complete genome	4968-5001	8	0.765
NZ_CP013679_1	1.25\|869543\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869543-869576	34	MH206184	Xanthomonas phage phiLf UK variant, complete genome	4962-4995	8	0.765
NZ_CP013679_1	1.40\|870524\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	870524-870557	34	CP040467	Streptomyces albidoflavus strain UYFA156 plasmid unnamed, complete sequence	86952-86985	8	0.765
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_CP033583	Streptomyces sp. ADI95-16 plasmid pADI95-16b, complete sequence	72653-72687	9	0.743
NZ_CP013679_1	1.12\|868687\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868687-868721	35	NZ_CP023712	Rhodococcus ruber strain YC-YT1 plasmid unnamed1, complete sequence	130311-130345	9	0.743
NZ_CP013679_1	1.31\|869937\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869937-869971	35	AF069776	Xanthomonas phage phi-Xv adsorption protein (gIII) gene, complete cds	748-782	9	0.743
NZ_CP013679_1	1.31\|869937\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	869937-869971	35	MH206183	Xanthomonas phage phiXv2, complete genome	2498-2532	9	0.743
NZ_CP013679_1	1.9\|868491\|35\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868491-868525	35	NZ_LR134452	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence	346762-346796	10	0.714
NZ_CP013679_1	1.16\|868948\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868948-868981	34	NZ_CP028976	Cronobacter sakazakii strain GZcsf-1 plasmid pGW2, complete sequence	75410-75443	10	0.706
NZ_CP013679_1	1.16\|868948\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868948-868981	34	NZ_CP012258	Cronobacter universalis NCTC 9529 plasmid pCUNV1, complete sequence	122698-122731	10	0.706
NZ_CP013679_1	1.16\|868948\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	868948-868981	34	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	1038521-1038554	10	0.706
NZ_CP013679_1	1.65\|872165\|33\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	872165-872197	33	NZ_CP017244	Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence	1897159-1897191	10	0.697
NZ_CP013679_1	1.69\|872422\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	872422-872455	34	NZ_CP016619	Microvirga ossetica strain V5/3m plasmid unnamed2, complete sequence	150835-150868	10	0.706
NZ_CP013679_2	2.1\|4130365\|34\|NZ_CP013679\|CRISPRCasFinder	4130365-4130398	34	NZ_CP049701	Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence	147457-147490	10	0.706
NZ_CP013679_1	1.47\|870986\|34\|NZ_CP013679\|CRISPRCasFinder,CRT,PILER-CR	870986-871019	34	MG945614	UNVERIFIED: Microviridae sp. isolate 4943-1602, complete genome	5199-5232	11	0.676

1. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP030170 (Xanthomonas citri pv. punicae strain BD0025 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

2. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019227 (Xanthomonas oryzae pv. oryzae strain IX-280 plasmid pXOO43, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

3. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KR071788 (Xanthomonas oryzae pv. oryzicola strain GX01 plasmid pXOCgx01, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

4. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP030162 (Xanthomonas citri pv. punicae strain BD0023 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

5. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP030165 (Xanthomonas citri pv. punicae strain LMG7439 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

6. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP030165 (Xanthomonas citri pv. punicae strain LMG7439 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

7. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018860 (Xanthomonas citri pv. citri strain LH201 plasmid pLH201.2, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

8. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018852 (Xanthomonas citri pv. citri strain LJ207-7 plasmid pLJ207-7.2, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

9. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024030 (Xanthomonas citri pv. citri strain Xcc49 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

10. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011963 (Xanthomonas oryzae pv. oryzicola strain CFBP2286 plasmid, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

11. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009012 (Xanthomonas citri pv. citri strain JX4 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

12. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP008997 (Xanthomonas citri pv. citri strain MN12 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

13. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013664 (Xanthomonas citri pv. citri strain jx-6 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

14. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009000 (Xanthomonas citri pv. citri strain MN11 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

15. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024033 (Xanthomonas citri pv. citri strain Xcc29-1 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

16. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009015 (Xanthomonas citri pv. citri strain GD3 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

17. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP008994 (Xanthomonas citri pv. citri strain NT17 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

18. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009009 (Xanthomonas citri pv. citri strain JX5 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

19. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009003 (Xanthomonas citri pv. citri strain MN10 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

20. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009018 (Xanthomonas citri pv. citri strain GD2 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

21. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009021 (Xanthomonas citri pv. citri strain FB19 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

22. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP008988 (Xanthomonas citri pv. citri strain UI7 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

23. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_020797 (Xanthomonas axonopodis Xac29-1 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

24. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009006 (Xanthomonas citri pv. citri strain MF20 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

25. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP008991 (Xanthomonas citri subsp. citri UI6 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

26. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_003922 (Xanthomonas citri pv. citri str. 306 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

27. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP030179 (Xanthomonas citri pv. punicae strain LMG 859 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

28. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023287 (Xanthomonas citri pv. citri strain 03-1638-1-1 plasmid pP2, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

29. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP030160 (Xanthomonas citri pv. punicae strain BD0022 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

30. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034651 (Xanthomonas vasicola strain NCPPB 1060 plasmid pXVH45, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

31. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018849 (Xanthomonas citri pv. citri strain LL074-4 plasmid pLL074-4.2, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

32. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018856 (Xanthomonas citri pv. citri strain LH276 plasmid pLH276.2, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

33. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP030167 (Xanthomonas citri pv. punicae strain LMG7504 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

34. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023157 (Xanthomonas citri pv. malvacearum strain AR81009 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctacgt	Protospacer
************************************

35. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019227 (Xanthomonas oryzae pv. oryzae strain IX-280 plasmid pXOO43, complete sequence) position: , mismatch: 0, identity: 1.0

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcacgggccgtggatacgttactacccat	Protospacer
*********************************

36. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KR071788 (Xanthomonas oryzae pv. oryzicola strain GX01 plasmid pXOCgx01, complete sequence) position: , mismatch: 0, identity: 1.0

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcacgggccgtggatacgttactacccat	Protospacer
*********************************

37. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011963 (Xanthomonas oryzae pv. oryzicola strain CFBP2286 plasmid, complete sequence) position: , mismatch: 0, identity: 1.0

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcacgggccgtggatacgttactacccat	Protospacer
*********************************

38. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024032 (Xanthomonas citri pv. citri strain Xcc29-1 plasmid pXAC33, complete sequence) position: , mismatch: 0, identity: 1.0

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcacgggccgtggatacgttactacccat	Protospacer
*********************************

39. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024033 (Xanthomonas citri pv. citri strain Xcc29-1 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcacgggccgtggatacgttactacccat	Protospacer
*********************************

40. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_020801 (Xanthomonas axonopodis Xac29-1 plasmid pXAC33, complete sequence) position: , mismatch: 0, identity: 1.0

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcacgggccgtggatacgttactacccat	Protospacer
*********************************

41. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_020797 (Xanthomonas axonopodis Xac29-1 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcacgggccgtggatacgttactacccat	Protospacer
*********************************

42. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP030179 (Xanthomonas citri pv. punicae strain LMG 859 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

43. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017192 (Xanthomonas campestris pv. vesicatoria str. 85-10 plasmid p_XCV_2, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

44. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023287 (Xanthomonas citri pv. citri strain 03-1638-1-1 plasmid pP2, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

45. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP030160 (Xanthomonas citri pv. punicae strain BD0022 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

46. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034651 (Xanthomonas vasicola strain NCPPB 1060 plasmid pXVH45, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

47. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018849 (Xanthomonas citri pv. citri strain LL074-4 plasmid pLL074-4.2, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

48. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018856 (Xanthomonas citri pv. citri strain LH276 plasmid pLH276.2, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

49. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP030167 (Xanthomonas citri pv. punicae strain LMG7504 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

50. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP030168 (Xanthomonas citri pv. punicae strain LMG7504 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

51. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP030170 (Xanthomonas citri pv. punicae strain BD0025 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

52. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019227 (Xanthomonas oryzae pv. oryzae strain IX-280 plasmid pXOO43, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

53. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP030162 (Xanthomonas citri pv. punicae strain BD0023 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

54. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018465 (Xanthomonas euvesicatoria strain LMG930 plasmid pLMG930.4, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

55. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP030165 (Xanthomonas citri pv. punicae strain LMG7439 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

56. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018860 (Xanthomonas citri pv. citri strain LH201 plasmid pLH201.2, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

57. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018852 (Xanthomonas citri pv. citri strain LJ207-7 plasmid pLJ207-7.2, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

58. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011164 (Xanthomonas citri pv. aurantifolii strain FDC 1609 plasmid pXfc37, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

59. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024030 (Xanthomonas citri pv. citri strain Xcc49 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

60. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011963 (Xanthomonas oryzae pv. oryzicola strain CFBP2286 plasmid, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

61. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009012 (Xanthomonas citri pv. citri strain JX4 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

62. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP008997 (Xanthomonas citri pv. citri strain MN12 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

63. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013664 (Xanthomonas citri pv. citri strain jx-6 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

64. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009000 (Xanthomonas citri pv. citri strain MN11 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

65. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024033 (Xanthomonas citri pv. citri strain Xcc29-1 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

66. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021022 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pG, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

67. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009015 (Xanthomonas citri pv. citri strain GD3 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

68. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_007506 (Xanthomonas campestris pv. vesicatoria str. 85-10 plasmid pXCV38, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

69. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP008994 (Xanthomonas citri pv. citri strain NT17 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

70. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009009 (Xanthomonas citri pv. citri strain JX5 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

71. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009003 (Xanthomonas citri pv. citri strain MN10 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

72. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009018 (Xanthomonas citri pv. citri strain GD2 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

73. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009021 (Xanthomonas citri pv. citri strain FB19 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

74. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP008988 (Xanthomonas citri pv. citri strain UI7 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

75. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_020797 (Xanthomonas axonopodis Xac29-1 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

76. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009006 (Xanthomonas citri pv. citri strain MF20 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

77. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP008991 (Xanthomonas citri subsp. citri UI6 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

78. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_003922 (Xanthomonas citri pv. citri str. 306 plasmid pXAC64, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

79. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011251 (Xanthomonas citri pv. aurantifolii strain FDC 1561 plasmid pXfb33, complete sequence) position: , mismatch: 0, identity: 1.0

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
***********************************

80. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019227 (Xanthomonas oryzae pv. oryzae strain IX-280 plasmid pXOO43, complete sequence) position: , mismatch: 0, identity: 1.0

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaacgt	Protospacer
***********************************

81. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KR071788 (Xanthomonas oryzae pv. oryzicola strain GX01 plasmid pXOCgx01, complete sequence) position: , mismatch: 0, identity: 1.0

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaacgt	Protospacer
***********************************

82. spacer 1.14|868819|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP018090 (Xanthomonas oryzae pv. oryzae strain YN24 plasmid pXOOYN24, complete sequence) position: , mismatch: 0, identity: 1.0

gcggccttttcagcgatgcagaaacgcagatggt	CRISPR spacer
gcggccttttcagcgatgcagaaacgcagatggt	Protospacer
**********************************

83. spacer 1.15|868884|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP018090 (Xanthomonas oryzae pv. oryzae strain YN24 plasmid pXOOYN24, complete sequence) position: , mismatch: 0, identity: 1.0

gcaaccttaagatcaccctccacgctccgtata	CRISPR spacer
gcaaccttaagatcaccctccacgctccgtata	Protospacer
*********************************

84. spacer 1.18|869079|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AF162859 (Xanthomonas oryzae phage phiXo adsorption protein pIII (gIII) gene, complete cds) position: , mismatch: 0, identity: 1.0

cagcacagccgacaacgcctgttccagcaccatcac	CRISPR spacer
cagcacagccgacaacgcctgttccagcaccatcac	Protospacer
************************************

85. spacer 1.19|869146|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019227 (Xanthomonas oryzae pv. oryzae strain IX-280 plasmid pXOO43, complete sequence) position: , mismatch: 0, identity: 1.0

ttgcttgctgatctgcgcatgcgcgctcatgaaat	CRISPR spacer
ttgcttgctgatctgcgcatgcgcgctcatgaaat	Protospacer
***********************************

86. spacer 1.23|869410|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AF162859 (Xanthomonas oryzae phage phiXo adsorption protein pIII (gIII) gene, complete cds) position: , mismatch: 0, identity: 1.0

tggtgaaattgtagaagcatccatcgtcacaacta	CRISPR spacer
tggtgaaattgtagaagcatccatcgtcacaacta	Protospacer
***********************************

87. spacer 1.24|869476|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP020973 (Xanthomonas axonopodis pv. phaseoli strain CFBP6546R plasmid pC, complete sequence) position: , mismatch: 0, identity: 1.0

ggctacagcgccttcgtagaggctggccaacgtcgg	CRISPR spacer
ggctacagcgccttcgtagaggctggccaacgtcgg	Protospacer
************************************

88. spacer 1.24|869476|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020969 (Xanthomonas phaseoli pv. phaseoli strain CFBP6164 plasmid pC, complete sequence) position: , mismatch: 0, identity: 1.0

ggctacagcgccttcgtagaggctggccaacgtcgg	CRISPR spacer
ggctacagcgccttcgtagaggctggccaacgtcgg	Protospacer
************************************

89. spacer 1.24|869476|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021020 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pC, complete sequence) position: , mismatch: 0, identity: 1.0

ggctacagcgccttcgtagaggctggccaacgtcgg	CRISPR spacer
ggctacagcgccttcgtagaggctggccaacgtcgg	Protospacer
************************************

90. spacer 1.24|869476|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012062 (Xanthomonas sp. ISO98C4 plasmid pNX47, complete sequence) position: , mismatch: 0, identity: 1.0

ggctacagcgccttcgtagaggctggccaacgtcgg	CRISPR spacer
ggctacagcgccttcgtagaggctggccaacgtcgg	Protospacer
************************************

91. spacer 1.24|869476|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020977 (Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pC) position: , mismatch: 0, identity: 1.0

ggctacagcgccttcgtagaggctggccaacgtcgg	CRISPR spacer
ggctacagcgccttcgtagaggctggccaacgtcgg	Protospacer
************************************

92. spacer 1.24|869476|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020977 (Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pC) position: , mismatch: 0, identity: 1.0

ggctacagcgccttcgtagaggctggccaacgtcgg	CRISPR spacer
ggctacagcgccttcgtagaggctggccaacgtcgg	Protospacer
************************************

93. spacer 1.24|869476|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012056 (Xanthomonas citri pv. fuscans strain ISO12C3 plasmid pXff45, complete sequence) position: , mismatch: 0, identity: 1.0

ggctacagcgccttcgtagaggctggccaacgtcgg	CRISPR spacer
ggctacagcgccttcgtagaggctggccaacgtcgg	Protospacer
************************************

94. spacer 1.24|869476|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012054 (Xanthomonas citri pv. fuscans strain ISO118C1 plasmid pXff45, complete sequence) position: , mismatch: 0, identity: 1.0

ggctacagcgccttcgtagaggctggccaacgtcgg	CRISPR spacer
ggctacagcgccttcgtagaggctggccaacgtcgg	Protospacer
************************************

95. spacer 1.24|869476|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012052 (Xanthomonas citri pv. fuscans strain ISO118C5 plasmid pXff45, complete sequence) position: , mismatch: 0, identity: 1.0

ggctacagcgccttcgtagaggctggccaacgtcgg	CRISPR spacer
ggctacagcgccttcgtagaggctggccaacgtcgg	Protospacer
************************************

96. spacer 1.24|869476|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012059 (Xanthomonas phaseoli pv. phaseoli strain ISO98C12 plasmid pXap47, complete sequence) position: , mismatch: 0, identity: 1.0

ggctacagcgccttcgtagaggctggccaacgtcgg	CRISPR spacer
ggctacagcgccttcgtagaggctggccaacgtcgg	Protospacer
************************************

97. spacer 1.24|869476|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012065 (Xanthomonas phaseoli pv. phaseoli strain ISO18C8 plasmid pXap48, complete sequence) position: , mismatch: 0, identity: 1.0

ggctacagcgccttcgtagaggctggccaacgtcgg	CRISPR spacer
ggctacagcgccttcgtagaggctggccaacgtcgg	Protospacer
************************************

98. spacer 1.24|869476|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012050 (Xanthomonas phaseoli pv. phaseoli strain ISO18C2 plasmid pXap48, complete sequence) position: , mismatch: 0, identity: 1.0

ggctacagcgccttcgtagaggctggccaacgtcgg	CRISPR spacer
ggctacagcgccttcgtagaggctggccaacgtcgg	Protospacer
************************************

99. spacer 1.25|869543|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP033195 (Xanthomonas oryzae pv. oryzae strain CIAT plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

agcgcccctacggataacgctccacacgcgctga	CRISPR spacer
agcgcccctacggataacgctccacacgcgctga	Protospacer
**********************************

100. spacer 1.25|869543|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP033202 (Xanthomonas oryzae pv. oryzae strain BXO1 plasmid pBXO1-1, complete sequence) position: , mismatch: 0, identity: 1.0

agcgcccctacggataacgctccacacgcgctga	CRISPR spacer
agcgcccctacggataacgctccacacgcgctga	Protospacer
**********************************

101. spacer 1.31|869937|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AF162859 (Xanthomonas oryzae phage phiXo adsorption protein pIII (gIII) gene, complete cds) position: , mismatch: 0, identity: 1.0

ggtcatcaccgtggccatcaccatcaccgggcgtg	CRISPR spacer
ggtcatcaccgtggccatcaccatcaccgggcgtg	Protospacer
***********************************

102. spacer 1.43|870721|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AF162859 (Xanthomonas oryzae phage phiXo adsorption protein pIII (gIII) gene, complete cds) position: , mismatch: 0, identity: 1.0

ccatcaccgggcgtggaaggtggcgcgtcaccaaca	CRISPR spacer
ccatcaccgggcgtggaaggtggcgcgtcaccaaca	Protospacer
************************************

103. spacer 1.67|872293|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_009543 (Xanthomonas phage Xop411, complete genome) position: , mismatch: 0, identity: 1.0

tattggcctgtccctggatcaatgcccgcaccgt	CRISPR spacer
tattggcctgtccctggatcaatgcccgcaccgt	Protospacer
**********************************

104. spacer 1.67|872293|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_004902 (Xanthomonas phage Xp10, complete genome) position: , mismatch: 0, identity: 1.0

tattggcctgtccctggatcaatgcccgcaccgt	CRISPR spacer
tattggcctgtccctggatcaatgcccgcaccgt	Protospacer
**********************************

105. spacer 1.67|872293|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AY299121 (Xanthomonas oryzae bacteriophage Xp10 genomic DNA, complete genome) position: , mismatch: 0, identity: 1.0

tattggcctgtccctggatcaatgcccgcaccgt	CRISPR spacer
tattggcctgtccctggatcaatgcccgcaccgt	Protospacer
**********************************

106. spacer 1.72|872617|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_009543 (Xanthomonas phage Xop411, complete genome) position: , mismatch: 0, identity: 1.0

gcattgttgtaggagacgccgtgggtgctgttggt	CRISPR spacer
gcattgttgtaggagacgccgtgggtgctgttggt	Protospacer
***********************************

107. spacer 1.72|872617|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AP008979 (Xanthomonas oryzae phage OP1 DNA, complete genome) position: , mismatch: 0, identity: 1.0

gcattgttgtaggagacgccgtgggtgctgttggt	CRISPR spacer
gcattgttgtaggagacgccgtgggtgctgttggt	Protospacer
***********************************

108. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018465 (Xanthomonas euvesicatoria strain LMG930 plasmid pLMG930.4, complete sequence) position: , mismatch: 1, identity: 0.972

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctatgt	Protospacer
*********************************.**

109. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011164 (Xanthomonas citri pv. aurantifolii strain FDC 1609 plasmid pXfc37, complete sequence) position: , mismatch: 1, identity: 0.972

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctatgt	Protospacer
*********************************.**

110. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021022 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pG, complete sequence) position: , mismatch: 1, identity: 0.972

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctatgt	Protospacer
*********************************.**

111. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020978 (Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pD) position: , mismatch: 1, identity: 0.972

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctatgt	Protospacer
*********************************.**

112. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011162 (Xanthomonas citri pv. aurantifolii strain FDC 1559 plasmid pXfc38, complete sequence) position: , mismatch: 1, identity: 0.972

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctatgt	Protospacer
*********************************.**

113. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_007506 (Xanthomonas campestris pv. vesicatoria str. 85-10 plasmid pXCV38, complete sequence) position: , mismatch: 1, identity: 0.972

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctatgt	Protospacer
*********************************.**

114. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011251 (Xanthomonas citri pv. aurantifolii strain FDC 1561 plasmid pXfb33, complete sequence) position: , mismatch: 1, identity: 0.972

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctatgt	Protospacer
*********************************.**

115. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017192 (Xanthomonas campestris pv. vesicatoria str. 85-10 plasmid p_XCV_2, complete sequence) position: , mismatch: 1, identity: 0.972

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctatgt	Protospacer
*********************************.**

116. spacer 1.6|868294|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020966 (Xanthomonas phaseoli pv. phaseoli strain CFBP412 plasmid pD, complete sequence) position: , mismatch: 1, identity: 0.972

gtggcgcgagcgctataacaagcgctcgttctacgt	CRISPR spacer
gtggcgcgagcgctataacaagcgctcgttctatgt	Protospacer
*********************************.**

117. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_005240 (Xanthomonas citri plasmid pXcB, complete sequence) position: , mismatch: 1, identity: 0.971

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccagaggaacgcgccttgaggtcgg	Protospacer
************.**********************

118. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011165 (Xanthomonas citri pv. aurantifolii strain FDC 1609 plasmid pXfc32, complete sequence) position: , mismatch: 1, identity: 0.971

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccagaggaacgcgccttgaggtcgg	Protospacer
************.**********************

119. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023157 (Xanthomonas citri pv. malvacearum strain AR81009 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.971

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccagaggaacgcgccttgaggtcgg	Protospacer
************.**********************

120. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020966 (Xanthomonas phaseoli pv. phaseoli strain CFBP412 plasmid pD, complete sequence) position: , mismatch: 1, identity: 0.971

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgagccggaggaacgcgccttgaggtcgg	Protospacer
*********.*************************

121. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KR071788 (Xanthomonas oryzae pv. oryzicola strain GX01 plasmid pXOCgx01, complete sequence) position: , mismatch: 1, identity: 0.971

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttgtatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
*** *******************************

122. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012003 (Xanthomonas citri pv. aurantifolii strain 1566 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.971

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccagaggaacgcgccttgaggtcgg	Protospacer
************.**********************

123. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020978 (Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pD) position: , mismatch: 1, identity: 0.971

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgagccggaggaacgcgccttgaggtcgg	Protospacer
*********.*************************

124. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011162 (Xanthomonas citri pv. aurantifolii strain FDC 1559 plasmid pXfc38, complete sequence) position: , mismatch: 1, identity: 0.971

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
ttggatcgaaccagaggaacgcgccttgaggtcgg	Protospacer
************.**********************

125. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP030179 (Xanthomonas citri pv. punicae strain LMG 859 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

126. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP030170 (Xanthomonas citri pv. punicae strain BD0025 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

127. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP030162 (Xanthomonas citri pv. punicae strain BD0023 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

128. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023287 (Xanthomonas citri pv. citri strain 03-1638-1-1 plasmid pP2, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

129. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP030160 (Xanthomonas citri pv. punicae strain BD0022 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

130. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP030165 (Xanthomonas citri pv. punicae strain LMG7439 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

131. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034651 (Xanthomonas vasicola strain NCPPB 1060 plasmid pXVH45, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

132. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018860 (Xanthomonas citri pv. citri strain LH201 plasmid pLH201.2, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

133. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018852 (Xanthomonas citri pv. citri strain LJ207-7 plasmid pLJ207-7.2, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

134. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018849 (Xanthomonas citri pv. citri strain LL074-4 plasmid pLL074-4.2, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

135. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018856 (Xanthomonas citri pv. citri strain LH276 plasmid pLH276.2, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

136. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024030 (Xanthomonas citri pv. citri strain Xcc49 plasmid pXAC64, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

137. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011963 (Xanthomonas oryzae pv. oryzicola strain CFBP2286 plasmid, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

138. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009012 (Xanthomonas citri pv. citri strain JX4 plasmid pXAC64, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

139. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP008997 (Xanthomonas citri pv. citri strain MN12 plasmid pXAC64, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

140. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013664 (Xanthomonas citri pv. citri strain jx-6 plasmid pXAC64, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

141. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009000 (Xanthomonas citri pv. citri strain MN11 plasmid pXAC64, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

142. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024033 (Xanthomonas citri pv. citri strain Xcc29-1 plasmid pXAC64, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

143. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP030167 (Xanthomonas citri pv. punicae strain LMG7504 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

144. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009015 (Xanthomonas citri pv. citri strain GD3 plasmid pXAC64, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

145. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP008994 (Xanthomonas citri pv. citri strain NT17 plasmid pXAC64, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

146. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009009 (Xanthomonas citri pv. citri strain JX5 plasmid pXAC64, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

147. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009003 (Xanthomonas citri pv. citri strain MN10 plasmid pXAC64, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

148. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009018 (Xanthomonas citri pv. citri strain GD2 plasmid pXAC64, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

149. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009021 (Xanthomonas citri pv. citri strain FB19 plasmid pXAC64, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

150. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP008988 (Xanthomonas citri pv. citri strain UI7 plasmid pXAC64, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

151. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_020797 (Xanthomonas axonopodis Xac29-1 plasmid pXAC64, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

152. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009006 (Xanthomonas citri pv. citri strain MF20 plasmid pXAC64, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

153. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP008991 (Xanthomonas citri subsp. citri UI6 plasmid pXAC64, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

154. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_003922 (Xanthomonas citri pv. citri str. 306 plasmid pXAC64, complete sequence) position: , mismatch: 1, identity: 0.971

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccaccggtcgcccagggcgagcggcttgaaggt	Protospacer
******************************** **

155. spacer 1.25|869543|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP020973 (Xanthomonas axonopodis pv. phaseoli strain CFBP6546R plasmid pC, complete sequence) position: , mismatch: 1, identity: 0.971

agcgcccctacggataacgctccacacgcgctga	CRISPR spacer
agcgcccctacggataacgctccacacgcgctgg	Protospacer
*********************************.

156. spacer 1.25|869543|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP020974 (Xanthomonas axonopodis pv. phaseoli strain CFBP6546R plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.971

agcgcccctacggataacgctccacacgcgctga	CRISPR spacer
agcgcccctacggataacgctccacacgcgctgg	Protospacer
*********************************.

157. spacer 1.25|869543|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031608 (Xanthomonas hortorum strain VT106 plasmid pVT106, complete sequence) position: , mismatch: 1, identity: 0.971

agcgcccctacggataacgctccacacgcgctga	CRISPR spacer
agcgcccctacggataacgctccacacgcgctgg	Protospacer
*********************************.

158. spacer 1.25|869543|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP016879 (Xanthomonas hortorum strain B07-007 plasmid pB07007, complete sequence) position: , mismatch: 1, identity: 0.971

agcgcccctacggataacgctccacacgcgctga	CRISPR spacer
agcgcccctacggataacgctccacacgcgctgg	Protospacer
*********************************.

159. spacer 1.25|869543|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020969 (Xanthomonas phaseoli pv. phaseoli strain CFBP6164 plasmid pC, complete sequence) position: , mismatch: 1, identity: 0.971

agcgcccctacggataacgctccacacgcgctga	CRISPR spacer
agcgcccctacggataacgctccacacgcgctgg	Protospacer
*********************************.

160. spacer 1.25|869543|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012062 (Xanthomonas sp. ISO98C4 plasmid pNX47, complete sequence) position: , mismatch: 1, identity: 0.971

agcgcccctacggataacgctccacacgcgctga	CRISPR spacer
agcgcccctacggataacgctccacacgcgctgg	Protospacer
*********************************.

161. spacer 1.25|869543|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020977 (Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pC) position: , mismatch: 1, identity: 0.971

agcgcccctacggataacgctccacacgcgctga	CRISPR spacer
agcgcccctacggataacgctccacacgcgctgg	Protospacer
*********************************.

162. spacer 1.25|869543|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020977 (Xanthomonas phaseoli pv. phaseoli strain CFBP6982 plasmid pC) position: , mismatch: 1, identity: 0.971

agcgcccctacggataacgctccacacgcgctga	CRISPR spacer
agcgcccctacggataacgctccacacgcgctgg	Protospacer
*********************************.

163. spacer 1.25|869543|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012059 (Xanthomonas phaseoli pv. phaseoli strain ISO98C12 plasmid pXap47, complete sequence) position: , mismatch: 1, identity: 0.971

agcgcccctacggataacgctccacacgcgctga	CRISPR spacer
agcgcccctacggataacgctccacacgcgctgg	Protospacer
*********************************.

164. spacer 1.25|869543|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012065 (Xanthomonas phaseoli pv. phaseoli strain ISO18C8 plasmid pXap48, complete sequence) position: , mismatch: 1, identity: 0.971

agcgcccctacggataacgctccacacgcgctga	CRISPR spacer
agcgcccctacggataacgctccacacgcgctgg	Protospacer
*********************************.

165. spacer 1.25|869543|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012050 (Xanthomonas phaseoli pv. phaseoli strain ISO18C2 plasmid pXap48, complete sequence) position: , mismatch: 1, identity: 0.971

agcgcccctacggataacgctccacacgcgctga	CRISPR spacer
agcgcccctacggataacgctccacacgcgctgg	Protospacer
*********************************.

166. spacer 1.25|869543|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018733 (Xanthomonas gardneri strain ICMP 7383 plasmid pICMP7383.2, complete sequence) position: , mismatch: 1, identity: 0.971

agcgcccctacggataacgctccacacgcgctga	CRISPR spacer
agcgcccctacggataacgctccacacgcgctgg	Protospacer
*********************************.

167. spacer 1.44|870788|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_004902 (Xanthomonas phage Xp10, complete genome) position: , mismatch: 1, identity: 0.972

actgctgtgcccaatcatgctcggcgggacgccgaa	CRISPR spacer
actgctgtgcccaatcatgctcggcggcacgccgaa	Protospacer
*************************** ********

168. spacer 1.44|870788|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AY299121 (Xanthomonas oryzae bacteriophage Xp10 genomic DNA, complete genome) position: , mismatch: 1, identity: 0.972

actgctgtgcccaatcatgctcggcgggacgccgaa	CRISPR spacer
actgctgtgcccaatcatgctcggcggcacgccgaa	Protospacer
*************************** ********

169. spacer 1.48|871051|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AP008979 (Xanthomonas oryzae phage OP1 DNA, complete genome) position: , mismatch: 1, identity: 0.971

ccttctgacattcccgccacagcgccttgcccgc	CRISPR spacer
ccttctgacattcccgccagagcgccttgcccgc	Protospacer
******************* **************

170. spacer 1.57|871642|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AP008979 (Xanthomonas oryzae phage OP1 DNA, complete genome) position: , mismatch: 1, identity: 0.971

gtgtgattatggaagagccacggaggataagcac	CRISPR spacer
gtgtaattatggaagagccacggaggataagcac	Protospacer
****.*****************************

171. spacer 1.58|871707|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AP008979 (Xanthomonas oryzae phage OP1 DNA, complete genome) position: , mismatch: 1, identity: 0.972

gggctcagggatcaacccacagggctcggacttgca	CRISPR spacer
gggctcagggatcaaccctcagggctcggacttgca	Protospacer
****************** *****************

172. spacer 1.65|872165|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_004902 (Xanthomonas phage Xp10, complete genome) position: , mismatch: 1, identity: 0.97

gctagcctattggcaagcacgctcgcagacact	CRISPR spacer
gctggcctattggcaagcacgctcgcagacact	Protospacer
***.*****************************

173. spacer 1.65|872165|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AY299121 (Xanthomonas oryzae bacteriophage Xp10 genomic DNA, complete genome) position: , mismatch: 1, identity: 0.97

gctagcctattggcaagcacgctcgcagacact	CRISPR spacer
gctggcctattggcaagcacgctcgcagacact	Protospacer
***.*****************************

174. spacer 1.66|872229|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AP008979 (Xanthomonas oryzae phage OP1 DNA, complete genome) position: , mismatch: 1, identity: 0.97

acatgcacccgccttggccgtcttgctgtcctt	CRISPR spacer
acatgcaccagccttggccgtcttgctgtcctt	Protospacer
********* ***********************

175. spacer 1.66|872229|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_004902 (Xanthomonas phage Xp10, complete genome) position: , mismatch: 1, identity: 0.97

acatgcacccgccttggccgtcttgctgtcctt	CRISPR spacer
acatgcacccgccttggctgtcttgctgtcctt	Protospacer
******************.**************

176. spacer 1.66|872229|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AY299121 (Xanthomonas oryzae bacteriophage Xp10 genomic DNA, complete genome) position: , mismatch: 1, identity: 0.97

acatgcacccgccttggccgtcttgctgtcctt	CRISPR spacer
acatgcacccgccttggctgtcttgctgtcctt	Protospacer
******************.**************

177. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP030179 (Xanthomonas citri pv. punicae strain LMG 859 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.939

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcgcgggccgtggatacgttactccccat	Protospacer
******.******************** *****

178. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP030170 (Xanthomonas citri pv. punicae strain BD0025 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.939

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcgcgggccgtggatacgttactccccat	Protospacer
******.******************** *****

179. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP030162 (Xanthomonas citri pv. punicae strain BD0023 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.939

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcgcgggccgtggatacgttactccccat	Protospacer
******.******************** *****

180. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP030160 (Xanthomonas citri pv. punicae strain BD0022 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.939

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcgcgggccgtggatacgttactccccat	Protospacer
******.******************** *****

181. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP030165 (Xanthomonas citri pv. punicae strain LMG7439 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.939

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcgcgggccgtggatacgttactccccat	Protospacer
******.******************** *****

182. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034651 (Xanthomonas vasicola strain NCPPB 1060 plasmid pXVH45, complete sequence) position: , mismatch: 2, identity: 0.939

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcgcgggccgtggatacgttactccccat	Protospacer
******.******************** *****

183. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012003 (Xanthomonas citri pv. aurantifolii strain 1566 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.939

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcgcgggccgtggatacgttactccccat	Protospacer
******.******************** *****

184. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_005240 (Xanthomonas citri plasmid pXcB, complete sequence) position: , mismatch: 2, identity: 0.939

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcgcgggccgtggatacgttactccccat	Protospacer
******.******************** *****

185. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022266 (Xanthomonas citri pv. vignicola strain CFBP7111 plasmid plB, complete sequence) position: , mismatch: 2, identity: 0.939

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcgcgggccgtggatacgttactccccat	Protospacer
******.******************** *****

186. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011165 (Xanthomonas citri pv. aurantifolii strain FDC 1609 plasmid pXfc32, complete sequence) position: , mismatch: 2, identity: 0.939

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcgcgggccgtggatacgttactccccat	Protospacer
******.******************** *****

187. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP022269 (Xanthomonas citri pv. vignicola strain CFBP7112 plasmid plB, complete sequence) position: , mismatch: 2, identity: 0.939

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcacgggccgtcgatacgttactccccat	Protospacer
*************** *********** *****

188. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP022269 (Xanthomonas citri pv. vignicola strain CFBP7112 plasmid plB, complete sequence) position: , mismatch: 2, identity: 0.939

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcacgggccgtcgatacgttactccccat	Protospacer
*************** *********** *****

189. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP030167 (Xanthomonas citri pv. punicae strain LMG7504 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.939

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcgcgggccgtggatacgttactccccat	Protospacer
******.******************** *****

190. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP030168 (Xanthomonas citri pv. punicae strain LMG7504 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.939

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcgcgggccgtggatacgttactccccat	Protospacer
******.******************** *****

191. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023156 (Xanthomonas citri pv. malvacearum strain AR81009 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.939

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcgcgggccgtggatacgttactccccat	Protospacer
******.******************** *****

192. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011161 (Xanthomonas citri pv. aurantifolii strain FDC 1559 plasmid pXfc43, complete sequence) position: , mismatch: 2, identity: 0.939

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcgcgggccgtggatacgttactccccat	Protospacer
******.******************** *****

193. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013005 (Xanthomonas citri pv. malvacearum strain XcmH1005 plasmid pXcmH, complete sequence) position: , mismatch: 2, identity: 0.939

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcgcgggccgtggatacgttactccccat	Protospacer
******.******************** *****

194. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013007 (Xanthomonas citri pv. malvacearum strain XcmN1003 plasmid pXcmN, complete sequence) position: , mismatch: 2, identity: 0.939

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcacgggccgtcgatacgttactccccat	Protospacer
*************** *********** *****

195. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP046021 (Xanthomonas citri pv. malvacearum strain HD-1 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.939

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcgcgggccgtggatacgttactccccat	Protospacer
******.******************** *****

196. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011251 (Xanthomonas citri pv. aurantifolii strain FDC 1561 plasmid pXfb33, complete sequence) position: , mismatch: 2, identity: 0.939

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
cgcttcgcgggccgtggatacgttactccccat	Protospacer
******.******************** *****

197. spacer 1.8|868425|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP030165 (Xanthomonas citri pv. punicae strain LMG7439 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.943

ttggatcgaaccggaggaacgcgccttgaggtcgg	CRISPR spacer
attgatcgaaccggaggaacgcgccttgaggtcgg	Protospacer
 * ********************************

198. spacer 1.27|869673|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to MH218848 (Xanthomonas phage phiLf2, complete genome) position: , mismatch: 2, identity: 0.943

gccactgcgtggccctggaccgcgcctattcgtga	CRISPR spacer
gccaccgcgtggccctggaccgcgcccattcgtga	Protospacer
*****.********************.********

199. spacer 1.27|869673|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AF018286 (Xanthomonas campestris phage phi-Lf protein VI (VI) and protein I (I) genes, complete cds) position: , mismatch: 2, identity: 0.943

gccactgcgtggccctggaccgcgcctattcgtga	CRISPR spacer
gccaccgcgtggccctggaccgcgcccattcgtga	Protospacer
*****.********************.********

200. spacer 1.27|869673|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to MH206184 (Xanthomonas phage phiLf UK variant, complete genome) position: , mismatch: 2, identity: 0.943

gccactgcgtggccctggaccgcgcctattcgtga	CRISPR spacer
gccaccgcgtggccctggaccgcgcccattcgtga	Protospacer
*****.********************.********

201. spacer 1.27|869673|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to MN263053 (UNVERIFIED: Xanthomonas phage phiLF, complete genome) position: , mismatch: 2, identity: 0.943

gccactgcgtggccctggaccgcgcctattcgtga	CRISPR spacer
gccaccgcgtggccctggaccgcgcccattcgtga	Protospacer
*****.********************.********

202. spacer 1.34|870134|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_009543 (Xanthomonas phage Xop411, complete genome) position: , mismatch: 2, identity: 0.941

agtgggatacccttgcgctcggcactgtccgtgg	CRISPR spacer
agtgggatacccttacgctccgcactgtccgtgg	Protospacer
**************.***** *************

203. spacer 1.41|870589|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP033195 (Xanthomonas oryzae pv. oryzae strain CIAT plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.944

cctgctcgatcgtccagttatcgctataagaccccg	CRISPR spacer
cctgctcgatcgtccagttgtcgctgtaagaccccg	Protospacer
*******************.*****.**********

204. spacer 1.41|870589|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019227 (Xanthomonas oryzae pv. oryzae strain IX-280 plasmid pXOO43, complete sequence) position: , mismatch: 2, identity: 0.944

cctgctcgatcgtccagttatcgctataagaccccg	CRISPR spacer
cctgctcgatcgtccagttgtcgctgtaagaccccg	Protospacer
*******************.*****.**********

205. spacer 1.41|870589|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP033202 (Xanthomonas oryzae pv. oryzae strain BXO1 plasmid pBXO1-1, complete sequence) position: , mismatch: 2, identity: 0.944

cctgctcgatcgtccagttatcgctataagaccccg	CRISPR spacer
cctgctcgatcgtccagttgtcgctgtaagaccccg	Protospacer
*******************.*****.**********

206. spacer 1.44|870788|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_009543 (Xanthomonas phage Xop411, complete genome) position: , mismatch: 2, identity: 0.944

actgctgtgcccaatcatgctcggcgggacgccgaa	CRISPR spacer
actgctgtgcccaatcatgctcggcggcacgccaaa	Protospacer
*************************** *****.**

207. spacer 1.47|870986|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AP008979 (Xanthomonas oryzae phage OP1 DNA, complete genome) position: , mismatch: 2, identity: 0.941

atgaggggtattgcaaagctaagggctgcaaggt	CRISPR spacer
acgatgggtattgcaaagctaagggctgcaaggt	Protospacer
*.** *****************************

208. spacer 1.57|871642|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_009543 (Xanthomonas phage Xop411, complete genome) position: , mismatch: 2, identity: 0.941

gtgtgattatggaagagccacggaggataagcac	CRISPR spacer
gtgtgattatggaagagccgcggaggataagcgc	Protospacer
*******************.************.*

209. spacer 1.57|871642|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_004902 (Xanthomonas phage Xp10, complete genome) position: , mismatch: 2, identity: 0.941

gtgtgattatggaagagccacggaggataagcac	CRISPR spacer
gtgtgattatggaagagccgcggaggataagcgc	Protospacer
*******************.************.*

210. spacer 1.57|871642|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AY299121 (Xanthomonas oryzae bacteriophage Xp10 genomic DNA, complete genome) position: , mismatch: 2, identity: 0.941

gtgtgattatggaagagccacggaggataagcac	CRISPR spacer
gtgtgattatggaagagccgcggaggataagcgc	Protospacer
*******************.************.*

211. spacer 1.59|871774|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to DQ408365 (Xanthomonas oryzae phage Xo411 hypothetical proteins and lysozyme (lys411) genes, complete cds) position: , mismatch: 2, identity: 0.939

tccccagtacctttcgtgttcacgctcaaaacc	CRISPR spacer
gccccagtacctttcgtgttcacgctcgaaacc	Protospacer
 **************************.*****

212. spacer 1.59|871774|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_009543 (Xanthomonas phage Xop411, complete genome) position: , mismatch: 2, identity: 0.939

tccccagtacctttcgtgttcacgctcaaaacc	CRISPR spacer
gccccagtacctttcgtgttcacgctcgaaacc	Protospacer
 **************************.*****

213. spacer 1.59|871774|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_004902 (Xanthomonas phage Xp10, complete genome) position: , mismatch: 2, identity: 0.939

tccccagtacctttcgtgttcacgctcaaaacc	CRISPR spacer
gccccagtacctttcgtgttcacgctcgaaacc	Protospacer
 **************************.*****

214. spacer 1.59|871774|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AY299121 (Xanthomonas oryzae bacteriophage Xp10 genomic DNA, complete genome) position: , mismatch: 2, identity: 0.939

tccccagtacctttcgtgttcacgctcaaaacc	CRISPR spacer
gccccagtacctttcgtgttcacgctcgaaacc	Protospacer
 **************************.*****

215. spacer 1.62|871969|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_004902 (Xanthomonas phage Xp10, complete genome) position: , mismatch: 2, identity: 0.941

cacccataccagtgtcatttttggggttggtata	CRISPR spacer
cacccataccagtgtcgtttttggggttggtgta	Protospacer
****************.**************.**

216. spacer 1.62|871969|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AY299121 (Xanthomonas oryzae bacteriophage Xp10 genomic DNA, complete genome) position: , mismatch: 2, identity: 0.941

cacccataccagtgtcatttttggggttggtata	CRISPR spacer
cacccataccagtgtcgtttttggggttggtgta	Protospacer
****************.**************.**

217. spacer 1.64|872100|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AP008979 (Xanthomonas oryzae phage OP1 DNA, complete genome) position: , mismatch: 2, identity: 0.941

agcggcacacctgaactctatgggtctttggaaa	CRISPR spacer
agcagcacacctgaattctatgggtctttggaaa	Protospacer
***.***********.******************

218. spacer 1.66|872229|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_009543 (Xanthomonas phage Xop411, complete genome) position: , mismatch: 2, identity: 0.939

acatgcacccgccttggccgtcttgctgtcctt	CRISPR spacer
acaggcacccgccttggctgtcttgctgtcctt	Protospacer
*** **************.**************

219. spacer 1.69|872422|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_009543 (Xanthomonas phage Xop411, complete genome) position: , mismatch: 2, identity: 0.941

accaacggatttcctgaagattgcagagtatcca	CRISPR spacer
gccaacggatttcctgaagattgcagactatcca	Protospacer
.************************** ******

220. spacer 2.3|4130467|25|NZ_CP013679|CRISPRCasFinder matches to NZ_CP049159 (Caballeronia sp. SBC1 plasmid pSBC1_3, complete sequence) position: , mismatch: 2, identity: 0.92

acggcggtcgtcacggcggtcgtca	CRISPR spacer
acggcgatcgtcacgccggtcgtca	Protospacer
******.******** *********

221. spacer 2.3|4130467|25|NZ_CP013679|CRISPRCasFinder matches to NZ_CP049320 (Caballeronia sp. SBC2 plasmid pSBC2-4, complete sequence) position: , mismatch: 2, identity: 0.92

acggcggtcgtcacggcggtcgtca	CRISPR spacer
acggcgatcgtcacgccggtcgtca	Protospacer
******.******** *********

222. spacer 2.3|4130467|25|NZ_CP013679|CRISPRCasFinder matches to NZ_AP022334 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49b, complete sequence) position: , mismatch: 2, identity: 0.92

acggcggtcgtcacggcggtcgtca	CRISPR spacer
atggcggtcgtcgcggcggtcgtca	Protospacer
*.**********.************

223. spacer 1.37|870328|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AP008979 (Xanthomonas oryzae phage OP1 DNA, complete genome) position: , mismatch: 3, identity: 0.914

ttccgcgctggtcctatgccaacaagatcaagctt	CRISPR spacer
tcccacgttggtcctatgccaacaagatcaagctt	Protospacer
*.**.**.***************************

224. spacer 1.63|872034|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to MH218848 (Xanthomonas phage phiLf2, complete genome) position: , mismatch: 3, identity: 0.914

tgccataggtgacgacgctgacgctgtaaccaagg	CRISPR spacer
cgccatacgtgacgacgctgacgctgtaacccagg	Protospacer
.****** *********************** ***

225. spacer 1.63|872034|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AF018286 (Xanthomonas campestris phage phi-Lf protein VI (VI) and protein I (I) genes, complete cds) position: , mismatch: 3, identity: 0.914

tgccataggtgacgacgctgacgctgtaaccaagg	CRISPR spacer
cgccatacgtgacgacgctgacgctgtaacccagg	Protospacer
.****** *********************** ***

226. spacer 1.63|872034|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to MH206184 (Xanthomonas phage phiLf UK variant, complete genome) position: , mismatch: 3, identity: 0.914

tgccataggtgacgacgctgacgctgtaaccaagg	CRISPR spacer
cgccatacgtgacgacgctgacgctgtaacccagg	Protospacer
.****** *********************** ***

227. spacer 1.63|872034|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to MN263053 (UNVERIFIED: Xanthomonas phage phiLF, complete genome) position: , mismatch: 3, identity: 0.914

tgccataggtgacgacgctgacgctgtaaccaagg	CRISPR spacer
cgccatacgtgacgacgctgacgctgtaacccagg	Protospacer
.****** *********************** ***

228. spacer 1.69|872422|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_004902 (Xanthomonas phage Xp10, complete genome) position: , mismatch: 3, identity: 0.912

accaacggatttcctgaagattgcagagtatcca	CRISPR spacer
gccaacggatttcctcaagattgcagattatcca	Protospacer
.************** *********** ******

229. spacer 1.69|872422|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AY299121 (Xanthomonas oryzae bacteriophage Xp10 genomic DNA, complete genome) position: , mismatch: 3, identity: 0.912

accaacggatttcctgaagattgcagagtatcca	CRISPR spacer
gccaacggatttcctcaagattgcagattatcca	Protospacer
.************** *********** ******

230. spacer 2.3|4130467|25|NZ_CP013679|CRISPRCasFinder matches to KX752698 (Mycobacterium phage Tonenili, complete genome) position: , mismatch: 3, identity: 0.88

acggcggtcgtcacggcggtcgtca	CRISPR spacer
tcggcggtcatctcggcggtcgtca	Protospacer
 ********.** ************

231. spacer 2.3|4130467|25|NZ_CP013679|CRISPRCasFinder matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 3, identity: 0.88

acggcggtcgtcacggcggtcgtca	CRISPR spacer
acgccggtcgtcccggcggtcgtcc	Protospacer
*** ******** ***********

232. spacer 2.3|4130467|25|NZ_CP013679|CRISPRCasFinder matches to NZ_CP034351 (Streptomyces sp. W1SF4 plasmid p1, complete sequence) position: , mismatch: 3, identity: 0.88

acggcggtcgtcacggcggtcgtca	CRISPR spacer
ccggcggtcttcaccgcggtcgtca	Protospacer
 ******** **** **********

233. spacer 2.3|4130467|25|NZ_CP013679|CRISPRCasFinder matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 3, identity: 0.88

acggcggtcgtcacggcggtcgtca	CRISPR spacer
acgccggtcgtcccggcggtcgtcc	Protospacer
*** ******** ***********

234. spacer 2.3|4130467|25|NZ_CP013679|CRISPRCasFinder matches to NC_047977 (Microbacterium phage Hendrix, complete genome) position: , mismatch: 3, identity: 0.88

acggcggtcgtcacggcggtcgtca	CRISPR spacer
acggcgggcgtcacgacggtcgtcg	Protospacer
******* *******.********.

235. spacer 2.3|4130467|25|NZ_CP013679|CRISPRCasFinder matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 3, identity: 0.88

acggcggtcgtcacggcggtcgtca	CRISPR spacer
agggcgttcgtcacggcgttcgtca	Protospacer
* **** *********** ******

236. spacer 1.16|868948|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to MG944235 (Xanthomonas phage XPV2, complete genome) position: , mismatch: 4, identity: 0.882

cgttaatcgccgaccaggtgatcacgccgcgaaa	CRISPR spacer
cgttaatcgccgaccaggtaatgacgccgcagaa	Protospacer
*******************.** *******..**

237. spacer 2.3|4130467|25|NZ_CP013679|CRISPRCasFinder matches to NZ_CP050081 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence) position: , mismatch: 4, identity: 0.84

acggcggtcgtcacggcggtcgtca	CRISPR spacer
ctggcggtcgtcacggccgtcgtcg	Protospacer
 .*************** ******.

238. spacer 2.3|4130467|25|NZ_CP013679|CRISPRCasFinder matches to NZ_CP053206 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence) position: , mismatch: 4, identity: 0.84

acggcggtcgtcacggcggtcgtca	CRISPR spacer
ctggcggtcgtcacggccgtcgtcg	Protospacer
 .*************** ******.

239. spacer 2.3|4130467|25|NZ_CP013679|CRISPRCasFinder matches to NZ_CP031166 (Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence) position: , mismatch: 4, identity: 0.84

acggcggtcgtcacggcggtcgtca	CRISPR spacer
gcgccggtcgtgacggcggtcgtcg	Protospacer
.** ******* ************.

240. spacer 2.3|4130467|25|NZ_CP013679|CRISPRCasFinder matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

acggcggtcgtcacggcggtcgtca	CRISPR spacer
ccggcggtcgtcacggcggtgctct	Protospacer
 *******************  **

241. spacer 2.3|4130467|25|NZ_CP013679|CRISPRCasFinder matches to NZ_CP014942 (Rhodococcus sp. BH4 plasmid, complete sequence) position: , mismatch: 4, identity: 0.84

acggcggtcgtcacggcggtcgtca	CRISPR spacer
tcggcggtcgtcgaggcggtcgtcg	Protospacer
 ***********. **********.

242. spacer 1.39|870459|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_004902 (Xanthomonas phage Xp10, complete genome) position: , mismatch: 5, identity: 0.853

atacggcgcagccagggcgacagagtcatagtca	CRISPR spacer
atgcggcgcagccagggcgacaaagtcatcgaga	Protospacer
**.*******************.****** *  *

243. spacer 1.39|870459|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AY299121 (Xanthomonas oryzae bacteriophage Xp10 genomic DNA, complete genome) position: , mismatch: 5, identity: 0.853

atacggcgcagccagggcgacagagtcatagtca	CRISPR spacer
atgcggcgcagccagggcgacaaagtcatcgaga	Protospacer
**.*******************.****** *  *

244. spacer 1.43|870721|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AF069776 (Xanthomonas phage phi-Xv adsorption protein (gIII) gene, complete cds) position: , mismatch: 5, identity: 0.861

ccatcaccgggcgtggaaggtggcgcgtcaccaaca	CRISPR spacer
tcatcaccaggcgtggaaggtggcgcatcacccgca	Protospacer
.*******.*****************.***** .**

245. spacer 1.43|870721|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to MH206183 (Xanthomonas phage phiXv2, complete genome) position: , mismatch: 5, identity: 0.861

ccatcaccgggcgtggaaggtggcgcgtcaccaaca	CRISPR spacer
tcatcaccaggcgtggaaggtggcgcatcacccgca	Protospacer
.*******.*****************.***** .**

246. spacer 2.3|4130467|25|NZ_CP013679|CRISPRCasFinder matches to NZ_CP032686 (Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence) position: , mismatch: 5, identity: 0.8

acggcggtcgtcacggcggtcgtca	CRISPR spacer
cactcgatcgtcacggcggtcgtca	Protospacer
    **.******************

247. spacer 2.3|4130467|25|NZ_CP013679|CRISPRCasFinder matches to NZ_CP032691 (Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence) position: , mismatch: 5, identity: 0.8

acggcggtcgtcacggcggtcgtca	CRISPR spacer
cactcgatcgtcacggcggtcgtca	Protospacer
    **.******************

248. spacer 2.3|4130467|25|NZ_CP013679|CRISPRCasFinder matches to NZ_CP030830 (Neorhizobium sp. NCHU2750 plasmid pNCHU2750c, complete sequence) position: , mismatch: 5, identity: 0.8

acggcggtcgtcacggcggtcgtca	CRISPR spacer
gctatggtcgtcacggcggtcgtct	Protospacer
.* ..*******************

249. spacer 1.12|868687|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_011892 (Methylobacterium nodulans ORS 2060 plasmid pMNOD01, complete sequence) position: , mismatch: 7, identity: 0.8

atgagcatccaggtcgtcccgctcgccccgcgccc	CRISPR spacer
gtcagcatcgaggtcgtcccggtcgccccgcaggc	Protospacer
.* ****** *********** *********.  *

250. spacer 1.25|869543|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_010509 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD02, complete sequence) position: , mismatch: 7, identity: 0.794

agcgcccctacggataacgctccacacgcgctga	CRISPR spacer
ggaacccctacgaataacgctccacccgcgccgg	Protospacer
.* .********.************ *****.*.

251. spacer 1.29|869805|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP054620 (Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.794

tgcaaccgaacgccatcaccctgtcgaacgatgt	CRISPR spacer
tgaacggcaacggcatcacgctgtcgaacgatgt	Protospacer
** *    **** ****** **************

252. spacer 1.30|869870|36|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to KT803877 (Burkholderia phage PE067, complete genome) position: , mismatch: 7, identity: 0.806

ctacggggactacagcgccaacggcat---gagcaaggc	CRISPR spacer
gtacggcgactacagcggcaacggcatgtcgagcca---	Protospacer
 ***** ********** *********   **** *

253. spacer 1.35|870199|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to MG592561 (Vibrio phage 1.191.O._10N.286.52.B4, partial genome) position: , mismatch: 7, identity: 0.788

aggatctggagctgatggatcaa--ccaatgtgac	CRISPR spacer
aggagctggagccgatggatcaacgccaccctg--	Protospacer
**** *******.**********  *** . **

254. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_042355 (Corynebacterium phage phi674, complete genome) position: , mismatch: 8, identity: 0.758

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
agatcacccggccgtggatacgtttctccccat	Protospacer
 * *.  * *************** ** *****

255. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to MG324354 (Corynebacterium phage phi674) position: , mismatch: 8, identity: 0.758

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
agatcacccggccgtggatacgtttctccccat	Protospacer
 * *.  * *************** ** *****

256. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to MG324353 (Corynebacterium phage phi673) position: , mismatch: 8, identity: 0.758

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
agatcacccggccgtggatacgtttctccccat	Protospacer
 * *.  * *************** ** *****

257. spacer 1.7|868361|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_042354 (Corynebacterium phage phi673, complete genome) position: , mismatch: 8, identity: 0.758

cgcttcacgggccgtggatacgttactacccat	CRISPR spacer
agatcacccggccgtggatacgtttctccccat	Protospacer
 * *.  * *************** ** *****

258. spacer 1.10|868557|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP050090 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b4, complete sequence) position: , mismatch: 8, identity: 0.765

gcggtcgtttcgcctgcgactcgacgtgggccac	CRISPR spacer
gcggtcgtttcgcctgctgctcgacaattgccgg	Protospacer
***************** .******.   ***.

259. spacer 1.11|868622|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.765

cagcagcgtgcccgcgccgttccgcgtatagaac	CRISPR spacer
gcgcagcgtgcccccgccgatccgcgtcccgaag	Protospacer
  *********** ***** ******* . ***

260. spacer 1.11|868622|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 8, identity: 0.765

cagcagcgtgcccgcgccgttccgcgtatagaac	CRISPR spacer
gcgcagcgtgcccccgccgatccgcgtcccgaag	Protospacer
  *********** ***** ******* . ***

261. spacer 1.25|869543|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to MH218848 (Xanthomonas phage phiLf2, complete genome) position: , mismatch: 8, identity: 0.765

agcgcccctacggataacgctccacacgcgctga	CRISPR spacer
atagcccctacggataacgcctcacacgcggcct	Protospacer
*  *****************..******** .

262. spacer 1.25|869543|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to MH206184 (Xanthomonas phage phiLf UK variant, complete genome) position: , mismatch: 8, identity: 0.765

agcgcccctacggataacgctccacacgcgctga	CRISPR spacer
atagcccctacggataacgcctcacacgcggcct	Protospacer
*  *****************..******** .

263. spacer 1.40|870524|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to CP040467 (Streptomyces albidoflavus strain UYFA156 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.765

ccgtcgcggtcggtgatacgcacgcgccacaggt	CRISPR spacer
ccgtcgcggtcggtgacacggacgcggcgccctc	Protospacer
****************.*** ***** *.*   .

264. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP033583 (Streptomyces sp. ADI95-16 plasmid pADI95-16b, complete sequence) position: , mismatch: 9, identity: 0.743

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
tcccactggtcacccagggcgagcggttcaccccc	Protospacer
******.****.**************.*..  * .

265. spacer 1.12|868687|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023712 (Rhodococcus ruber strain YC-YT1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.743

atgagcatccaggtcgtcccgctcgccccgcgccc	CRISPR spacer
gacggcatccatgtcgtcacgctcgccccgaacct	Protospacer
.  .******* ****** *********** .**.

266. spacer 1.31|869937|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to AF069776 (Xanthomonas phage phi-Xv adsorption protein (gIII) gene, complete cds) position: , mismatch: 9, identity: 0.743

ggtcatcaccgtggccatcaccatcaccgggcgtg	CRISPR spacer
cgacatcaccgtcgccatcaccatcaccatcgccg	Protospacer
 * ********* ***************.    .*

267. spacer 1.31|869937|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to MH206183 (Xanthomonas phage phiXv2, complete genome) position: , mismatch: 9, identity: 0.743

ggtcatcaccgtggccatcaccatcaccgggcgtg	CRISPR spacer
cgccatcaccgtcgccatcaccatcaccatcgccg	Protospacer
 *.********* ***************.    .*

268. spacer 1.9|868491|35|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR134452 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence) position: , mismatch: 10, identity: 0.714

tcccaccggtcgcccagggcgagcggcttgaacgt	CRISPR spacer
gcgaggccctcgcccagggcgagcggcgcgaacga	Protospacer
 *  . *  ****************** .*****

269. spacer 1.16|868948|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028976 (Cronobacter sakazakii strain GZcsf-1 plasmid pGW2, complete sequence) position: , mismatch: 10, identity: 0.706

cgttaatcgccgaccaggtgatcacgccgcgaaa	CRISPR spacer
ccggcatcgccgcccaggtgataacgccgctcgc	Protospacer
*    ******* ********* *******  .

270. spacer 1.16|868948|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012258 (Cronobacter universalis NCTC 9529 plasmid pCUNV1, complete sequence) position: , mismatch: 10, identity: 0.706

cgttaatcgccgaccaggtgatcacgccgcgaaa	CRISPR spacer
ccggcatcgccgcccaggtgataacgccgctcgc	Protospacer
*    ******* ********* *******  .

271. spacer 1.16|868948|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 10, identity: 0.706

cgttaatcgccgaccaggtgatcacgccgcgaaa	CRISPR spacer
cactcatcgccgaccaggcgatcacgacgatcct	Protospacer
*..* *************.******* **

272. spacer 1.65|872165|33|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017244 (Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence) position: , mismatch: 10, identity: 0.697

gctagcctattggcaagcacgctcgcagacact	CRISPR spacer
cctagctcattggcaagcacgctcgttatgccg	Protospacer
 *****..*****************. .   *

273. spacer 1.69|872422|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP016619 (Microvirga ossetica strain V5/3m plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.706

accaacggatttcctgaagattgcagagtatcca	CRISPR spacer
tgtcacggaattcctcaagattgcagagatttcc	Protospacer
  . ***** ***** ************  *.*

274. spacer 2.1|4130365|34|NZ_CP013679|CRISPRCasFinder matches to NZ_CP049701 (Bradyrhizobium sp. 1S5 strain 323S2 plasmid pB323S2b, complete sequence) position: , mismatch: 10, identity: 0.706

gtaacgggcgtcgcgataaccatcacggtagccg	CRISPR spacer
agggttggtttcgcgatagccatcacggcagccg	Protospacer
. ... **. ********.*********.*****

275. spacer 1.47|870986|34|NZ_CP013679|CRISPRCasFinder,CRT,PILER-CR matches to MG945614 (UNVERIFIED: Microviridae sp. isolate 4943-1602, complete genome) position: , mismatch: 11, identity: 0.676

atgaggggtattgcaaagctaagggctgcaaggt	CRISPR spacer
cacacatatattgcagagctaacggctgcaagcc	Protospacer
   * . .*******.****** ********* .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

7736 : 59013

Ralstonia_phage(40.0%)

protease,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011407164.1\|7736_8573_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_011407165.1\|8759_9566_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_011257013.1\|9842_11036_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_011257015.1\|11944_12706_+	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
WP_010364790.1\|12752_13175_+	biopolymer transporter ExbD	NA	NA	NA	NA
WP_011257016.1\|13178_13592_+	biopolymer transporter ExbD	NA	NA	NA	NA
WP_011407166.1\|13887_14655_-	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
WP_019301610.1\|14665_14935_-	hypothetical protein	NA	NA	NA	NA
WP_011407167.1\|15009_16470_-	cardiolipin synthase	NA	NA	NA	NA
WP_011257020.1\|17116_18127_-	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	9.5e-49	37.8
WP_011257021.1\|18398_19601_-	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
WP_011407169.1\|19742_21881_+	TonB-dependent receptor	A0A1B0VCF0	Salmonella_phage	5.3e-65	40.9
WP_012443560.1\|22091_22385_+	hypothetical protein	NA	NA	NA	NA
WP_153296734.1\|22416_22914_-	hypothetical protein	NA	NA	NA	NA
WP_011257024.1\|23160_24141_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-88	55.8
WP_011257025.1\|24188_25355_-	FMN-dependent L-lactate dehydrogenase LldD	NA	NA	NA	NA
WP_069959658.1\|25501_26068_-	DUF1295 domain-containing protein	NA	NA	NA	NA
WP_069959660.1\|27542_28751_+	trans-2-enoyl-CoA reductase family protein	NA	NA	NA	NA
WP_011257029.1\|29378_30401_-	sugar kinase	NA	NA	NA	NA
WP_069970062.1\|31223_32192_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	7.3e-99	59.9
WP_125168733.1\|33020_33413_-	hypothetical protein	NA	NA	NA	NA
WP_103057298.1\|33638_34520_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.5e-05	22.6
WP_012443646.1\|35121_36498_-\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	4.1e-79	56.9
WP_012443643.1\|39510_39753_-	hypothetical protein	NA	NA	NA	NA
WP_012443642.1\|39694_40018_-	hypothetical protein	NA	NA	NA	NA
WP_011257128.1\|40483_41464_-\|transposase	IS5-like element ISXoo7 family transposase	A0A077K814	Ralstonia_phage	5.3e-89	55.9
WP_069959662.1\|42082_43372_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.0e-39	32.9
WP_011407185.1\|43811_44147_-	hypothetical protein	NA	NA	NA	NA
WP_011407187.1\|44421_44853_-	hypothetical protein	NA	NA	NA	NA
WP_155296471.1\|45014_45167_-	hypothetical protein	NA	NA	NA	NA
WP_024743401.1\|45201_46611_-	FAD-binding protein	NA	NA	NA	NA
WP_041181902.1\|46888_47104_+	hypothetical protein	NA	NA	NA	NA
WP_011257122.1\|47928_48189_-	hypothetical protein	NA	NA	NA	NA
WP_027704081.1\|48205_48538_-	hypothetical protein	NA	NA	NA	NA
WP_080256644.1\|48537_48996_-	hypothetical protein	NA	NA	NA	NA
WP_011258803.1\|49403_50372_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	1.5e-99	60.0
WP_133265185.1\|50571_51891_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_011407913.1\|51992_53207_-\|transposase	IS4-like element ISXo14 family transposase	A0A0F7LAS3	uncultured_marine_virus	1.8e-54	33.4
WP_094187731.1\|53727_54525_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_109182053.1\|56240_57206_+\|transposase	IS1595-like element ISXo5 family transposase	NA	NA	NA	NA
WP_125168734.1\|57202_57481_-	RHS repeat protein	NA	NA	NA	NA
WP_109182054.1\|57624_59013_+\|transposase	IS701 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

124477 : 171338

Ralstonia_phage(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069959667.1\|124477_125428_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	4.4e-96	61.6
WP_143699970.1\|125541_125751_-	hypothetical protein	NA	NA	NA	NA
WP_094187709.1\|125818_126091_-	hypothetical protein	NA	NA	NA	NA
WP_011257048.1\|126131_126413_-	hypothetical protein	NA	NA	NA	NA
WP_069959669.1\|126551_127610_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.9e-72	42.5
WP_011407232.1\|127750_128698_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.6e-44	35.7
WP_011407233.1\|128952_129264_-	hypothetical protein	NA	NA	NA	NA
WP_027704036.1\|130730_131201_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_011257042.1\|131370_132063_+	hypothetical protein	NA	NA	NA	NA
WP_011257041.1\|132154_132553_+	host attachment protein	NA	NA	NA	NA
WP_011407237.1\|133354_134311_+\|transposase	IS30-like element IS1112a family transposase	Q9MBM9	Staphylococcus_prophage	2.1e-42	35.2
WP_044756192.1\|134285_134756_-	hypothetical protein	NA	NA	NA	NA
WP_044756194.1\|134947_136201_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_011407239.1\|136546_137236_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-36	39.7
WP_011257145.1\|137248_138406_+	FtsX-like permease family protein	NA	NA	NA	NA
WP_011257146.1\|138418_139729_+	ABC transporter permease	NA	NA	NA	NA
WP_027703668.1\|141604_141856_-	type I toxin-antitoxin system SymE family toxin	NA	NA	NA	NA
WP_075239626.1\|142308_142710_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_011407243.1\|142733_142964_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_011407244.1\|143030_143693_-	hemolysin III	NA	NA	NA	NA
WP_094187820.1\|143957_146366_+	DEAD/DEAH box helicase	A0A1B1IUF6	uncultured_Mediterranean_phage	1.5e-07	36.0
WP_042464339.1\|146362_148189_+	ribonuclease H-like domain-containing protein	NA	NA	NA	NA
WP_011407248.1\|148677_150822_-	avirulence protein	NA	NA	NA	NA
WP_011407249.1\|151012_152170_-	ROK family protein	NA	NA	NA	NA
WP_042464342.1\|152342_154931_+	TonB-dependent receptor	NA	NA	NA	NA
WP_011257157.1\|154941_155727_+	DUF1868 domain-containing protein	NA	NA	NA	NA
WP_011407251.1\|156040_157180_-	saccharopine dehydrogenase	NA	NA	NA	NA
WP_011407253.1\|158330_158636_+	hypothetical protein	NA	NA	NA	NA
WP_042464345.1\|158860_160114_-	DNA topoisomerase IB	A0A0U2TSJ7	Niemeyer_virus	1.9e-38	35.2
WP_011257161.1\|160170_160551_+	hypothetical protein	NA	NA	NA	NA
WP_011257162.1\|160752_165225_+	glutamate synthase large subunit	NA	NA	NA	NA
WP_011257163.1\|165419_166901_+	NAD(P)-binding protein	NA	NA	NA	NA
WP_155296472.1\|168138_169104_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_094187801.1\|170539_171338_-\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

223021 : 367855

Bacillus_phage(18.75%)

tRNA,holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012443704.1\|223021_224926_-\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
WP_075239321.1\|225186_225366_-	hypothetical protein	NA	NA	NA	NA
WP_069970067.1\|225499_225967_-	hypothetical protein	NA	NA	NA	NA
WP_011257199.1\|226124_227084_+	pyridoxal-phosphate dependent enzyme	NA	NA	NA	NA
WP_044756223.1\|227068_227686_+	YdcF family protein	NA	NA	NA	NA
WP_011257200.1\|227728_228148_+	hypothetical protein	NA	NA	NA	NA
WP_012443706.1\|228400_229306_-	lipid A hydroxylase LpxO	S4VR59	Pandoravirus	2.6e-37	39.5
WP_011257202.1\|229554_230439_-	malonyl-ACP O-methyltransferase BioC	NA	NA	NA	NA
WP_011257203.1\|230502_231285_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_011407292.1\|231329_232091_-	pimeloyl-ACP methyl ester esterase BioH	NA	NA	NA	NA
WP_011257206.1\|232254_232584_-	hypothetical protein	NA	NA	NA	NA
WP_082323350.1\|232902_233994_+	DUF4380 domain-containing protein	NA	NA	NA	NA
WP_011407294.1\|234062_235661_+	glucan biosynthesis protein D	NA	NA	NA	NA
WP_011407295.1\|235825_237070_-	GAF domain-containing sensor histidine kinase	NA	NA	NA	NA
WP_011257210.1\|237521_238151_-	thymidine kinase	A0A023W530	Serratia_phage	3.3e-52	55.0
WP_011257211.1\|238357_240334_+	AAA family ATPase	A7KV33	Bacillus_phage	1.1e-112	37.2
WP_011407298.1\|241720_242386_-	DUF480 domain-containing protein	NA	NA	NA	NA
WP_011257214.1\|242672_243683_+	5'-nucleotidase, lipoprotein e(P4) family	NA	NA	NA	NA
WP_011257215.1\|243679_244411_+	orotidine-5'-phosphate decarboxylase	NA	NA	NA	NA
WP_011257216.1\|244764_246294_-	tryptophan 7-halogenase	M4T1E3	Cyanophage	1.0e-46	28.7
WP_011407300.1\|246403_249436_-	membrane protein	NA	NA	NA	NA
WP_011257218.1\|249734_252773_-	TonB-dependent receptor	NA	NA	NA	NA
WP_011257219.1\|252937_253990_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_075240491.1\|254158_254404_-	hypothetical protein	NA	NA	NA	NA
WP_011407301.1\|254402_255368_+	hypothetical protein	NA	NA	NA	NA
WP_011257221.1\|255367_258028_+	glycerol-3-phosphate 1-O-acyltransferase PlsB	NA	NA	NA	NA
WP_011257222.1\|259846_260065_-	YdcH family protein	NA	NA	NA	NA
WP_012446407.1\|262626_263112_+	rhamnogalacturonan acetylesterase	NA	NA	NA	NA
WP_109182060.1\|263143_263470_+	cupin domain-containing protein	NA	NA	NA	NA
WP_011257226.1\|263691_264336_-	DUF4375 domain-containing protein	NA	NA	NA	NA
WP_011257227.1\|264476_265367_-	phenylalanine 4-monooxygenase	NA	NA	NA	NA
WP_011407307.1\|265494_265977_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_011257232.1\|269012_269546_-	lipocalin family protein	NA	NA	NA	NA
WP_011407313.1\|272361_273420_-	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L339	Tupanvirus	3.0e-77	45.7
WP_011257237.1\|273727_274801_+	glycoside hydrolase family 5 protein	NA	NA	NA	NA
WP_011257238.1\|275563_276616_+	glycoside hydrolase family 5 protein	NA	NA	NA	NA
WP_011257239.1\|277263_278394_+	glycoside hydrolase family 5 protein	NA	NA	NA	NA
WP_011257241.1\|279717_280107_+	YchJ family protein	NA	NA	NA	NA
WP_011407316.1\|280314_280521_+	hypothetical protein	NA	NA	NA	NA
WP_011407671.1\|280752_281721_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	6.6e-100	60.3
WP_011257243.1\|281974_284137_+	lytic murein transglycosylase	NA	NA	NA	NA
WP_011407318.1\|284684_285989_+	tetracycline resistance MFS efflux pump	NA	NA	NA	NA
WP_011407319.1\|286048_286651_+	biliverdin-producing heme oxygenase	NA	NA	NA	NA
WP_011257245.1\|286647_288552_+	GAF domain-containing protein	Q6XLU9	Feldmannia_irregularis_virus	3.9e-19	27.7
WP_155296473.1\|295887_296996_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	6.3e-38	39.6
WP_155296474.1\|297429_297546_-	hypothetical protein	NA	NA	NA	NA
WP_011407325.1\|299230_300046_+	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	A0A127AWE5	Bacillus_phage	6.3e-19	27.3
WP_069970072.1\|300204_301161_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	4.8e-42	35.2
WP_094187715.1\|302541_303304_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011257253.1\|305102_306161_-	VacJ family lipoprotein	NA	NA	NA	NA
WP_069970073.1\|306171_306462_-	STAS domain-containing protein	NA	NA	NA	NA
WP_011257255.1\|306451_307114_-	organic solvent ABC transporter	NA	NA	NA	NA
WP_012446379.1\|307110_307662_-	outer membrane lipid asymmetry maintenance protein MlaD	NA	NA	NA	NA
WP_011257257.1\|307673_308423_-	ABC transporter permease	NA	NA	NA	NA
WP_011407332.1\|308422_309217_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	1.7e-08	27.8
WP_011257259.1\|309601_309889_+	hypothetical protein	NA	NA	NA	NA
WP_044757224.1\|309907_310465_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_115862304.1\|310482_311448_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_069959685.1\|312292_313249_+\|transposase	IS30-like element IS1112 family transposase	Q9MBM9	Staphylococcus_prophage	6.9e-41	35.0
WP_109182012.1\|313320_314083_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_109182062.1\|314122_314921_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011407338.1\|315052_316267_+\|transposase	IS4 family transposase	A0A0F7LAS3	uncultured_marine_virus	4.1e-54	33.4
WP_117231476.1\|316326_317157_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011257269.1\|317319_318555_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_011257271.1\|319952_320381_+	hypothetical protein	NA	NA	NA	NA
WP_082324389.1\|320400_320841_+	3-dehydroquinate dehydratase	NA	NA	NA	NA
WP_011407345.1\|320743_321049_+	hypothetical protein	NA	NA	NA	NA
WP_011407346.1\|321356_323111_-	PQQ-binding-like beta-propeller repeat protein	A0A0M4JT37	Mollivirus	7.3e-81	35.6
WP_109182012.1\|324081_324844_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_027703800.1\|324897_325482_-	gluconokinase	NA	NA	NA	NA
WP_011407349.1\|325639_327022_+	MFS transporter	NA	NA	NA	NA
WP_044757567.1\|327024_329424_+	NdvB protein	NA	NA	NA	NA
WP_011407351.1\|329527_332170_-	hypothetical protein	NA	NA	NA	NA
WP_011257279.1\|332917_336367_+	hybrid sensor histidine kinase/response regulator	NA	NA	NA	NA
WP_011407353.1\|336559_337144_-	manganese efflux pump MntP family protein	NA	NA	NA	NA
WP_011407354.1\|337620_338397_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_069959686.1\|338577_339879_+	L-fucose:H+ symporter permease	NA	NA	NA	NA
WP_094187863.1\|339875_340241_+	L-rhamnose mutarotase	NA	NA	NA	NA
WP_011257284.1\|340677_342159_+\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	2.7e-100	66.0
WP_109182027.1\|342351_343317_+\|transposase	IS1595-like element ISXo5 family transposase	NA	NA	NA	NA
WP_011407357.1\|344143_346306_+	hypothetical protein	NA	NA	NA	NA
WP_069959687.1\|346432_348601_-	peptidyl-dipeptidase Dcp	NA	NA	NA	NA
WP_011257288.1\|349238_349868_-\|holin	lysophosphatidylcholine acyltransferase	NA	NA	NA	NA
WP_011257289.1\|349870_350302_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_094187815.1\|350394_350937_+	DUF2059 domain-containing protein	NA	NA	NA	NA
WP_027703865.1\|351032_351785_-	pseudouridylate synthase	NA	NA	NA	NA
WP_011257292.1\|352009_352399_-	cupin domain-containing protein	NA	NA	NA	NA
WP_011257293.1\|352512_354186_-	ubiquinone biosynthesis regulatory protein kinase UbiB	E5EQY1	Bathycoccus_sp._RCC1105_virus	3.1e-28	28.6
WP_044757204.1\|354182_354827_-	sterol-binding protein	NA	NA	NA	NA
WP_011407366.1\|358511_358796_+	hypothetical protein	NA	NA	NA	NA
WP_115801865.1\|359147_359946_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_094187710.1\|360005_360769_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_109182067.1\|364722_365688_-\|transposase	IS1595-like element ISXo5 family transposase	NA	NA	NA	NA
WP_042464374.1\|366748_367855_+\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

778402 : 814721

Enterobacteria_phage(36.36%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_109182077.1\|778402_779722_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_011407609.1\|780037_781222_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.0e-41	45.4
WP_011407610.1\|781751_783065_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.8e-13	28.6
WP_011407611.1\|783054_783873_-	ABC transporter permease	NA	NA	NA	NA
WP_069959723.1\|784095_785037_-	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_011257675.1\|785036_785783_-	electron transfer flavoprotein subunit beta/FixA family protein	NA	NA	NA	NA
WP_011407612.1\|786008_787064_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	4.3e-84	48.0
WP_011407613.1\|787119_788007_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	2.2e-94	58.2
WP_011407614.1\|788003_788561_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	2.3e-44	47.5
WP_011407615.1\|788557_789466_+	dTDP-4-dehydrorhamnose reductase	I7HXC9	Enterobacteria_phage	1.8e-27	35.1
WP_011257680.1\|789582_790986_-	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	2.5e-47	29.6
WP_011407616.1\|791032_792379_-	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	2.6e-33	26.9
WP_011407617.1\|792512_793244_+	CoA transferase subunit A	NA	NA	NA	NA
WP_011257683.1\|793243_793873_+	CoA transferase subunit B	NA	NA	NA	NA
WP_011407618.1\|793930_796018_-	hypothetical protein	NA	NA	NA	NA
WP_012446093.1\|796014_797664_-	electron transfer flavoprotein-ubiquinone oxidoreductase	NA	NA	NA	NA
WP_011257686.1\|797779_798388_+	alpha-ketoglutarate-dependent dioxygenase AlkB	A0A2K9L0M4	Tupanvirus	1.8e-23	31.4
WP_011257687.1\|798938_799583_-	ABC transporter	NA	NA	NA	NA
WP_044757110.1\|799579_800506_-	MCE family protein	NA	NA	NA	NA
WP_011257689.1\|800508_801351_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	9.1e-13	30.1
WP_011407620.1\|801436_802549_-	ABC transporter permease	NA	NA	NA	NA
WP_011257691.1\|802718_803978_+	threonine/serine exporter	NA	NA	NA	NA
WP_011407621.1\|804039_804501_-	H-NS histone family protein	NA	NA	NA	NA
WP_011257693.1\|804643_806338_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_011257694.1\|806449_806854_-	DUF4124 domain-containing protein	NA	NA	NA	NA
WP_011407623.1\|806985_807759_+	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_011257696.1\|807769_808237_+	alanine acetyltransferase	NA	NA	NA	NA
WP_011257697.1\|808242_808716_+	ribosomal-protein-alanine N-acetyltransferase	NA	NA	NA	NA
WP_109182079.1\|809274_810594_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_109182080.1\|810751_812071_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_011407627.1\|812283_813252_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	9.6e-99	60.0
WP_109182081.1\|813401_814721_-\|transposase	IS701 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

881100 : 925002

Ralstonia_phage(25.0%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_129593129.1\|881100_882066_+\|transposase	IS1595-like element ISXo5 family transposase	NA	NA	NA	NA
WP_011257750.1\|882456_883032_-	septum formation inhibitor Maf	NA	NA	NA	NA
WP_011407659.1\|883144_883654_+	hypothetical protein	NA	NA	NA	NA
WP_010368401.1\|883752_883947_+	50S ribosomal protein L32	NA	NA	NA	NA
WP_011257752.1\|884036_885014_+	ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_011257753.1\|885243_885684_+	MEKHLA domain-containing protein	NA	NA	NA	NA
WP_011257754.1\|885961_886906_+	ACP S-malonyltransferase	NA	NA	NA	NA
WP_069959731.1\|886988_887732_+	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	3.1e-12	29.7
WP_010368407.1\|887936_888176_+	acyl carrier protein	B2ZXV3	Ralstonia_phage	5.9e-10	44.6
WP_011407661.1\|888317_889553_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_011407662.1\|889723_891079_+	aminodeoxychorismate synthase component I	NA	NA	NA	NA
WP_011257758.1\|891139_892213_+	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_069959732.1\|892209_893169_+	DNA polymerase III subunit delta'	NA	NA	NA	NA
WP_011257760.1\|893165_893519_+	type IV fimbriae assembly protein	NA	NA	NA	NA
WP_112998597.1\|894209_895004_+	hypothetical protein	NA	NA	NA	NA
WP_128415345.1\|895097_895283_+	hypothetical protein	NA	NA	NA	NA
WP_011407665.1\|895365_895692_+	hypothetical protein	NA	NA	NA	NA
WP_041181972.1\|895927_897526_-	propionate catabolism operon regulatory protein PrpR	NA	NA	NA	NA
WP_011257763.1\|897671_898568_+	methylisocitrate lyase	NA	NA	NA	NA
WP_011407667.1\|898643_899798_+	2-methylcitrate synthase	NA	NA	NA	NA
WP_011257765.1\|899992_902584_+	Fe/S-dependent 2-methylisocitrate dehydratase AcnD	NA	NA	NA	NA
WP_011407669.1\|902906_903044_+	hypothetical protein	NA	NA	NA	NA
WP_069959733.1\|903316_904522_+	2-methylaconitate cis-trans isomerase PrpF	NA	NA	NA	NA
WP_011409545.1\|904971_905940_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_011407672.1\|906181_908398_+	TonB-dependent receptor	NA	NA	NA	NA
WP_011407673.1\|908476_909475_+	nucleoside hydrolase	NA	NA	NA	NA
WP_103057250.1\|909584_909767_-	hypothetical protein	NA	NA	NA	NA
WP_011257772.1\|910746_913734_+	TonB-dependent receptor	NA	NA	NA	NA
WP_041182786.1\|913908_914856_+	glycerophosphodiester phosphodiesterase family protein	M1HTS7	Paramecium_bursaria_Chlorella_virus	4.9e-07	28.5
WP_011407676.1\|915354_915891_+	hypothetical protein	NA	NA	NA	NA
WP_133265185.1\|915961_917281_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_041182785.1\|917625_918588_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.5e-43	35.8
WP_012446027.1\|918721_919282_-	bacterioferritin	NA	NA	NA	NA
WP_011257779.1\|919324_919807_-	peroxiredoxin	A0A1D8KSL1	Synechococcus_phage	3.1e-21	36.2
WP_011407679.1\|919969_920446_+	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_011257781.1\|920856_921756_+	DnaJ domain-containing protein	A0A2L0UZR4	Agrobacterium_phage	5.9e-18	27.7
WP_011257782.1\|921995_922382_+	response regulator	W8CYM9	Bacillus_phage	9.6e-10	31.8
WP_011407680.1\|923011_924139_+\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
WP_027703756.1\|924138_925002_+\|protease	protease modulator HflC	NA	NA	NA	NA

DBSCAN-SWA_6

930302 : 1082802

114

Ralstonia_phage(18.52%)

protease,integrase,transposase

attL 1067413:1067433|attR 1082881:1082901

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011257788.1\|930302_931085_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_011407683.1\|931195_932572_-\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	1.7e-77	54.8
WP_011257791.1\|932815_933451_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_103057263.1\|934077_934611_+	hypothetical protein	NA	NA	NA	NA
WP_011258529.1\|934794_935763_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.0
WP_011257793.1\|935896_936094_+	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_011407685.1\|936103_937216_+	glycosyltransferase	NA	NA	NA	NA
WP_069960160.1\|937196_938531_+	O-antigen ligase family protein	NA	NA	NA	NA
WP_011257796.1\|938764_939685_-	LpxL/LpxP family Kdo(2)-lipid IV(A) lauroyl/palmitoleoyl acyltransferase	NA	NA	NA	NA
WP_011257797.1\|939761_941078_+	3-deoxy-D-manno-octulosonic acid transferase	NA	NA	NA	NA
WP_011257798.1\|941350_942730_-	TolC family outer membrane protein	NA	NA	NA	NA
WP_011407686.1\|942750_943407_-	protein-L-isoaspartate O-methyltransferase	NA	NA	NA	NA
WP_011257800.1\|943535_944189_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_011407687.1\|944459_944921_+	hypothetical protein	NA	NA	NA	NA
WP_069960069.1\|945980_946865_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011257806.1\|946985_948434_+	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
WP_011257807.1\|948501_949149_+	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
WP_011257808.1\|949965_951039_+	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
WP_011407690.1\|951369_952932_-	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	4.3e-08	24.4
WP_011407691.1\|952928_954053_-	threonine dehydratase	NA	NA	NA	NA
WP_011257810.1\|954128_954386_-	acetolactate synthase	NA	NA	NA	NA
WP_011257811.1\|954369_956091_-	acetolactate synthase 2 catalytic subunit	E4WLQ6	Ostreococcus_tauri_virus	6.1e-64	32.9
WP_011257812.1\|956134_957136_-	ketol-acid reductoisomerase	NA	NA	NA	NA
WP_011407693.1\|958412_960290_+	phosphomethylpyrimidine synthase ThiC	NA	NA	NA	NA
WP_011407694.1\|960715_963067_+	biopolymer transporter Tol	NA	NA	NA	NA
WP_011407695.1\|963177_964071_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_094187800.1\|964116_967086_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	8.7e-42	24.9
WP_094187799.1\|967700_968816_-	HDOD domain-containing protein	NA	NA	NA	NA
WP_011257818.1\|968962_969499_-	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	3.6e-47	53.6
WP_011407697.1\|969695_970178_+	hypothetical protein	NA	NA	NA	NA
WP_109182067.1\|972453_973419_+\|transposase	IS1595-like element ISXo5 family transposase	NA	NA	NA	NA
WP_109182120.1\|973415_973589_-	hypothetical protein	NA	NA	NA	NA
WP_012446005.1\|973873_974365_+	hypothetical protein	NA	NA	NA	NA
WP_011257827.1\|976043_977300_-	6-phosphofructokinase	NA	NA	NA	NA
WP_011257828.1\|977459_978023_+	adenylate kinase	A0A1B4XWI3	Tenacibaculum_phage	3.6e-13	31.4
WP_011257829.1\|978389_979748_+	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase	NA	NA	NA	NA
WP_027703752.1\|979747_980344_+\|protease	ATP-dependent protease	NA	NA	NA	NA
WP_011257831.1\|980490_981375_+	membrane protein	NA	NA	NA	NA
WP_011257834.1\|983356_983971_+	glutathione S-transferase	NA	NA	NA	NA
WP_011257835.1\|984053_985040_-	malate dehydrogenase	NA	NA	NA	NA
WP_011257836.1\|985155_985650_-	peptidylprolyl isomerase	A0A1V0SCU1	Indivirus	5.5e-26	52.3
WP_011257837.1\|985894_987724_+	translational GTPase TypA	NA	NA	NA	NA
WP_011407704.1\|987742_988213_+	DUF2127 domain-containing protein	NA	NA	NA	NA
WP_011257840.1\|989135_990263_-	mechanosensitive ion channel	NA	NA	NA	NA
WP_011257841.1\|990363_991746_-	3-deoxy-7-phosphoheptulonate synthase class II	NA	NA	NA	NA
WP_011257842.1\|991993_994117_+	TonB-dependent receptor plug domain-containing protein	NA	NA	NA	NA
WP_011407706.1\|994645_995164_-	disulfide bond formation protein B	NA	NA	NA	NA
WP_115801872.1\|995869_996971_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.6e-41	41.4
WP_011257570.1\|997486_998722_+\|transposase	ISL3-like element ISXoo13 family transposase	NA	NA	NA	NA
WP_011407710.1\|999335_1000226_-\|protease	trypsin-like serine protease	NA	NA	NA	NA
WP_012445986.1\|1000315_1000456_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_011407713.1\|1004015_1005251_-\|transposase	ISL3-like element ISXoo13 family transposase	NA	NA	NA	NA
WP_109182089.1\|1006233_1007553_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_041182948.1\|1008298_1009222_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.3e-36	33.1
WP_109182121.1\|1010284_1011250_+\|transposase	IS1595-like element ISXo5 family transposase	NA	NA	NA	NA
WP_011257859.1\|1011551_1013129_+	hypothetical protein	NA	NA	NA	NA
WP_094187735.1\|1013196_1013960_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011257031.1\|1016628_1017597_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	4.3e-99	60.0
WP_011407721.1\|1017857_1018319_-	cell wall hydrolase	NA	NA	NA	NA
WP_011257866.1\|1018867_1019110_-	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_109182012.1\|1019103_1019867_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_049756327.1\|1019899_1020631_-	glycerophosphodiester phosphodiesterase family protein	A0A0S2MYI4	Enterococcus_phage	1.1e-06	37.5
WP_109182091.1\|1022450_1023203_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_109181928.1\|1023204_1024170_-\|transposase	IS1595-like element ISXo5 family transposase	NA	NA	NA	NA
WP_011257874.1\|1024433_1025441_+	isocitrate dehydrogenase	NA	NA	NA	NA
WP_011257875.1\|1025584_1026346_-	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_012445939.1\|1029663_1030956_+	trigger factor	NA	NA	NA	NA
WP_002806026.1\|1031048_1031675_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.0e-56	57.4
WP_011257881.1\|1031799_1033086_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	9.0e-137	59.9
WP_012445937.1\|1033229_1035701_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.7e-224	52.2
WP_002806049.1\|1035914_1036187_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	2.2e-21	64.0
WP_011407728.1\|1037018_1038989_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_011407729.1\|1039694_1040873_-	lytic transglycosylase domain-containing protein	NA	NA	NA	NA
WP_011257886.1\|1040869_1041637_-	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_011257887.1\|1041649_1042306_+	hypothetical protein	NA	NA	NA	NA
WP_011257888.1\|1042333_1042786_+	ribonuclease HI	A0A1Q2U2R0	Vibrio_phage	2.8e-40	55.4
WP_011257889.1\|1042794_1043529_+	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	8.7e-36	40.4
WP_011257891.1\|1043964_1044669_-	serine/threonine-protein phosphatase	NA	NA	NA	NA
WP_041181989.1\|1045494_1046124_-	hypothetical protein	NA	NA	NA	NA
WP_012445927.1\|1047015_1047216_+	hypothetical protein	NA	NA	NA	NA
WP_069963830.1\|1047611_1050335_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	1.1e-70	30.0
WP_069960070.1\|1050402_1052553_+	DUF3274 domain-containing protein	A0A077K801	Ralstonia_phage	2.0e-27	28.2
WP_044757078.1\|1052549_1054247_+	DUF2875 domain-containing protein	NA	NA	NA	NA
WP_011257897.1\|1054566_1056771_+	DUF3274 domain-containing protein	A0A077K801	Ralstonia_phage	5.9e-19	29.7
WP_069970082.1\|1056767_1058462_+	DUF2875 domain-containing protein	NA	NA	NA	NA
WP_075239641.1\|1058458_1058722_+	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	7.5e-06	43.4
WP_011257899.1\|1058783_1059341_+	hypothetical protein	NA	NA	NA	NA
WP_115862289.1\|1059423_1060389_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_069970176.1\|1060487_1061174_-\|integrase	site-specific integrase	A0A077KET4	Ralstonia_phage	1.0e-54	51.8
WP_011257902.1\|1061284_1061689_+	hypothetical protein	A0A1C9C5K8	Heterosigma_akashiwo_virus	5.0e-17	35.9
WP_011407740.1\|1061899_1062949_-	glycosyltransferase family 9 protein	NA	NA	NA	NA
WP_011257904.1\|1062969_1063719_+	3-deoxy-D-manno-octulosonic acid kinase	NA	NA	NA	NA
WP_011257905.1\|1063718_1064468_+	MBL fold metallo-hydrolase	A0A0A0RUN7	Bacillus_phage	2.4e-09	26.0
WP_011257906.1\|1064467_1065499_+	GTP 3',8-cyclase MoaA	NA	NA	NA	NA
WP_011257907.1\|1065516_1065876_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_011407742.1\|1065900_1066398_+	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
WP_011257909.1\|1066394_1066640_+	MoaD/ThiS family protein	NA	NA	NA	NA
WP_011257910.1\|1066636_1067083_+	molybdenum cofactor biosynthesis protein MoaE	NA	NA	NA	NA
1067413:1067433	attL	NA	NA	NA	NA
WP_069970083.1\|1067906_1068236_+	helix-turn-helix domain-containing protein	A0A139ZPK3	Marinitoga_camini_virus	7.7e-08	45.9
WP_069970084.1\|1068228_1069056_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_082323361.1\|1069148_1069553_+	H-NS histone family protein	NA	NA	NA	NA
WP_155296475.1\|1069587_1070796_+	hypothetical protein	NA	NA	NA	NA
WP_069970087.1\|1070813_1072151_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_069970177.1\|1072335_1072527_-	antitoxin VbhA family protein	NA	NA	NA	NA
WP_155296476.1\|1072654_1072876_-	hypothetical protein	NA	NA	NA	NA
WP_082323424.1\|1072990_1073320_-	hypothetical protein	NA	NA	NA	NA
WP_078537162.1\|1073631_1073982_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_082323362.1\|1074129_1075383_+	SIR2 family protein	NA	NA	NA	NA
WP_069970089.1\|1075379_1077224_+	ATP-binding protein	NA	NA	NA	NA
WP_082323363.1\|1077213_1077426_+	KTSC domain-containing protein	A0A0K1LMB5	Caulobacter_phage	1.4e-10	50.7
WP_069970090.1\|1077456_1078272_-	hypothetical protein	NA	NA	NA	NA
WP_069970091.1\|1078693_1080286_+	plasmid mobilization protein	NA	NA	NA	NA
WP_069970092.1\|1080625_1081315_-	hypothetical protein	NA	NA	NA	NA
WP_082323364.1\|1081311_1082802_-\|integrase	site-specific integrase	NA	NA	NA	NA
1082881:1082901	attR	NA	NA	NA	NA

DBSCAN-SWA_7

1100827 : 1166682

Bacillus_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011257570.1\|1100827_1102063_+\|transposase	ISL3-like element ISXoo13 family transposase	NA	NA	NA	NA
WP_011258802.1\|1102891_1103860_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_075241901.1\|1104327_1104678_-	DUF4433 domain-containing protein	NA	NA	NA	NA
WP_143681429.1\|1104759_1106079_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_011407757.1\|1106122_1106458_-	DUF4433 domain-containing protein	NA	NA	NA	NA
WP_011257932.1\|1106789_1107716_-	Grx4 family monothiol glutaredoxin	NA	NA	NA	NA
WP_011257933.1\|1107776_1108553_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_011407759.1\|1108854_1109526_-	methyltransferase	NA	NA	NA	NA
WP_011407760.1\|1109848_1110487_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_011257936.1\|1110486_1111758_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_011257937.1\|1111911_1113003_+	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
WP_011257938.1\|1113002_1114265_+	flavohemoglobin expression-modulating QEGLA motif protein	NA	NA	NA	NA
WP_011407761.1\|1114417_1115098_+	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
WP_011407762.1\|1115264_1117181_-	amylosucrase	NA	NA	NA	NA
WP_011407763.1\|1117215_1119660_-	TonB-dependent receptor plug domain-containing protein	NA	NA	NA	NA
WP_011407764.1\|1119929_1121261_+	MFS transporter	NA	NA	NA	NA
WP_011407765.1\|1121501_1122533_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_011407766.1\|1122773_1123514_-	acetoacetyl-CoA reductase	NA	NA	NA	NA
WP_011257945.1\|1123625_1124954_-	CitMHS family transporter	NA	NA	NA	NA
WP_011407767.1\|1125181_1126375_-	porin	NA	NA	NA	NA
WP_011407768.1\|1126630_1127332_+	response regulator	NA	NA	NA	NA
WP_069970094.1\|1127324_1128710_+	sensor histidine kinase	W8CYF6	Bacillus_phage	8.3e-11	23.7
WP_011407770.1\|1128709_1129759_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011257949.1\|1129798_1130437_+	response regulator transcription factor	NA	NA	NA	NA
WP_069970095.1\|1130637_1131492_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_011407771.1\|1131488_1132127_-	aldo/keto reductase	NA	NA	NA	NA
WP_011257953.1\|1132435_1133338_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011257955.1\|1133329_1134109_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_143677753.1\|1134105_1135428_-	MFS transporter	Q6JIH2	Burkholderia_virus	1.5e-62	36.3
WP_069970096.1\|1135770_1138416_-	response regulator	B5LWN0	Feldmannia_species_virus	4.4e-13	28.1
WP_011407774.1\|1138737_1139910_-	porin	NA	NA	NA	NA
WP_011407775.1\|1140200_1141574_+	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_011257960.1\|1141771_1144081_+	NADP-dependent malic enzyme	NA	NA	NA	NA
WP_155296477.1\|1144809_1145911_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.2e-43	42.3
WP_012445878.1\|1147342_1147966_-	thiamine phosphate synthase	NA	NA	NA	NA
WP_011257965.1\|1147989_1148229_+	rubredoxin	NA	NA	NA	NA
WP_011257966.1\|1148278_1149160_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_011407780.1\|1149309_1149759_-	DUF192 domain-containing protein	NA	NA	NA	NA
WP_011407781.1\|1149909_1150557_-	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_011257969.1\|1150648_1151119_-	EVE domain-containing protein	NA	NA	NA	NA
WP_011407783.1\|1151115_1151706_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_011257971.1\|1152314_1152614_-	cell division protein ZapA	NA	NA	NA	NA
WP_011407784.1\|1152610_1152832_-	TIGR02449 family protein	NA	NA	NA	NA
WP_011407785.1\|1153067_1153610_+	YecA family protein	NA	NA	NA	NA
WP_011257974.1\|1153620_1154961_+	M24 family metallopeptidase	NA	NA	NA	NA
WP_094187736.1\|1155668_1156432_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011257975.1\|1156664_1157990_-	Xaa-Pro dipeptidase	NA	NA	NA	NA
WP_011257976.1\|1158188_1158536_-	PilZ domain-containing protein	NA	NA	NA	NA
WP_011407789.1\|1158532_1160941_-	DUF1631 domain-containing protein	NA	NA	NA	NA
WP_011257978.1\|1161119_1162277_-	radical SAM family heme chaperone HemW	NA	NA	NA	NA
WP_011257979.1\|1162292_1162892_-	RdgB/HAM1 family non-canonical purine NTP pyrophosphatase	C6K8R3	Cassava_brown_streak_virus	3.8e-13	34.8
WP_011257980.1\|1162888_1163284_-	glyoxalase	NA	NA	NA	NA
WP_011257981.1\|1163280_1164006_-	ribonuclease PH	NA	NA	NA	NA
WP_011257982.1\|1164115_1164976_+	YicC family protein	NA	NA	NA	NA
WP_011257983.1\|1165092_1165704_+	guanylate kinase	A0A218KC48	Bacillus_phage	3.1e-10	30.9
WP_099051298.1\|1165884_1166682_+\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_8

1175113 : 1239262

Leptospira_phage(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_115801874.1\|1175113_1176433_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_011407794.1\|1176796_1177447_-	hypothetical protein	NA	NA	NA	NA
WP_094187795.1\|1177756_1180279_-	penicillin-binding protein 1A	NA	NA	NA	NA
WP_011407795.1\|1180401_1181460_+	pilus assembly protein PilM	NA	NA	NA	NA
WP_011257994.1\|1181459_1182218_+	PilN domain-containing protein	NA	NA	NA	NA
WP_011257995.1\|1182214_1182880_+	type 4a pilus biogenesis protein PilO	NA	NA	NA	NA
WP_011257996.1\|1182876_1183410_+	pilus assembly protein PilP	NA	NA	NA	NA
WP_011407796.1\|1183429_1185379_+	type IV pilus secretin PilQ family protein	NA	NA	NA	NA
WP_155296478.1\|1185449_1186248_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011257854.1\|1186390_1187626_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_082323365.1\|1187696_1188731_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.1e-65	41.7
WP_069963832.1\|1189353_1190373_+	MoxR family ATPase	NA	NA	NA	NA
WP_069959745.1\|1190393_1191356_+	DUF58 domain-containing protein	NA	NA	NA	NA
WP_011407801.1\|1191358_1191820_+	DUF4381 domain-containing protein	NA	NA	NA	NA
WP_011407802.1\|1191816_1192824_+	VWA domain-containing protein	NA	NA	NA	NA
WP_069959746.1\|1192820_1194623_+	VWA domain-containing protein	NA	NA	NA	NA
WP_011407804.1\|1194619_1196377_+	membrane protein	NA	NA	NA	NA
WP_033013273.1\|1196672_1196990_+	hypothetical protein	NA	NA	NA	NA
WP_103057328.1\|1197187_1198468_+	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_011258007.1\|1198687_1200688_+	transketolase	NA	NA	NA	NA
WP_069959747.1\|1201506_1202214_-	M23 family metallopeptidase	A0A0M5M794	Arthrobacter_phage	2.6e-05	34.2
WP_011407808.1\|1202216_1203209_-	murein L,D-transpeptidase	NA	NA	NA	NA
WP_042464574.1\|1203528_1206243_-	TonB-dependent receptor	NA	NA	NA	NA
WP_011407810.1\|1206362_1207538_-	hypothetical protein	NA	NA	NA	NA
WP_042464577.1\|1207672_1209631_-	acetyl-CoA hydrolase	NA	NA	NA	NA
WP_069960293.1\|1209806_1210454_+	thermostable hemolysin	NA	NA	NA	NA
WP_011407813.1\|1210450_1211950_+	AMP-binding protein	NA	NA	NA	NA
WP_011407814.1\|1211946_1212621_+	iron-containing redox enzyme family protein	NA	NA	NA	NA
WP_069959748.1\|1212620_1213460_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_011407818.1\|1214126_1214825_+	response regulator transcription factor	W8CYM9	Bacillus_phage	9.8e-29	35.0
WP_041182938.1\|1214842_1216204_+	two-component sensor histidine kinase	NA	NA	NA	NA
WP_011407820.1\|1216303_1216669_+	BlaI/MecI/CopY family transcriptional regulator	NA	NA	NA	NA
WP_069959749.1\|1216658_1217975_+	TonB family protein	NA	NA	NA	NA
WP_011407822.1\|1217971_1218556_+	hypothetical protein	NA	NA	NA	NA
WP_011407823.1\|1218898_1219513_-	molybdenum ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.1e-19	35.0
WP_011258026.1\|1219512_1220205_-	molybdate ABC transporter permease subunit	NA	NA	NA	NA
WP_069959750.1\|1220215_1220992_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011258028.1\|1221062_1221893_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_069959751.1\|1221906_1222680_-	S1/P1 nuclease	NA	NA	NA	NA
WP_153296750.1\|1225753_1225894_+	hypothetical protein	NA	NA	NA	NA
WP_011407830.1\|1226550_1227552_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_109181945.1\|1227939_1228702_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_115801876.1\|1228791_1229757_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_027704076.1\|1229866_1231186_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_011407833.1\|1231648_1232326_-	response regulator transcription factor	Q6XM27	Feldmannia_irregularis_virus	7.4e-05	27.4
WP_027704066.1\|1232405_1232795_-	hypothetical protein	NA	NA	NA	NA
WP_011407835.1\|1233007_1233895_-	30S ribosomal protein S6--L-glutamate ligase	A0A1D7SR78	Cyanophage	1.2e-31	32.7
WP_069970099.1\|1234328_1235312_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	2.0e-99	61.5
WP_011407838.1\|1235485_1237573_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_011407839.1\|1237724_1238384_+	serine/threonine protein kinase	NA	NA	NA	NA
WP_094187758.1\|1238464_1239262_+\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_9

1258198 : 1313985

Xanthomonas_phage(84.62%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011258055.1\|1258198_1259068_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.4e-29	35.2
WP_011258056.1\|1259089_1259761_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	5.2e-27	38.9
WP_011258057.1\|1259757_1259979_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_041182003.1\|1260152_1263161_-	avirulence protein	NA	NA	NA	NA
WP_011408491.1\|1263384_1263684_-	hypothetical protein	A0A1W6DY99	Xanthomonas_phage	1.9e-45	91.3
WP_041182100.1\|1263687_1263882_-	hypothetical protein	A0A1W6DXV7	Xanthomonas_phage	2.5e-19	80.6
WP_069959754.1\|1264150_1267462_-	Avirulence protein AvrBs3	NA	NA	NA	NA
WP_041182759.1\|1267685_1267985_-	hypothetical protein	A0A1W6DY99	Xanthomonas_phage	9.3e-45	91.3
WP_041182100.1\|1267988_1268183_-	hypothetical protein	A0A1W6DXV7	Xanthomonas_phage	2.5e-19	80.6
WP_153296744.1\|1268249_1268396_-	hypothetical protein	Q38057	Xanthomonas_phage	6.4e-07	78.4
WP_011408408.1\|1273085_1273385_-	hypothetical protein	A0A1W6DY99	Xanthomonas_phage	6.4e-46	92.4
WP_041182100.1\|1273388_1273583_-	hypothetical protein	A0A1W6DXV7	Xanthomonas_phage	2.5e-19	80.6
WP_082323370.1\|1273851_1277649_-	avirulence protein	NA	NA	NA	NA
WP_109181945.1\|1278869_1279633_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011408516.1\|1279763_1280276_+	hypothetical protein	NA	NA	NA	NA
WP_125168752.1\|1280889_1281213_-	hypothetical protein	NA	NA	NA	NA
WP_011258188.1\|1281389_1282358_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_109181946.1\|1282876_1283640_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_125168751.1\|1283709_1284021_+	hypothetical protein	NA	NA	NA	NA
WP_011408511.1\|1284142_1284325_+	hypothetical protein	NA	NA	NA	NA
WP_069970101.1\|1284449_1285079_-	hypothetical protein	A0A1W6DY99	Xanthomonas_phage	2.5e-71	80.6
WP_011408508.1\|1285390_1285603_+	hypothetical protein	A0A1D6ZIV2	Xanthomonas_phage	1.6e-27	100.0
WP_080496434.1\|1285755_1286796_+	inovirus-type Gp2 protein	A0A1D6ZIT9	Xanthomonas_phage	7.7e-203	99.1
WP_069959850.1\|1286792_1287089_+	DNA-binding protein	A0A1W6DXU2	Xanthomonas_phage	2.8e-49	100.0
WP_042464854.1\|1287092_1287296_+	hypothetical protein	A0A1D6ZIU2	Xanthomonas_phage	9.8e-30	100.0
WP_011347634.1\|1287307_1287538_+	hypothetical protein	A0A1W6DXZ2	Xanthomonas_phage	2.2e-30	100.0
WP_069959849.1\|1287674_1289081_+	hypothetical protein	A0A1W6DXV5	Xanthomonas_phage	7.9e-235	99.6
WP_011408503.1\|1289080_1289410_+	DUF2523 domain-containing protein	A0A1D6ZIU0	Xanthomonas_phage	3.8e-55	100.0
WP_069959848.1\|1289409_1290603_+	hypothetical protein	A0A1W6DXR3	Xanthomonas_phage	5.5e-221	100.0
WP_069959847.1\|1290604_1291252_+	conjugal transfer protein	A0A1W6DY89	Xanthomonas_phage	2.7e-121	100.0
WP_069959846.1\|1291412_1291706_+	hypothetical protein	A0A1W6DXU7	Xanthomonas_phage	3.4e-47	100.0
WP_113085484.1\|1291761_1291974_+	hypothetical protein	A0A1W6DXJ1	Xanthomonas_phage	2.4e-26	100.0
WP_069959845.1\|1291998_1292310_-	chloride channel protein	A0A1W6DXV7	Xanthomonas_phage	1.8e-54	100.0
WP_075239627.1\|1293311_1293410_-	hypothetical protein	NA	NA	NA	NA
WP_044756821.1\|1293451_1294231_+	pectate lyase	NA	NA	NA	NA
WP_044756822.1\|1294761_1298058_+	hypothetical protein	NA	NA	NA	NA
WP_012444931.1\|1298326_1298521_+	hypothetical protein	A0A1W6DXV7	Xanthomonas_phage	1.3e-18	79.0
WP_011408491.1\|1298524_1298824_+	hypothetical protein	A0A1W6DY99	Xanthomonas_phage	1.9e-45	91.3
WP_069964882.1\|1299047_1302905_+	avirulence protein	NA	NA	NA	NA
WP_011258948.1\|1303490_1304111_-	bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE	NA	NA	NA	NA
WP_011258947.1\|1304100_1304877_-	imidazole glycerol phosphate synthase subunit HisF	NA	NA	NA	NA
WP_011258946.1\|1304870_1305605_-	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase	NA	NA	NA	NA
WP_011258945.1\|1305601_1306204_-	imidazole glycerol phosphate synthase subunit HisH	NA	NA	NA	NA
WP_011258944.1\|1306200_1307328_-	bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB	NA	NA	NA	NA
WP_011408488.1\|1307324_1308416_-	histidinol-phosphate transaminase	NA	NA	NA	NA
WP_011258942.1\|1308412_1309708_-	histidinol dehydrogenase	NA	NA	NA	NA
WP_011258941.1\|1309704_1310619_-	ATP phosphoribosyltransferase	NA	NA	NA	NA
WP_011258940.1\|1310628_1310955_-	DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_094187798.1\|1311268_1312066_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_012444952.1\|1312572_1313985_-\|tRNA	histidine--tRNA ligase	A0A2K9L6G5	Tupanvirus	3.0e-40	28.2

DBSCAN-SWA_10

1415042 : 1542764

Ralstonia_phage(19.23%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_109181928.1\|1415042_1416008_+\|transposase	IS1595-like element ISXo5 family transposase	NA	NA	NA	NA
WP_011408430.1\|1416028_1416832_-	amidohydrolase	NA	NA	NA	NA
WP_011408429.1\|1416971_1418120_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_011408428.1\|1418346_1418991_+	heme ABC exporter ATP-binding protein CcmA	G3M9Y6	Bacillus_virus	3.1e-13	25.9
WP_011258853.1\|1418987_1419683_+	heme exporter protein CcmB	NA	NA	NA	NA
WP_011408427.1\|1419777_1420530_+	heme ABC transporter permease	NA	NA	NA	NA
WP_011258852.1\|1420526_1420697_+	heme exporter protein CcmD	NA	NA	NA	NA
WP_011258851.1\|1420693_1421164_+	cytochrome c maturation protein CcmE	NA	NA	NA	NA
WP_011408426.1\|1421332_1423270_+	heme lyase CcmF/NrfE family subunit	NA	NA	NA	NA
WP_011258849.1\|1423262_1423865_+	DsbE family thiol:disulfide interchange protein	NA	NA	NA	NA
WP_094187828.1\|1423882_1424293_+	cytochrome c-type biogenesis protein CcmH	NA	NA	NA	NA
WP_011258847.1\|1424286_1425306_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_011258845.1\|1425595_1427467_-	DUF4105 domain-containing protein	NA	NA	NA	NA
WP_011408424.1\|1427463_1427763_-	DUF2388 domain-containing protein	NA	NA	NA	NA
WP_011258843.1\|1427797_1429216_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_011258842.1\|1429424_1430666_+	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	1.7e-103	48.4
WP_011258841.1\|1430821_1431409_-	NUDIX hydrolase	NA	NA	NA	NA
WP_011408420.1\|1431545_1433027_+	amino acid permease	NA	NA	NA	NA
WP_069959832.1\|1433103_1434534_+	amino acid permease	NA	NA	NA	NA
WP_011408418.1\|1434622_1435300_+	methylthioribulose 1-phosphate dehydratase	NA	NA	NA	NA
WP_011408417.1\|1435311_1435878_+	acireductone dioxygenase	NA	NA	NA	NA
WP_011408416.1\|1435880_1436579_+	acireductone synthase	NA	NA	NA	NA
WP_042464827.1\|1436905_1437991_+	peptidase C13	NA	NA	NA	NA
WP_155296480.1\|1439822_1441142_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_069959831.1\|1441430_1445558_+	avirulence protein	NA	NA	NA	NA
WP_069959830.1\|1445698_1447174_+\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	9.2e-101	67.1
WP_082323372.1\|1448725_1452328_+	Avirulence protein AvrBs3	NA	NA	NA	NA
WP_153296744.1\|1452383_1452530_+	hypothetical protein	Q38057	Xanthomonas_phage	6.4e-07	78.4
WP_042464821.1\|1452596_1452791_+	hypothetical protein	A0A1W6DXV7	Xanthomonas_phage	3.9e-20	82.3
WP_011408408.1\|1452794_1453094_+	hypothetical protein	A0A1W6DY99	Xanthomonas_phage	6.4e-46	92.4
WP_069960204.1\|1453317_1456833_+	Avirulence protein AvrBs3	NA	NA	NA	NA
WP_109182103.1\|1456906_1457002_+	hypothetical protein	NA	NA	NA	NA
WP_153296780.1\|1457245_1457512_+	hypothetical protein	NA	NA	NA	NA
WP_011258825.1\|1458202_1459216_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_069959827.1\|1459315_1459912_+	FMN-dependent NADH-azoreductase	NA	NA	NA	NA
WP_011407175.1\|1459963_1460932_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	5.6e-99	59.7
WP_115801888.1\|1461144_1462464_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_155296478.1\|1462903_1463701_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011258822.1\|1463851_1465201_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.5e-94	51.6
WP_099051282.1\|1465207_1465972_+	energy transducer TonB	NA	NA	NA	NA
WP_027704061.1\|1466332_1466800_+	energy transducer TonB	NA	NA	NA	NA
WP_109181933.1\|1466986_1468088_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.2e-36	39.2
WP_011257031.1\|1469265_1470234_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	4.3e-99	60.0
WP_155296481.1\|1471265_1472231_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_109181931.1\|1474460_1475426_-\|transposase	IS1595-like element ISXo5 family transposase	NA	NA	NA	NA
WP_109181930.1\|1475651_1476449_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011257031.1\|1476729_1477698_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	4.3e-99	60.0
WP_069960202.1\|1477889_1478858_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	1.9e-99	60.0
WP_011258800.1\|1479718_1480918_+	homoserine O-acetyltransferase	NA	NA	NA	NA
WP_011258799.1\|1481066_1481249_+	cold shock domain-containing protein	NA	NA	NA	NA
WP_011408398.1\|1481570_1483046_+\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	2.9e-99	66.8
WP_011408397.1\|1483100_1484285_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	5.0e-41	44.8
WP_109181928.1\|1484729_1485695_+\|transposase	IS1595-like element ISXo5 family transposase	NA	NA	NA	NA
WP_011258802.1\|1487047_1488016_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_011408388.1\|1488174_1488522_-	hypothetical protein	NA	NA	NA	NA
WP_011258793.1\|1488523_1489291_-	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_109181926.1\|1490361_1491159_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011258790.1\|1491370_1493899_-	ribonuclease R	Q0GXV6	Lactococcus_phage	4.0e-64	34.0
WP_042464810.1\|1494465_1495911_-	acetylhydrolase	M1HKG7	Acanthocystis_turfacea_Chlorella_virus	1.8e-08	25.8
WP_042464808.1\|1496282_1496423_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_103057266.1\|1496422_1497571_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_011258786.1\|1497692_1498688_+	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	3.7e-05	46.9
WP_011408382.1\|1498684_1499824_+	5-methyltetrahydrofolate--homocysteine methyltransferase	A0A140XBC7	Dickeya_phage	2.2e-17	66.7
WP_012445124.1\|1499966_1502720_+	methionine synthase	NA	NA	NA	NA
WP_011258783.1\|1503106_1504312_-	AGE family epimerase/isomerase	NA	NA	NA	NA
WP_103073473.1\|1504308_1505367_-	carbohydrate kinase	NA	NA	NA	NA
WP_011258781.1\|1505291_1506602_-	L-fucose:H+ symporter permease	NA	NA	NA	NA
WP_069960295.1\|1506615_1507791_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_042464805.1\|1507931_1508777_-	transporter	NA	NA	NA	NA
WP_042464803.1\|1509110_1509863_-	DUF2058 family protein	NA	NA	NA	NA
WP_011258777.1\|1509863_1510100_-	protein SlyX	NA	NA	NA	NA
WP_011408374.1\|1510092_1511442_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	2.4e-79	40.4
WP_027703707.1\|1511467_1512433_-	FKBP-type peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_011408372.1\|1512524_1513082_-	glutathione peroxidase	NA	NA	NA	NA
WP_042464800.1\|1513217_1513466_+	hypothetical protein	NA	NA	NA	NA
WP_014502778.1\|1513468_1513831_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_012445132.1\|1513827_1514703_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.3e-13	27.9
WP_044756884.1\|1514699_1515686_+	hypothetical protein	NA	NA	NA	NA
WP_012445134.1\|1515695_1516526_+	hypothetical protein	NA	NA	NA	NA
WP_027703710.1\|1517158_1517581_+	hypothetical protein	NA	NA	NA	NA
WP_011408367.1\|1517703_1519107_-	class II fumarate hydratase	NA	NA	NA	NA
WP_155296175.1\|1520455_1520599_+	hypothetical protein	NA	NA	NA	NA
WP_094187715.1\|1520558_1521322_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011258759.1\|1524344_1525712_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	3.3e-113	48.6
WP_011258758.1\|1525953_1526454_+	DUF3060 domain-containing protein	NA	NA	NA	NA
WP_041182090.1\|1526733_1526997_-	PDZ domain-containing protein	NA	NA	NA	NA
WP_011408362.1\|1527334_1528834_+	cupin domain-containing protein	NA	NA	NA	NA
WP_011408361.1\|1528830_1529763_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_027703748.1\|1529943_1532772_+	2-oxoglutarate dehydrogenase E1 component	NA	NA	NA	NA
WP_027703749.1\|1532814_1534017_+	dihydrolipoyllysine-residue succinyltransferase	NA	NA	NA	NA
WP_027703750.1\|1534254_1535691_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	5.7e-39	27.1
WP_044756895.1\|1535889_1536483_+	TIGR00730 family Rossman fold protein	A0A2I2L3F0	Orpheovirus	2.1e-11	27.5
WP_103073520.1\|1536750_1537344_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	8.1e-16	41.2
WP_011408359.1\|1537340_1539110_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	8.0e-59	30.7
WP_069970104.1\|1539448_1540054_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_044756897.1\|1540183_1541110_+	TolC family protein	NA	NA	NA	NA
WP_115862277.1\|1541444_1542764_+\|transposase	IS701-like element ISXo15 family transposase	NA	NA	NA	NA

DBSCAN-SWA_11

1593917 : 1717948

104

Acidithiobacillus_phage(16.67%)

tRNA,protease,transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033003618.1\|1593917_1594442_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_044756902.1\|1594450_1595221_+	molecular chaperone	NA	NA	NA	NA
WP_044756903.1\|1595237_1597589_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_011258703.1\|1597585_1598620_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_044756904.1\|1598666_1598999_+	hypothetical protein	NA	NA	NA	NA
WP_011408326.1\|1599001_1599727_+	molecular chaperone	NA	NA	NA	NA
WP_011258701.1\|1600102_1600906_+	30S ribosomal protein S2	NA	NA	NA	NA
WP_011258700.1\|1601075_1601954_+	elongation factor Ts	NA	NA	NA	NA
WP_011408325.1\|1602081_1602459_+	HDOD domain-containing protein	NA	NA	NA	NA
WP_011258698.1\|1602515_1603238_+	UMP kinase	NA	NA	NA	NA
WP_011258697.1\|1603418_1603976_+	ribosome recycling factor	NA	NA	NA	NA
WP_027703358.1\|1603993_1604755_+	di-trans,poly-cis-decaprenylcistransferase	R9W0U9	Flavobacterium_phage	3.6e-16	32.6
WP_011258695.1\|1604751_1605579_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_011258694.1\|1605581_1606772_+	1-deoxy-D-xylulose-5-phosphate reductoisomerase	NA	NA	NA	NA
WP_011408324.1\|1606798_1608145_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_011258692.1\|1608141_1610595_+	outer membrane protein assembly factor BamA	NA	NA	NA	NA
WP_069959820.1\|1610994_1612008_+	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
WP_011258690.1\|1612004_1612466_+	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_011258689.1\|1612489_1613281_+	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
WP_027703356.1\|1613319_1614576_+	lipid-A-disaccharide synthase	NA	NA	NA	NA
WP_011408322.1\|1614572_1615313_+	ribonuclease HII	G9E3X7	Emiliania_huxleyi_virus	1.6e-24	38.0
WP_011408321.1\|1615770_1619361_+	DNA polymerase III subunit alpha	A0A291AVA6	Streptomyces_phage	4.4e-181	36.6
WP_011258685.1\|1619536_1620496_+	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_042464756.1\|1621335_1623516_+	TonB-dependent receptor plug domain-containing protein	NA	NA	NA	NA
WP_011258682.1\|1623515_1624253_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.5e-08	27.6
WP_011258681.1\|1624249_1625662_+	DUF3526 domain-containing protein	NA	NA	NA	NA
WP_011258680.1\|1625598_1626942_+	DUF3526 domain-containing protein	NA	NA	NA	NA
WP_012445196.1\|1627763_1628030_+	hypothetical protein	NA	NA	NA	NA
WP_069970181.1\|1628107_1628554_-	hypothetical protein	NA	NA	NA	NA
WP_011408316.1\|1628627_1629230_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011258677.1\|1629397_1630714_+	polyhydroxyalkanoate depolymerase	NA	NA	NA	NA
WP_012445198.1\|1631186_1631750_+	hypothetical protein	NA	NA	NA	NA
WP_080256646.1\|1635451_1635622_+	adenylyl-sulfate kinase	NA	NA	NA	NA
WP_011408313.1\|1635635_1636052_-	hypothetical protein	NA	NA	NA	NA
WP_069959817.1\|1636850_1638326_+\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	2.2e-102	67.5
WP_011408311.1\|1638368_1638764_+	type I toxin-antitoxin system SymE family toxin	NA	NA	NA	NA
WP_082323429.1\|1638803_1640180_-\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	2.0e-78	55.1
WP_011258670.1\|1641810_1642485_+	DUF502 domain-containing protein	A0A2I7S9X1	Vibrio_phage	1.9e-08	24.5
WP_011258669.1\|1642489_1643266_+	queuosine precursor transporter	R4TNY5	Halovirus	1.9e-09	27.2
WP_069959816.1\|1643686_1645624_+	DUF885 family protein	NA	NA	NA	NA
WP_011408306.1\|1645805_1646783_-	homocysteine S-methyltransferase	NA	NA	NA	NA
WP_011408305.1\|1646779_1648177_-	S-methylmethionine permease	NA	NA	NA	NA
WP_011408304.1\|1648447_1649506_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_011408302.1\|1650269_1650719_+	DUF2147 domain-containing protein	NA	NA	NA	NA
WP_011258663.1\|1650943_1653028_+\|tRNA	methionine--tRNA ligase	NA	NA	NA	NA
WP_041182084.1\|1653235_1653832_+	HAD family hydrolase	NA	NA	NA	NA
WP_011408301.1\|1653833_1654262_+	Rnf electron transport complex subunit RnfB	NA	NA	NA	NA
WP_042464748.1\|1654880_1655663_+	hypothetical protein	NA	NA	NA	NA
WP_012445216.1\|1655748_1656117_+	hypothetical protein	NA	NA	NA	NA
WP_011258659.1\|1656175_1656739_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_011258658.1\|1656723_1657569_+	hypothetical protein	NA	NA	NA	NA
WP_011408297.1\|1657794_1658793_+	acyl-CoA desaturase	G4YAW5	Emiliania_huxleyi_virus	2.3e-18	30.6
WP_069970106.1\|1658789_1660040_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_094187733.1\|1659964_1660924_+	DUF1365 domain-containing protein	NA	NA	NA	NA
WP_011258655.1\|1660920_1662216_+	class I SAM-dependent methyltransferase	A0A2I2L5L3	Orpheovirus	3.9e-39	32.4
WP_011408293.1\|1662212_1662758_+	DUF2878 domain-containing protein	NA	NA	NA	NA
WP_011408292.1\|1662754_1663537_+	DUF1295 domain-containing protein	NA	NA	NA	NA
WP_012445221.1\|1663554_1664625_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011408290.1\|1664786_1665134_-	RidA family protein	NA	NA	NA	NA
WP_069964915.1\|1666114_1668679_+	bifunctional lysylphosphatidylglycerol flippase/synthetase MprF	NA	NA	NA	NA
WP_109181916.1\|1669070_1669832_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011408285.1\|1670117_1671488_-	virulence factor family protein	NA	NA	NA	NA
WP_011258646.1\|1671557_1671752_-	hypothetical protein	NA	NA	NA	NA
WP_011258645.1\|1671811_1672420_-	hypothetical protein	NA	NA	NA	NA
WP_011408284.1\|1672455_1673058_-	RNA 2',3'-cyclic phosphodiesterase	NA	NA	NA	NA
WP_011258643.1\|1673331_1673787_-	PA2169 family four-helix-bundle protein	NA	NA	NA	NA
WP_103057306.1\|1675377_1675539_-	hypothetical protein	NA	NA	NA	NA
WP_011258642.1\|1675709_1676921_-	MFS transporter	NA	NA	NA	NA
WP_011408282.1\|1677141_1678260_+	alkene reductase	NA	NA	NA	NA
WP_075239156.1\|1679150_1679441_+	hypothetical protein	NA	NA	NA	NA
WP_011408280.1\|1679729_1680065_-	alkylphosphonate utilization protein	NA	NA	NA	NA
WP_011408279.1\|1680179_1681229_+	cation transporter	NA	NA	NA	NA
WP_011408277.1\|1682900_1683374_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_069970107.1\|1683513_1684890_+	Hsp70 family protein	NA	NA	NA	NA
WP_011258635.1\|1685079_1685265_+	hypothetical protein	NA	NA	NA	NA
WP_155296482.1\|1685655_1686975_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_069970109.1\|1687063_1688278_-\|transposase	IS4 family transposase	A0A0F7LAS3	uncultured_marine_virus	2.4e-54	33.4
WP_041182418.1\|1688462_1689029_+	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_011258631.1\|1689219_1689486_-	DksA/TraR family C4-type zinc finger protein	A0A193GYU8	Escherichia_phage	1.5e-17	54.5
WP_011258630.1\|1689660_1689915_+	DUF2789 domain-containing protein	NA	NA	NA	NA
WP_011258629.1\|1690075_1690249_-	DUF1328 domain-containing protein	NA	NA	NA	NA
WP_041182081.1\|1690650_1691178_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_011258627.1\|1691644_1692745_+	Glu/Leu/Phe/Val dehydrogenase	NA	NA	NA	NA
WP_069964917.1\|1692805_1695634_-\|protease	autotransporter serine protease	A0A1V0SBG2	Catovirus	3.9e-07	25.2
WP_011408270.1\|1695789_1696965_+	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_011408269.1\|1697087_1697432_+	hypothetical protein	NA	NA	NA	NA
WP_011258624.1\|1697661_1697988_+	hypothetical protein	NA	NA	NA	NA
WP_011408268.1\|1698096_1699806_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.1e-16	37.5
WP_011408267.1\|1699903_1700494_+	cell shape determination protein CcmA	NA	NA	NA	NA
WP_011258621.1\|1700490_1700856_+	hypothetical protein	NA	NA	NA	NA
WP_011408265.1\|1701192_1702215_+	ligase-associated DNA damage response exonuclease	NA	NA	NA	NA
WP_011258619.1\|1702211_1702445_+	hypothetical protein	NA	NA	NA	NA
WP_069970110.1\|1702441_1704046_+	ATP-dependent DNA ligase	A0A068CDF3	Rhizobium_phage	6.4e-15	36.6
WP_069970111.1\|1704042_1706544_+	ligase-associated DNA damage response DEXH box helicase	NA	NA	NA	NA
WP_069970112.1\|1706533_1707178_+	ligase-associated DNA damage response endonuclease PdeM	NA	NA	NA	NA
WP_003488188.1\|1708688_1708895_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	9.3e-20	70.1
WP_011408258.1\|1708981_1709734_-	S-methyl-5'-thioinosine phosphorylase	NA	NA	NA	NA
WP_011408257.1\|1709819_1710374_-	hypoxanthine-guanine phosphoribosyltransferase	NA	NA	NA	NA
WP_011408256.1\|1710373_1711378_-	beta-N-acetylhexosaminidase	NA	NA	NA	NA
WP_011408255.1\|1711495_1713073_-	cryptochrome/photolyase family protein	A0A1V0SE91	Indivirus	2.2e-44	25.6
WP_011408254.1\|1713253_1714288_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_041182416.1\|1714304_1714988_-	DsbA family oxidoreductase	NA	NA	NA	NA
WP_011408252.1\|1715107_1716484_-\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	8.3e-80	56.9
WP_011257310.1\|1716712_1717948_+\|transposase	ISL3-like element ISXoo13 family transposase	NA	NA	NA	NA

DBSCAN-SWA_12

1836442 : 1902295

Bacillus_phage(20.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011408191.1\|1836442_1837678_+\|transposase	ISL3-like element ISXoo13 family transposase	NA	NA	NA	NA
WP_011258521.1\|1838177_1839281_+	exo-alpha-sialidase	NA	NA	NA	NA
WP_011408189.1\|1839422_1841381_+	hypothetical protein	NA	NA	NA	NA
WP_011258519.1\|1841405_1842137_-	copper homeostasis protein CutC	NA	NA	NA	NA
WP_011258518.1\|1842133_1843198_-	N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase	NA	NA	NA	NA
WP_011408185.1\|1847819_1848902_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_011258513.1\|1848913_1849537_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011258512.1\|1849787_1850264_-	chemotaxis protein CheW	NA	NA	NA	NA
WP_011408184.1\|1850297_1851500_-	hypothetical protein	NA	NA	NA	NA
WP_069959811.1\|1851507_1858434_-	response regulator	W8CYM9	Bacillus_phage	2.9e-11	31.1
WP_011258510.1\|1858547_1860584_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.1e-23	42.1
WP_003482487.1\|1860623_1861154_-	hypothetical protein	NA	NA	NA	NA
WP_011258508.1\|1861153_1861516_-	response regulator	A0A220YL79	Alteromonas_virus	9.0e-10	26.8
WP_005913706.1\|1861533_1861935_-	response regulator	NA	NA	NA	NA
WP_044756943.1\|1862184_1863135_+	glutathione synthase	NA	NA	NA	NA
WP_011258506.1\|1863131_1864007_+	energy transducer TonB	NA	NA	NA	NA
WP_011258505.1\|1864301_1865216_-	ADP-ribosylglycohydrolase family protein	A0A1S6UB21	Serratia_phage	1.2e-63	48.5
WP_011408180.1\|1865212_1865932_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_011408179.1\|1865945_1867973_-	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	4.6e-95	33.2
WP_011408178.1\|1868172_1868697_-	hypothetical protein	NA	NA	NA	NA
WP_069959810.1\|1868710_1871155_-	penicillin-binding protein 1B	NA	NA	NA	NA
WP_044756949.1\|1871396_1873499_+	glycosyltransferase	NA	NA	NA	NA
WP_042465507.1\|1873831_1875274_-	hypothetical protein	NA	NA	NA	NA
WP_042464698.1\|1875563_1877750_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	NA	NA	NA	NA
WP_002812057.1\|1878039_1878120_+	pyrroloquinoline quinone precursor peptide PqqA	NA	NA	NA	NA
WP_011258497.1\|1878203_1879103_+	pyrroloquinoline quinone biosynthesis protein PqqB	NA	NA	NA	NA
WP_011408174.1\|1879099_1879852_+	pyrroloquinoline-quinone synthase PqqC	NA	NA	NA	NA
WP_011408173.1\|1879848_1880127_+	pyrroloquinoline quinone biosynthesis peptide chaperone PqqD	NA	NA	NA	NA
WP_011408172.1\|1880123_1881242_+	pyrroloquinoline quinone biosynthesis protein PqqE	NA	NA	NA	NA
WP_011408171.1\|1881304_1881817_+	hypothetical protein	NA	NA	NA	NA
WP_094187782.1\|1882127_1882891_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_041182063.1\|1883061_1884576_+	PhoPQ-regulated protein	NA	NA	NA	NA
WP_011408167.1\|1886017_1888660_+	TonB-dependent receptor	NA	NA	NA	NA
WP_069970116.1\|1888880_1893002_-	ATP-dependent RNA helicase HrpA	A0A1V0SDF7	Indivirus	5.6e-47	28.5
WP_011408166.1\|1893103_1893649_+	DNA starvation/stationary phase protection protein	A0A2H4N7L5	Lake_Baikal_phage	1.5e-16	32.4
WP_069959808.1\|1894203_1896000_+	DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	2.6e-81	35.3
WP_011408165.1\|1896138_1896636_+	hypothetical protein	NA	NA	NA	NA
WP_011408164.1\|1896714_1897119_+	response regulator	NA	NA	NA	NA
WP_008578058.1\|1897749_1898424_-	7-cyano-7-deazaguanine synthase QueC	A0A088F6S9	Vibrio_phage	6.4e-25	34.7
WP_069959795.1\|1898802_1900179_+\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	1.1e-58	47.0
WP_094187715.1\|1900245_1901008_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011257310.1\|1901059_1902295_-\|transposase	ISL3-like element ISXoo13 family transposase	NA	NA	NA	NA

DBSCAN-SWA_13

1963599 : 2110362

114

Staphylococcus_prophage(12.5%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011258399.1\|1963599_1966431_-\|tRNA	isoleucine--tRNA ligase	A0A1V0SGW1	Hokovirus	4.1e-41	22.2
WP_011408095.1\|1966437_1967454_-	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_094187736.1\|1967579_1968343_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011408094.1\|1968468_1970073_-	murein biosynthesis integral membrane protein MurJ	NA	NA	NA	NA
WP_003484323.1\|1970189_1970459_+	30S ribosomal protein S20	NA	NA	NA	NA
WP_011258396.1\|1970550_1971603_-	GTPase ObgE	NA	NA	NA	NA
WP_011258395.1\|1971835_1972096_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_011258394.1\|1972108_1972429_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_012444462.1\|1972721_1975688_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	3.3e-307	55.8
WP_075240114.1\|1975684_1976092_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_011258392.1\|1976205_1976670_-	copper chaperone PCu(A)C	NA	NA	NA	NA
WP_011408091.1\|1976693_1977464_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_011408090.1\|1977534_1978440_+	acyl-CoA thioesterase II	NA	NA	NA	NA
WP_011408089.1\|1978667_1979171_+	hypothetical protein	NA	NA	NA	NA
WP_011408088.1\|1979282_1980026_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_041182403.1\|1980280_1980736_+	hypothetical protein	NA	NA	NA	NA
WP_109181906.1\|1980880_1981679_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011408086.1\|1981721_1982303_-	hypothetical protein	NA	NA	NA	NA
WP_042464672.1\|1982363_1983278_+	arginyltransferase	NA	NA	NA	NA
WP_027703288.1\|1983231_1984563_+	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_011258382.1\|1984867_1986469_-	membrane protein	NA	NA	NA	NA
WP_027703287.1\|1986914_1987991_+	aldose 1-epimerase family protein	NA	NA	NA	NA
WP_011408082.1\|1988086_1988560_-	DUF3574 domain-containing protein	NA	NA	NA	NA
WP_011408081.1\|1988795_1991231_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	2.6e-12	22.5
WP_069964514.1\|1992587_1993310_+	trehalose-phosphatase	NA	NA	NA	NA
WP_011408078.1\|1993354_1995133_+	glycoside hydrolase family 15 protein	NA	NA	NA	NA
WP_011258376.1\|1995129_1996497_+	alpha,alpha-trehalose-phosphate synthase (UDP-forming)	NA	NA	NA	NA
WP_011258374.1\|1996746_1997127_-	DUF393 domain-containing protein	NA	NA	NA	NA
WP_011258373.1\|1997101_1997608_-	DUF4166 domain-containing protein	NA	NA	NA	NA
WP_011258372.1\|1997628_1998435_-	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_011408077.1\|1998442_1999438_-	23S rRNA pseudouridine(1911/1915/1917) synthase RluD	NA	NA	NA	NA
WP_011258370.1\|1999558_2000440_+	outer membrane protein assembly factor BamD	NA	NA	NA	NA
WP_011258369.1\|2000597_2002256_-	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	1.2e-93	38.0
WP_011408075.1\|2002684_2002981_-	hypothetical protein	NA	NA	NA	NA
WP_011258368.1\|2003300_2004176_-	succinate--CoA ligase subunit alpha	NA	NA	NA	NA
WP_011258367.1\|2004200_2005370_-	ADP-forming succinate--CoA ligase subunit beta	NA	NA	NA	NA
WP_012444444.1\|2005603_2007217_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_033013168.1\|2007547_2008939_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_027703281.1\|2009011_2009218_+	DUF2559 family protein	NA	NA	NA	NA
WP_011408072.1\|2009797_2011531_-	type IV-A pilus assembly ATPase PilB	NA	NA	NA	NA
WP_069970117.1\|2013060_2013720_-	hypothetical protein	NA	NA	NA	NA
WP_069970118.1\|2013700_2015290_-	phosphoethanolamine transferase	NA	NA	NA	NA
WP_011408068.1\|2015424_2015850_-	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_069970182.1\|2016204_2017464_+	type II secretion system F family protein	NA	NA	NA	NA
WP_069970119.1\|2017470_2018334_+	prepilin peptidase	NA	NA	NA	NA
WP_011258357.1\|2018347_2018956_+	dephospho-CoA kinase	NA	NA	NA	NA
WP_155296483.1\|2019026_2020346_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_082323380.1\|2020906_2021314_-	hypothetical protein	NA	NA	NA	NA
WP_041182041.1\|2021192_2022149_-\|transposase	IS30-like element IS1112a family transposase	Q9MBM9	Staphylococcus_prophage	1.1e-41	34.9
WP_011257031.1\|2022840_2023809_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	4.3e-99	60.0
WP_011408064.1\|2023978_2024347_-	hypothetical protein	NA	NA	NA	NA
WP_125168748.1\|2025862_2026192_-	hypothetical protein	NA	NA	NA	NA
WP_125168747.1\|2026188_2026488_-	hypothetical protein	NA	NA	NA	NA
WP_011258803.1\|2026636_2027605_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	1.5e-99	60.0
WP_155296484.1\|2027656_2028211_-	hypothetical protein	NA	NA	NA	NA
WP_069959761.1\|2028227_2029463_+\|transposase	ISL3-like element ISXoo13 family transposase	NA	NA	NA	NA
WP_109181904.1\|2035251_2036571_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_094187715.1\|2036613_2037376_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_069959790.1\|2037452_2039285_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.2e-30	27.3
WP_069960188.1\|2039416_2040007_-	plasmid pRiA4b ORF-3 family protein	NA	NA	NA	NA
WP_044756980.1\|2040072_2043129_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_011258341.1\|2043125_2044229_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_011258340.1\|2044254_2045091_-	MipA/OmpV family protein	NA	NA	NA	NA
WP_011408057.1\|2046685_2047375_+	response regulator transcription factor	Q6XM27	Feldmannia_irregularis_virus	3.6e-07	28.3
WP_011408056.1\|2047371_2048565_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	5.2e-22	23.9
WP_011258336.1\|2048623_2049889_-	potassium transporter	NA	NA	NA	NA
WP_059317475.1\|2050035_2051712_-	serine hydrolase	NA	NA	NA	NA
WP_059317476.1\|2051653_2052154_-	RraA family protein	NA	NA	NA	NA
WP_069959788.1\|2053969_2054917_+	DMT family transporter	NA	NA	NA	NA
WP_059317478.1\|2055104_2055827_-	pseudouridine synthase	NA	NA	NA	NA
WP_012444418.1\|2055976_2058373_-	EAL domain-containing protein	G3MA91	Bacillus_virus	3.8e-11	30.2
WP_011258329.1\|2058636_2060541_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.5e-58	35.7
WP_069970183.1\|2061216_2061867_+	hypothetical protein	NA	NA	NA	NA
WP_011258326.1\|2061903_2062146_+	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_011258325.1\|2062494_2062896_-	membrane protein	NA	NA	NA	NA
WP_027704130.1\|2062921_2063455_-	DUF4019 domain-containing protein	NA	NA	NA	NA
WP_011258323.1\|2063857_2064112_-	hypothetical protein	NA	NA	NA	NA
WP_069959787.1\|2065574_2067038_+	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_012444410.1\|2067034_2067580_+	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A1S5V092	Saudi_moumouvirus	4.1e-14	51.9
WP_027704131.1\|2067836_2069135_+	alkaline phosphatase family protein	NA	NA	NA	NA
WP_011258317.1\|2069261_2070707_+	chloride channel protein	A0A1X9I5Z9	Streptococcus_phage	4.9e-14	31.5
WP_011258316.1\|2070779_2071820_+	zinc-dependent alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_011408042.1\|2071952_2072135_-	30S ribosomal protein THX	NA	NA	NA	NA
WP_011258314.1\|2072434_2072845_-	MerC domain-containing protein	NA	NA	NA	NA
WP_069970120.1\|2075472_2077854_+	TonB-dependent receptor plug domain-containing protein	NA	NA	NA	NA
WP_059317479.1\|2078080_2079052_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-32	34.5
WP_094187725.1\|2079103_2079514_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_011258309.1\|2079612_2080338_-	OmpA family protein	G3M9Z0	Bacillus_virus	1.4e-09	33.9
WP_011258308.1\|2080754_2082209_-	deoxyribodipyrimidine photo-lyase	A0A1V0S949	Catovirus	5.7e-47	31.7
WP_011408037.1\|2082275_2083706_-	replicative DNA helicase	O80281	Escherichia_phage	8.5e-120	53.4
WP_011258306.1\|2083927_2084482_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	1.1e-19	35.3
WP_011258305.1\|2084698_2086639_-	asparagine synthase (glutamine-hydrolyzing)	A0A1B1ISV2	uncultured_Mediterranean_phage	4.4e-26	30.5
WP_027704133.1\|2086814_2087453_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_033013599.1\|2089686_2090850_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_011408033.1\|2091007_2091799_-	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_011258299.1\|2091944_2092160_+	hypothetical protein	NA	NA	NA	NA
WP_011408032.1\|2092159_2092927_+	TatD family hydrolase	NA	NA	NA	NA
WP_011258297.1\|2092988_2093819_-\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	NA	NA	NA	NA
WP_011408031.1\|2093891_2094320_+	hypothetical protein	NA	NA	NA	NA
WP_011408030.1\|2094451_2094931_+	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_011258294.1\|2095181_2095397_-	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	6.5e-16	59.7
WP_011258293.1\|2095624_2096110_+	DUF456 domain-containing protein	NA	NA	NA	NA
WP_011258291.1\|2097671_2097875_-	hypothetical protein	NA	NA	NA	NA
WP_011408025.1\|2098652_2099111_-	cupin domain-containing protein	NA	NA	NA	NA
WP_011408024.1\|2099516_2100023_-	Fur family transcriptional regulator	NA	NA	NA	NA
WP_011258289.1\|2100036_2101440_-\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_075242217.1\|2102637_2103369_-	nitrilase	NA	NA	NA	NA
WP_011407237.1\|2103442_2104399_+\|transposase	IS30-like element IS1112a family transposase	Q9MBM9	Staphylococcus_prophage	2.1e-42	35.2
WP_011408021.1\|2104575_2105163_-	GNAT family acetyltransferase	NA	NA	NA	NA
WP_011408020.1\|2105393_2106206_+	C1 family peptidase	NA	NA	NA	NA
WP_011408019.1\|2106236_2107400_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	2.6e-98	61.2
WP_011408018.1\|2107531_2107915_-	membrane protein	NA	NA	NA	NA
WP_011408017.1\|2108430_2109243_+	C1 family peptidase	NA	NA	NA	NA
WP_011408016.1\|2109303_2110362_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.1e-71	42.6

DBSCAN-SWA_14

2331319 : 2476300

107

Xanthomonas_phage(40.74%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069959761.1\|2331319_2332555_+\|transposase	ISL3-like element ISXoo13 family transposase	NA	NA	NA	NA
WP_011258091.1\|2332976_2334365_-	amino acid permease	NA	NA	NA	NA
WP_011258090.1\|2335120_2336062_-	proline iminopeptidase-family hydrolase	NA	NA	NA	NA
WP_011407882.1\|2336375_2337140_-	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_011407881.1\|2337332_2338715_+	APC family permease	NA	NA	NA	NA
WP_011407879.1\|2339169_2340567_+	trypsin-like peptidase domain-containing protein	NA	NA	NA	NA
WP_011407877.1\|2341129_2341528_+	hypothetical protein	NA	NA	NA	NA
WP_011258085.1\|2341672_2342677_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_069959760.1\|2342714_2344232_-	tryptophan 7-halogenase	A0A1D7SEI2	Cyanophage	4.7e-52	32.5
WP_044757048.1\|2344272_2345319_-	cupin-like domain-containing protein	NA	NA	NA	NA
WP_011407875.1\|2345329_2346082_-	SapC family protein	NA	NA	NA	NA
WP_094187791.1\|2346413_2349560_-	TonB-dependent receptor	NA	NA	NA	NA
WP_069959759.1\|2350618_2352625_-	M1 family metallopeptidase	NA	NA	NA	NA
WP_011258079.1\|2352844_2353291_-	redox-sensitive transcriptional activator SoxR	NA	NA	NA	NA
WP_069959758.1\|2355282_2356449_-	glutathionylspermidine synthase family protein	B2ZXR7	Ralstonia_phage	3.4e-74	42.1
WP_011258076.1\|2356450_2357023_-	DUF1190 domain-containing protein	A0A191ZBZ0	Erwinia_phage	1.1e-09	27.7
WP_011407869.1\|2357035_2357440_-	DUF350 domain-containing protein	NA	NA	NA	NA
WP_011407868.1\|2357477_2358149_-	YjfK family protein	NA	NA	NA	NA
WP_011407867.1\|2358151_2359234_-	potassium channel protein	NA	NA	NA	NA
WP_011258072.1\|2359259_2360033_-	PspA/IM30 family protein	NA	NA	NA	NA
WP_012445807.1\|2360045_2360462_-	YjfI family protein	NA	NA	NA	NA
WP_011258070.1\|2360642_2361242_-	pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
WP_011258069.1\|2361408_2361951_+	shikimate kinase	NA	NA	NA	NA
WP_011258068.1\|2361947_2363060_+	3-dehydroquinate synthase	NA	NA	NA	NA
WP_011407864.1\|2363361_2363613_+	WGR domain-containing protein	NA	NA	NA	NA
WP_011258066.1\|2363627_2364692_+	uroporphyrinogen decarboxylase	NA	NA	NA	NA
WP_069959757.1\|2366163_2369880_+	avirulence protein	NA	NA	NA	NA
WP_011258059.1\|2370148_2370343_+	hypothetical protein	A0A1W6DXV7	Xanthomonas_phage	3.9e-20	94.1
WP_011408408.1\|2370346_2370646_+	hypothetical protein	A0A1W6DY99	Xanthomonas_phage	6.4e-46	92.4
WP_069960173.1\|2370869_2375294_+	avirulence protein	NA	NA	NA	NA
WP_153296744.1\|2375349_2375496_+	hypothetical protein	Q38057	Xanthomonas_phage	6.4e-07	78.4
WP_041182100.1\|2375562_2375757_+	hypothetical protein	A0A1W6DXV7	Xanthomonas_phage	2.5e-19	80.6
WP_041182759.1\|2375760_2376060_+	hypothetical protein	A0A1W6DY99	Xanthomonas_phage	9.3e-45	91.3
WP_041182100.1\|2379823_2380018_+	hypothetical protein	A0A1W6DXV7	Xanthomonas_phage	2.5e-19	80.6
WP_125168752.1\|2382305_2382629_+	hypothetical protein	NA	NA	NA	NA
WP_011408516.1\|2383242_2383755_-	hypothetical protein	NA	NA	NA	NA
WP_109181945.1\|2383885_2384648_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_082323370.1\|2385869_2389667_+	avirulence protein	NA	NA	NA	NA
WP_012444931.1\|2389935_2390130_+	hypothetical protein	A0A1W6DXV7	Xanthomonas_phage	1.3e-18	79.0
WP_011408491.1\|2390133_2390433_+	hypothetical protein	A0A1W6DY99	Xanthomonas_phage	1.9e-45	91.3
WP_069970122.1\|2390656_2394412_+	avirulence protein	NA	NA	NA	NA
WP_109181946.1\|2394501_2395264_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_153296744.1\|2395283_2395430_+	hypothetical protein	Q38057	Xanthomonas_phage	6.4e-07	78.4
WP_042464821.1\|2395495_2395690_+	hypothetical protein	A0A1W6DXV7	Xanthomonas_phage	3.9e-20	82.3
WP_011408491.1\|2395693_2395993_+	hypothetical protein	A0A1W6DY99	Xanthomonas_phage	1.9e-45	91.3
WP_069959856.1\|2396217_2400234_+	avirulence protein	NA	NA	NA	NA
WP_011258057.1\|2400407_2400629_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_082323384.1\|2400625_2401183_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	7.9e-21	40.0
WP_125168753.1\|2402328_2402574_-	hypothetical protein	NA	NA	NA	NA
WP_069970123.1\|2402557_2403514_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	3.7e-42	36.0
WP_011257031.1\|2403928_2404897_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	4.3e-99	60.0
WP_041182129.1\|2405041_2406007_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_041182130.1\|2405984_2410085_-	RHS repeat protein	NA	NA	NA	NA
WP_011408397.1\|2410393_2411578_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	5.0e-41	44.8
WP_041182131.1\|2411628_2412528_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	2.8e-36	35.1
WP_011408524.1\|2412694_2413201_+	glyoxalase	NA	NA	NA	NA
WP_011258968.1\|2413675_2414308_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_011258969.1\|2414307_2416164_-	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_011408525.1\|2416160_2417660_-	hypothetical protein	NA	NA	NA	NA
WP_011258971.1\|2417602_2418067_-	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
WP_069960087.1\|2418063_2418864_-	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
WP_011258973.1\|2419133_2420174_-	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
WP_011258974.1\|2420170_2421940_-	lipid A export permease/ATP-binding protein MsbA	W8CYL7	Bacillus_phage	9.4e-52	28.0
WP_011258975.1\|2421936_2422401_-	biopolymer transporter ExbD	NA	NA	NA	NA
WP_011408526.1\|2422404_2423067_-	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
WP_011408527.1\|2423095_2425504_-	DNA internalization-related competence protein ComEC/Rec2	NA	NA	NA	NA
WP_109181948.1\|2425757_2426723_+\|transposase	IS1595-like element ISXo5 family transposase	NA	NA	NA	NA
WP_011258980.1\|2428116_2428851_-	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	1.0e-31	34.5
WP_010378794.1\|2428843_2430085_-	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_014503500.1\|2430108_2430561_-	hypothetical protein	NA	NA	NA	NA
WP_011408531.1\|2430511_2430760_-	succinate dehydrogenase assembly factor 2	NA	NA	NA	NA
WP_011408532.1\|2430870_2431653_-	succinate dehydrogenase iron-sulfur subunit	NA	NA	NA	NA
WP_012444910.1\|2431669_2431879_-	hypothetical protein	NA	NA	NA	NA
WP_011258983.1\|2431882_2433673_-	succinate dehydrogenase flavoprotein subunit	NA	NA	NA	NA
WP_011258984.1\|2433707_2434094_-	succinate dehydrogenase, hydrophobic membrane anchor protein	NA	NA	NA	NA
WP_011258985.1\|2434090_2434486_-	succinate dehydrogenase, cytochrome b556 subunit	NA	NA	NA	NA
WP_012444907.1\|2434545_2434812_-	DUF1674 domain-containing protein	NA	NA	NA	NA
WP_011408533.1\|2434755_2435628_+	folate-binding protein YgfZ	NA	NA	NA	NA
WP_011258986.1\|2435756_2436854_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	2.2e-22	30.1
WP_011408534.1\|2437290_2438721_+	glucose-6-phosphate dehydrogenase	A0A222YYZ2	Synechococcus_phage	2.2e-67	34.5
WP_011258988.1\|2438717_2439725_+	glucokinase	NA	NA	NA	NA
WP_011258989.1\|2439721_2440441_+	6-phosphogluconolactonase	NA	NA	NA	NA
WP_011258990.1\|2440543_2442460_+	phosphogluconate dehydratase	NA	NA	NA	NA
WP_011408535.1\|2442515_2443175_+	bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_027703995.1\|2444801_2445005_-	hypothetical protein	NA	NA	NA	NA
WP_011258994.1\|2446020_2446401_+	response regulator	NA	NA	NA	NA
WP_011408539.1\|2446615_2450011_+	PAS domain S-box protein	A0A1V0SGX0	Hokovirus	2.9e-25	27.8
WP_094187715.1\|2451576_2452339_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011408544.1\|2454234_2454468_-	hypothetical protein	NA	NA	NA	NA
WP_011259000.1\|2454634_2455609_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.0e-19	39.6
WP_069960088.1\|2456372_2457254_-	hypothetical protein	NA	NA	NA	NA
WP_011408549.1\|2458954_2460088_+	phospholipase A	NA	NA	NA	NA
WP_011408550.1\|2460516_2460969_-	glutathione S-transferase	NA	NA	NA	NA
WP_125168754.1\|2460656_2461151_-	hypothetical protein	NA	NA	NA	NA
WP_011259006.1\|2461287_2462805_-	fumarate hydratase	NA	NA	NA	NA
WP_012444869.1\|2463138_2465019_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.3e-24	38.0
WP_011408551.1\|2465207_2465987_+	ferredoxin--NADP reductase	NA	NA	NA	NA
WP_011259009.1\|2466137_2466623_-	glutathione peroxidase	A0A1S7DM81	Molluscum_contagiosum_virus	2.8e-14	36.2
WP_027703343.1\|2469079_2469319_-	HTH domain-containing protein	NA	NA	NA	NA
WP_069959861.1\|2469570_2470284_-	hypothetical protein	NA	NA	NA	NA
WP_011259013.1\|2471808_2472309_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_044757420.1\|2472470_2473049_+	hypothetical protein	NA	NA	NA	NA
WP_011259015.1\|2473140_2473641_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_011259016.1\|2473707_2474541_-	hypothetical protein	NA	NA	NA	NA
WP_011408556.1\|2474591_2474906_-	N-acetyltransferase	NA	NA	NA	NA
WP_011259018.1\|2475089_2475278_+	hypothetical protein	NA	NA	NA	NA
WP_011408557.1\|2475691_2476300_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA

DBSCAN-SWA_15

2565339 : 2613435

Moumouvirus(16.67%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011408598.1\|2565339_2566734_+\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	7.6e-81	39.5
WP_011259080.1\|2566735_2566993_+	hypothetical protein	NA	NA	NA	NA
WP_011408599.1\|2566989_2567295_+	hypothetical protein	NA	NA	NA	NA
WP_011408600.1\|2567291_2567618_+	hypothetical protein	NA	NA	NA	NA
WP_011408603.1\|2568344_2569007_+	carbonate dehydratase	NA	NA	NA	NA
WP_024744799.1\|2569095_2569626_+	3-hydroxyanthranilate 3,4-dioxygenase	NA	NA	NA	NA
WP_011408606.1\|2571849_2573121_+	kynureninase	NA	NA	NA	NA
WP_011408607.1\|2573292_2574660_+	FAD-dependent monooxygenase	NA	NA	NA	NA
WP_011259089.1\|2574963_2576409_+	exodeoxyribonuclease I	NA	NA	NA	NA
WP_011259090.1\|2576405_2577092_+	DUF2461 domain-containing protein	NA	NA	NA	NA
WP_011259091.1\|2577064_2578084_+	aldo/keto reductase	NA	NA	NA	NA
WP_011259092.1\|2578125_2578686_+	DUF2939 domain-containing protein	NA	NA	NA	NA
WP_011259093.1\|2578706_2579663_-	5'-nucleotidase	NA	NA	NA	NA
WP_011408609.1\|2579830_2580607_-	NAD kinase	NA	NA	NA	NA
WP_069970124.1\|2581090_2583226_-	bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL	NA	NA	NA	NA
WP_027703372.1\|2583222_2583414_-	hypothetical protein	NA	NA	NA	NA
WP_011259098.1\|2585188_2585695_-	N-acetyltransferase	NA	NA	NA	NA
WP_011259099.1\|2585735_2586263_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_011408612.1\|2586259_2586751_-	MOSC domain-containing protein	NA	NA	NA	NA
WP_011408613.1\|2586774_2587350_+	N-acetylmuramoyl-L-alanine amidase	NA	NA	NA	NA
WP_011259101.1\|2587426_2588380_-	DUF1684 domain-containing protein	NA	NA	NA	NA
WP_011259102.1\|2588468_2589341_-	sulfurtransferase	NA	NA	NA	NA
WP_103057219.1\|2589337_2590105_-	CoA pyrophosphatase	NA	NA	NA	NA
WP_011408617.1\|2590295_2590994_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_011408618.1\|2591157_2591940_+	enoyl-CoA hydratase	NA	NA	NA	NA
WP_011408619.1\|2591948_2592329_+	hypothetical protein	NA	NA	NA	NA
WP_011259107.1\|2592325_2593036_+	endonuclease III	NA	NA	NA	NA
WP_011408621.1\|2594346_2594895_-	carbonate dehydratase	NA	NA	NA	NA
WP_069970125.1\|2595066_2596035_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	1.5e-99	60.0
WP_011408623.1\|2596639_2597875_+\|transposase	ISL3-like element ISXoo13 family transposase	NA	NA	NA	NA
WP_041182144.1\|2598438_2598759_-	hypothetical protein	NA	NA	NA	NA
WP_011259109.1\|2599098_2600349_+	porin	NA	NA	NA	NA
WP_103057309.1\|2600483_2601557_+	phosphate ABC transporter substrate-binding protein PstS	M4SNR3	Cyanophage	5.0e-48	38.4
WP_011408626.1\|2601744_2602836_+	phosphate ABC transporter substrate-binding protein PstS	E3SKK5	Synechococcus_phage	1.1e-47	39.7
WP_069959864.1\|2602948_2603923_+	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_069959865.1\|2603922_2604792_+	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_011259114.1\|2604814_2605645_+	phosphate ABC transporter ATP-binding protein PstB	W8CYL7	Bacillus_phage	5.5e-18	32.6
WP_011408630.1\|2605773_2606484_+	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_011259116.1\|2606616_2607024_+	RcnB family protein	NA	NA	NA	NA
WP_094187739.1\|2607301_2607943_+	ribonuclease T	NA	NA	NA	NA
WP_011408631.1\|2608013_2609333_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_042464912.1\|2609569_2610631_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011408397.1\|2610681_2611866_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	5.0e-41	44.8
WP_109181954.1\|2612115_2613435_+\|transposase	IS701 family transposase	NA	NA	NA	NA

DBSCAN-SWA_16

2620154 : 2691265

uncultured_Mediterranean_phage(35.71%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011259125.1\|2620154_2621300_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	2.2e-86	46.2
WP_027703908.1\|2621369_2622440_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_011259127.1\|2622605_2623037_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_011259128.1\|2623160_2624657_+	aminotransferase class III-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_011259129.1\|2625001_2625709_-	hypothetical protein	NA	NA	NA	NA
WP_011259140.1\|2629049_2630171_-	phytase	NA	NA	NA	NA
WP_103057211.1\|2632443_2632869_-	TonB-dependent receptor plug domain-containing protein	NA	NA	NA	NA
WP_011259142.1\|2633061_2633694_+	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_094187715.1\|2634090_2634853_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011259143.1\|2635133_2636165_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_011408648.1\|2636171_2637965_-	gamma-glutamyltransferase	NA	NA	NA	NA
WP_012444765.1\|2637961_2638246_-	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	1.4e-18	57.0
WP_011408650.1\|2638477_2638963_-	hypothetical protein	NA	NA	NA	NA
WP_011259147.1\|2639021_2639528_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	4.8e-25	41.1
WP_011259148.1\|2639524_2640145_-	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_011408651.1\|2640385_2642290_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	1.0e-112	36.8
WP_109181955.1\|2642377_2643435_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_109181956.1\|2643532_2644852_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_075239722.1\|2645085_2646243_+	molybdopterin-synthase adenylyltransferase MoeB	NA	NA	NA	NA
WP_109181957.1\|2646519_2647485_+\|transposase	IS1595-like element ISXo5 family transposase	NA	NA	NA	NA
WP_109181958.1\|2647462_2648938_-\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	1.2e-76	54.8
WP_011257031.1\|2651477_2652446_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	4.3e-99	60.0
WP_075243670.1\|2652713_2652953_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011259163.1\|2654827_2656048_-	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_011259164.1\|2656362_2657760_-	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_011259165.1\|2657770_2658991_-	outer membrane protein assembly factor BamB	NA	NA	NA	NA
WP_011259166.1\|2658987_2659626_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_011259167.1\|2659696_2660557_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011408658.1\|2660553_2661342_-	type IV pilus biogenesis/stability protein PilW	NA	NA	NA	NA
WP_011259169.1\|2661352_2662558_-	23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN	NA	NA	NA	NA
WP_002812972.1\|2662576_2663002_-	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	1.1e-19	41.7
WP_011259170.1\|2663221_2663854_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_011259171.1\|2663878_2666251_+	3-hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_011259172.1\|2666408_2667614_+	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_069959870.1\|2667934_2669266_+	voltage-gated chloride channel family protein	A0A1X9I5Z9	Streptococcus_phage	1.1e-41	35.2
WP_011408659.1\|2669262_2669613_+	hypothetical protein	NA	NA	NA	NA
WP_011408660.1\|2669644_2670052_+	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	5.7e-21	49.1
WP_011259175.1\|2670048_2670375_+	hypothetical protein	NA	NA	NA	NA
WP_011259176.1\|2670406_2671783_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	6.8e-74	38.3
WP_011259177.1\|2672019_2676186_+	hypothetical protein	NA	NA	NA	NA
WP_103073501.1\|2676298_2676928_-	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_069960218.1\|2677034_2678963_-	DUF3857 and transglutaminase domain-containing protein	NA	NA	NA	NA
WP_011259180.1\|2679125_2681486_-	DNA translocase FtsK	G1D482	Mycobacterium_virus	2.5e-84	45.8
WP_069959872.1\|2681769_2682738_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	5.9e-64	44.5
WP_011408662.1\|2682795_2683917_+	N-acetyltransferase	NA	NA	NA	NA
WP_042465566.1\|2685344_2686097_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_002813418.1\|2686177_2686396_+	translation initiation factor IF-1	NA	NA	NA	NA
WP_011259186.1\|2686676_2688959_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	8.7e-175	44.6
WP_005914463.1\|2689102_2689423_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	1.0e-12	45.7
WP_011408665.1\|2689673_2690132_+	NUDIX hydrolase	NA	NA	NA	NA
WP_011259189.1\|2690128_2691265_+\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA

DBSCAN-SWA_17

2773003 : 2801640

Ralstonia_phage(80.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011407175.1\|2773003_2773972_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	5.6e-99	59.7
WP_128896930.1\|2774066_2774603_-	DUF3828 domain-containing protein	NA	NA	NA	NA
WP_103073433.1\|2774635_2779471_-	type IV secretion protein Rhs	A0A2H4JFP5	uncultured_Caudovirales_phage	1.4e-09	39.8
WP_011258802.1\|2780806_2781775_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_011257031.1\|2783838_2784807_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	4.3e-99	60.0
WP_128415342.1\|2786431_2786911_-	hypothetical protein	NA	NA	NA	NA
WP_011259260.1\|2795044_2795437_+	c-type cytochrome	NA	NA	NA	NA
WP_011259261.1\|2795445_2795907_+	cytochrome c	NA	NA	NA	NA
WP_153296779.1\|2796327_2796726_+	hypothetical protein	NA	NA	NA	NA
WP_115801893.1\|2798429_2799395_+\|transposase	IS1595-like element ISXo5 family transposase	NA	NA	NA	NA
WP_082323388.1\|2799401_2800547_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_069959881.1\|2800671_2801640_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	9.6e-99	59.7

DBSCAN-SWA_18

2823950 : 2884552

Moumouvirus(10.0%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011259285.1\|2823950_2825381_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.1e-42	34.5
WP_011408724.1\|2825878_2826316_+	SufE family protein	NA	NA	NA	NA
WP_011259287.1\|2826312_2827563_+	MFS transporter	NA	NA	NA	NA
WP_011259288.1\|2827630_2828692_-	S41 family peptidase	NA	NA	NA	NA
WP_075242610.1\|2828834_2829875_-	RNA polymerase-binding protein DksA	NA	NA	NA	NA
WP_024710406.1\|2829965_2830247_+	membrane protein insertion efficiency factor YidD	NA	NA	NA	NA
WP_011408728.1\|2830243_2831593_+	dihydroorotase	NA	NA	NA	NA
WP_094187752.1\|2831532_2832432_+	M23 family metallopeptidase	A0A075BS18	Microcystis_phage	2.6e-13	41.2
WP_094187715.1\|2833330_2834093_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011259294.1\|2834119_2834383_-	hypothetical protein	NA	NA	NA	NA
WP_012444728.1\|2834754_2835243_-	general stress protein	NA	NA	NA	NA
WP_011408734.1\|2835466_2836786_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_011257031.1\|2836922_2837891_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	4.3e-99	60.0
WP_069964543.1\|2838090_2839407_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_012444725.1\|2839766_2840948_+	putative acyl-CoA thioester hydrolase	NA	NA	NA	NA
WP_011259303.1\|2842536_2844207_+	glycoside hydrolase family 28 protein	NA	NA	NA	NA
WP_011259304.1\|2844423_2845113_-	phytoene synthase	NA	NA	NA	NA
WP_011408736.1\|2845141_2845846_-	phosphoglycolate phosphatase	NA	NA	NA	NA
WP_011259306.1\|2845919_2846639_-	bifunctional 3-demethylubiquinone 3-O-methyltransferase/2-octaprenyl-6-hydroxy phenol methylase	NA	NA	NA	NA
WP_011408737.1\|2846669_2848019_-	TRZ/ATZ family hydrolase	NA	NA	NA	NA
WP_099051322.1\|2848026_2848863_-	hypothetical protein	NA	NA	NA	NA
WP_002802373.1\|2849021_2849588_-	elongation factor P	NA	NA	NA	NA
WP_011408738.1\|2849689_2850718_+	EF-P beta-lysylation protein EpmB	NA	NA	NA	NA
WP_011259310.1\|2850936_2853054_-	EAL domain-containing protein	NA	NA	NA	NA
WP_094187831.1\|2853050_2853971_-	phosphate/phosphite/phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011408739.1\|2854031_2854796_-	RNA methyltransferase	NA	NA	NA	NA
WP_011408740.1\|2854914_2855748_+	inositol monophosphatase	NA	NA	NA	NA
WP_011259314.1\|2856000_2856612_-	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	1.1e-79	69.8
WP_011259315.1\|2856866_2857307_+	ribonuclease	NA	NA	NA	NA
WP_011259316.1\|2857303_2857729_+	barstar family protein	NA	NA	NA	NA
WP_027703271.1\|2858177_2860073_-	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	1.8e-48	26.8
WP_069959885.1\|2860162_2861539_+	ATP-dependent RNA helicase DbpA	A0A0N9Q9J4	Chrysochromulina_ericina_virus	1.6e-54	31.4
WP_011259319.1\|2861641_2862202_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.6e-29	43.2
WP_011408741.1\|2862299_2863856_-	YdiU family protein	NA	NA	NA	NA
WP_011408742.1\|2864139_2865015_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_012444709.1\|2865215_2865914_-	glutathione S-transferase	NA	NA	NA	NA
WP_011408744.1\|2866084_2866294_-	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	2.8e-16	62.3
WP_011408745.1\|2866563_2867049_+	YaiI/YqxD family protein	NA	NA	NA	NA
WP_011259325.1\|2867119_2867668_+	YaeQ family protein	NA	NA	NA	NA
WP_011259326.1\|2867664_2868846_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_012444707.1\|2869069_2871139_+	GGDEF and EAL domain-containing response regulator	NA	NA	NA	NA
WP_011259328.1\|2871238_2872117_-\|protease	protease HtpX	NA	NA	NA	NA
WP_011259329.1\|2872214_2873114_+\|tRNA	tRNA glutamyl-Q(34) synthetase GluQRS	NA	NA	NA	NA
WP_011408747.1\|2873201_2873942_+	beta-ketoacyl-ACP reductase	NA	NA	NA	NA
WP_011259331.1\|2874101_2874677_+	polyhydroxyalkanoate synthesis repressor PhaR	NA	NA	NA	NA
WP_011408749.1\|2874850_2875822_-	TraB/GumN family protein	NA	NA	NA	NA
WP_011408750.1\|2875855_2876797_-	DUF1684 domain-containing protein	NA	NA	NA	NA
WP_011259334.1\|2876796_2878674_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	1.4e-85	35.2
WP_011408751.1\|2878811_2880545_-	N-acetylmuramoyl-L-alanine amidase	A6XML1	Bacillus_virus	4.1e-15	28.4
WP_011259336.1\|2880597_2881098_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_011259337.1\|2881094_2882582_-	bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase	NA	NA	NA	NA
WP_069959886.1\|2882606_2883674_+\|tRNA	tRNA epoxyqueuosine(34) reductase QueG	NA	NA	NA	NA
WP_094187715.1\|2883788_2884552_-\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_19

2887747 : 2974683

Bacillus_phage(18.18%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_094187754.1\|2887747_2888495_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_041182165.1\|2888811_2890647_-	formylglycine-generating enzyme family protein	A0A075BSL8	Microcystis_phage	5.6e-23	33.1
WP_041182166.1\|2890918_2892010_+	ribonuclease D	NA	NA	NA	NA
WP_080493491.1\|2892085_2892475_-	ATP-dependent DNA ligase	NA	NA	NA	NA
WP_011408757.1\|2892338_2892689_-	hypothetical protein	NA	NA	NA	NA
WP_011259345.1\|2893102_2893504_+	H-NS histone family protein	NA	NA	NA	NA
WP_011259346.1\|2894010_2894145_-\|transposase	transposase	NA	NA	NA	NA
WP_015463309.1\|2894367_2894547_-	hypothetical protein	NA	NA	NA	NA
WP_027703932.1\|2895148_2895439_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_011408759.1\|2895426_2895705_-	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_080256628.1\|2896189_2896378_-	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_011408397.1\|2897150_2898335_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	5.0e-41	44.8
WP_011408763.1\|2904373_2904790_+	DUF3301 domain-containing protein	NA	NA	NA	NA
WP_011408764.1\|2905000_2905327_-	hypothetical protein	NA	NA	NA	NA
WP_011259352.1\|2905359_2905800_-\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	9.3e-25	46.2
WP_011259353.1\|2905878_2906514_-	stringent starvation protein A	NA	NA	NA	NA
WP_103057267.1\|2906907_2907651_-	cytochrome c1	NA	NA	NA	NA
WP_011259355.1\|2907658_2908918_-	cytochrome bc complex cytochrome b subunit	NA	NA	NA	NA
WP_011259356.1\|2908917_2909562_-	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
WP_011259357.1\|2910091_2911078_-	lytic transglycosylase domain-containing protein	A0A0H3V0Q1	Geobacillus_virus	1.3e-29	56.0
WP_011408766.1\|2913013_2914468_+\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
WP_011408767.1\|2914891_2915878_+	PhoH family protein	W8D063	Erwinia_phage	2.5e-46	47.7
WP_011259362.1\|2916289_2916952_+	hypothetical protein	NA	NA	NA	NA
WP_011259363.1\|2917006_2917492_+	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_011408769.1\|2917491_2918010_+	hypothetical protein	NA	NA	NA	NA
WP_011408770.1\|2918104_2918983_+	CBS domain-containing protein	NA	NA	NA	NA
WP_011259366.1\|2918979_2920260_+	DUF4105 domain-containing protein	NA	NA	NA	NA
WP_011259367.1\|2920275_2921277_+	magnesium and cobalt transport protein CorA	NA	NA	NA	NA
WP_011408772.1\|2921428_2922793_-	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_011408773.1\|2923047_2923458_+	hypothetical protein	NA	NA	NA	NA
WP_011408774.1\|2923613_2924444_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_075240820.1\|2924757_2926005_-	polyamine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-24	35.3
WP_011259371.1\|2926150_2927662_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_011408778.1\|2927648_2929235_-	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_011408779.1\|2929231_2930434_-	HlyD family secretion protein	NA	NA	NA	NA
WP_115840172.1\|2930940_2932329_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_011408781.1\|2932562_2933948_-	glutamine synthetase	NA	NA	NA	NA
WP_011259377.1\|2934855_2936235_+	glutamine synthetase	NA	NA	NA	NA
WP_011408783.1\|2936234_2937551_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_012444665.1\|2937687_2938932_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.5e-19	36.4
WP_011408784.1\|2939239_2940520_-	MHS family MFS transporter	NA	NA	NA	NA
WP_094187755.1\|2940825_2941134_-	hypothetical protein	NA	NA	NA	NA
WP_069970126.1\|2941093_2943442_-	FdhF/YdeP family oxidoreductase	NA	NA	NA	NA
WP_011259382.1\|2943438_2944284_-	formate dehydrogenase accessory sulfurtransferase FdhD	NA	NA	NA	NA
WP_069970127.1\|2944290_2945985_-	OFA family MFS transporter	NA	NA	NA	NA
WP_075242096.1\|2946127_2946310_+	hypothetical protein	NA	NA	NA	NA
WP_094187715.1\|2946306_2947070_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011259384.1\|2948420_2949773_+	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_069970184.1\|2949833_2952971_-	hypothetical protein	NA	NA	NA	NA
WP_011408788.1\|2953137_2953992_+	hypothetical protein	A0A1B1INV8	uncultured_Mediterranean_phage	6.4e-14	39.8
WP_011408789.1\|2954162_2955467_+	DUF445 family protein	NA	NA	NA	NA
WP_069959889.1\|2955608_2959703_+	response regulator	A0A1V0SGX0	Hokovirus	1.1e-55	28.4
WP_011259389.1\|2959736_2960723_+	response regulator	W8CYM9	Bacillus_phage	2.8e-05	26.8
WP_069959890.1\|2960847_2961831_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.5e-99	61.5
WP_027703873.1\|2967580_2968240_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_012444649.1\|2968254_2969559_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_011259395.1\|2969571_2972742_+	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
WP_109181969.1\|2973717_2974683_-\|transposase	IS1595-like element ISXo5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_20

2984037 : 3053761

uncultured_Caudovirales_phage(61.54%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011258188.1\|2984037_2985006_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_069959892.1\|2985300_2987646_-	hypothetical protein	NA	NA	NA	NA
WP_041182891.1\|2987663_2988395_-	hypothetical protein	NA	NA	NA	NA
WP_069959893.1\|2988426_2990769_-	hypothetical protein	NA	NA	NA	NA
WP_014503414.1\|2990793_2991522_-	hypothetical protein	NA	NA	NA	NA
WP_069959894.1\|2991550_2993893_-	hypothetical protein	NA	NA	NA	NA
WP_042465604.1\|2993917_2994661_-	hypothetical protein	NA	NA	NA	NA
WP_069964549.1\|2994691_2997526_-	hypothetical protein	NA	NA	NA	NA
WP_069964550.1\|2997522_2998452_-	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_069964551.1\|2998460_3001223_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	1.5e-43	27.2
WP_011408812.1\|3006107_3006497_-	type VI secretion protein	NA	NA	NA	NA
WP_011408813.1\|3006651_3007611_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_011408814.1\|3007543_3007858_+	DUF1153 domain-containing protein	NA	NA	NA	NA
WP_151420453.1\|3008085_3009405_+\|transposase	IS701-like element ISXo15 family transposase	NA	NA	NA	NA
WP_041183259.1\|3010509_3010926_-	type I toxin-antitoxin system SymE family toxin	NA	NA	NA	NA
WP_155296486.1\|3010922_3011228_-	hypothetical protein	NA	NA	NA	NA
WP_155296487.1\|3011169_3011547_+	hypothetical protein	NA	NA	NA	NA
WP_069970129.1\|3011627_3012695_-	ParA family protein	H2BD62	Pseudomonas_phage	3.8e-48	37.3
WP_155296495.1\|3012859_3015901_-	TonB-dependent receptor	NA	NA	NA	NA
WP_069959900.1\|3016950_3017403_+	hypothetical protein	NA	NA	NA	NA
WP_069959901.1\|3017657_3019463_+	TonB-dependent receptor	NA	NA	NA	NA
WP_128415369.1\|3019464_3019812_+	hypothetical protein	NA	NA	NA	NA
WP_044756757.1\|3019887_3020595_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	8.4e-52	51.2
WP_011259416.1\|3020746_3021139_+	TonB-dependent receptor plug domain-containing protein	NA	NA	NA	NA
WP_075251701.1\|3021161_3021677_+	TonB-dependent receptor	NA	NA	NA	NA
WP_069959903.1\|3021673_3022027_+	hypothetical protein	NA	NA	NA	NA
WP_011259417.1\|3022115_3022856_+	flagellar motor protein	NA	NA	NA	NA
WP_011408827.1\|3022862_3023837_+	flagellar motor protein MotD	NA	NA	NA	NA
WP_069959904.1\|3023838_3024621_+	ParA family protein	Q8JL10	Natrialba_phage	1.0e-13	37.7
WP_042465006.1\|3024617_3025640_+	chemotaxis protein CheW	NA	NA	NA	NA
WP_011259421.1\|3025740_3026049_+	STAS domain-containing protein	NA	NA	NA	NA
WP_002806565.1\|3026045_3026411_+	response regulator	W8CYM9	Bacillus_phage	2.7e-14	39.3
WP_011259422.1\|3026444_3028454_+	chemotaxis protein CheA	NA	NA	NA	NA
WP_069960094.1\|3028628_3028883_+\|transposase	transposase	NA	NA	NA	NA
WP_103073514.1\|3030565_3031252_+	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.8e-12	36.2
WP_011408833.1\|3031567_3032329_+	transporter	NA	NA	NA	NA
WP_044756756.1\|3032342_3034685_+	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-09	61.7
WP_115840174.1\|3035181_3036147_+\|transposase	IS1595-like element ISXo5 family transposase	NA	NA	NA	NA
WP_069959906.1\|3036386_3038633_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.9e-13	41.2
WP_042465628.1\|3039361_3041473_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.2e-14	41.8
WP_069959907.1\|3042157_3044233_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.3e-12	40.9
WP_011259431.1\|3044825_3047087_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	9.3e-12	40.9
WP_011408839.1\|3047480_3049742_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.3e-10	54.5
WP_011259433.1\|3050699_3051497_+	flagellar brake protein	NA	NA	NA	NA
WP_011408841.1\|3051632_3052115_+	chemotaxis protein CheW	NA	NA	NA	NA
WP_094187763.1\|3052963_3053761_+\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_21

3132941 : 3144716

Escherichia_phage(22.22%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011259503.1\|3132941_3133241_-	endolysin	A0A1W6JT17	Escherichia_phage	1.5e-15	66.7
WP_011259504.1\|3133283_3133514_-	endolysin	D5LH07	Escherichia_phage	4.7e-20	63.8
WP_011259505.1\|3133757_3134507_-	isopentenyl transferase	NA	NA	NA	NA
WP_011408881.1\|3134511_3135207_-	hypothetical protein	E5DV83	Deep-sea_thermophilic_phage	5.6e-16	41.0
WP_109181974.1\|3135142_3135370_-	hypothetical protein	NA	NA	NA	NA
WP_012444559.1\|3135392_3135692_-	hypothetical protein	NA	NA	NA	NA
WP_103057240.1\|3136079_3136484_-	helix-turn-helix domain-containing protein	A0A1W6JTD5	Pseudomonas_phage	1.1e-32	56.6
WP_003481884.1\|3137209_3137422_-	carbon storage regulator CsrA	J7I430	Pseudomonas_phage	1.3e-13	76.5
WP_011259507.1\|3137561_3140210_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	3.7e-84	39.6
WP_012444556.1\|3140311_3140800_-	recombination regulator RecX	NA	NA	NA	NA
WP_011408884.1\|3141102_3142137_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	6.2e-112	60.7
WP_011408885.1\|3142309_3142951_-	transcriptional repressor LexA	A0A1W6JNS2	Morganella_phage	2.4e-13	40.2
WP_011408886.1\|3143039_3144716_-	2-polyprenylphenol 6-hydroxylase	E5EQ95	Micromonas_sp._RCC1109_virus	3.3e-38	27.2

DBSCAN-SWA_22

3185025 : 3264014

Xanthomonas_phage(50.0%)

transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011407237.1\|3185025_3185982_+\|transposase	IS30-like element IS1112a family transposase	Q9MBM9	Staphylococcus_prophage	2.1e-42	35.2
WP_011259549.1\|3186080_3187193_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_041182180.1\|3187189_3188320_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_011408908.1\|3188441_3189140_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_027703449.1\|3189136_3190372_-	amidohydrolase family protein	NA	NA	NA	NA
WP_011259553.1\|3190384_3191227_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011259554.1\|3191507_3192359_-	chain-length determining protein	NA	NA	NA	NA
WP_027703450.1\|3192404_3193538_-	hypothetical protein	NA	NA	NA	NA
WP_011259555.1\|3193534_3194485_-	glycosyltransferase	NA	NA	NA	NA
WP_011259556.1\|3194481_3195735_-	O-antigen translocase	NA	NA	NA	NA
WP_069959913.1\|3195731_3196844_-	DegT/DnrJ/EryC1/StrS family aminotransferase	E5ES42	Bathycoccus_sp._RCC1105_virus	8.3e-30	28.4
WP_069959914.1\|3196843_3197776_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_069959915.1\|3197762_3198716_-	hypothetical protein	NA	NA	NA	NA
WP_011408914.1\|3198719_3199391_-	acetyltransferase	NA	NA	NA	NA
WP_011408915.1\|3199387_3199819_-	WxcM-like domain-containing protein	NA	NA	NA	NA
WP_041182464.1\|3200213_3200744_+	cytochrome-c oxidase	NA	NA	NA	NA
WP_012444527.1\|3200827_3202168_+	hypothetical protein	NA	NA	NA	NA
WP_011408918.1\|3202193_3202586_+	c-type cytochrome	NA	NA	NA	NA
WP_033013216.1\|3203028_3203817_+	hypothetical protein	NA	NA	NA	NA
WP_011408920.1\|3203880_3204462_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_011408921.1\|3204353_3205115_+	zf-HC2 domain-containing protein	NA	NA	NA	NA
WP_011259567.1\|3205111_3206437_+	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	2.4e-23	39.2
WP_011259568.1\|3206447_3207206_+	heme ABC transporter permease	NA	NA	NA	NA
WP_011408923.1\|3207202_3207409_+	heme exporter protein CcmD	NA	NA	NA	NA
WP_011259569.1\|3207405_3207876_+	cytochrome c maturation protein CcmE	NA	NA	NA	NA
WP_011408924.1\|3207939_3209928_+	heme lyase CcmF/NrfE family subunit	NA	NA	NA	NA
WP_011259571.1\|3209924_3210467_+	DsbE family thiol:disulfide interchange protein	NA	NA	NA	NA
WP_027703454.1\|3210466_3210964_+	cytochrome c-type biogenesis protein CcmH	NA	NA	NA	NA
WP_011408926.1\|3210963_3211668_+	hypothetical protein	NA	NA	NA	NA
WP_069959916.1\|3211876_3215596_+	avirulence protein	NA	NA	NA	NA
WP_155296488.1\|3215651_3215798_+	hypothetical protein	Q38057	Xanthomonas_phage	4.1e-06	77.8
WP_042464821.1\|3215864_3216059_+	hypothetical protein	A0A1W6DXV7	Xanthomonas_phage	3.9e-20	82.3
WP_011408408.1\|3216062_3216362_+	hypothetical protein	A0A1W6DY99	Xanthomonas_phage	6.4e-46	92.4
WP_069964559.1\|3216585_3221037_+	avirulence protein	NA	NA	NA	NA
WP_012444931.1\|3221305_3221500_+	hypothetical protein	A0A1W6DXV7	Xanthomonas_phage	1.3e-18	79.0
WP_011408408.1\|3221503_3221803_+	hypothetical protein	A0A1W6DY99	Xanthomonas_phage	6.4e-46	92.4
WP_069970132.1\|3222026_3226472_+	avirulence protein	NA	NA	NA	NA
WP_069964561.1\|3226951_3227545_-	hypothetical protein	NA	NA	NA	NA
WP_069959918.1\|3227534_3229010_-\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	5.4e-101	67.1
WP_069959919.1\|3229092_3231681_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_011259580.1\|3231737_3232850_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_011259581.1\|3232974_3233553_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_042465046.1\|3235039_3237127_+	hypothetical protein	NA	NA	NA	NA
WP_069959920.1\|3237512_3238610_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_042465048.1\|3239026_3242107_+	hypothetical protein	NA	NA	NA	NA
WP_033013236.1\|3245142_3245850_+	response regulator	NA	NA	NA	NA
WP_011259588.1\|3245846_3246839_+	c-type cytochrome	NA	NA	NA	NA
WP_011259589.1\|3246835_3249295_+	two-component system VirA-like sensor kinase	NA	NA	NA	NA
WP_011259590.1\|3249408_3250389_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011408942.1\|3250397_3251426_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_109181977.1\|3251592_3252390_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_109181978.1\|3252452_3253250_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_012444504.1\|3253310_3253637_-	hypothetical protein	NA	NA	NA	NA
WP_069959922.1\|3253633_3256537_-	protein kinase	A0A2R8FF19	Brazilian_cedratvirus	2.5e-09	25.0
WP_011408945.1\|3256533_3257256_-	serine/threonine-protein phosphatase	NA	NA	NA	NA
WP_011408946.1\|3257252_3257900_-	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_069959923.1\|3257896_3261355_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_011408948.1\|3261358_3262675_-	type VI secretion system protein TssL	NA	NA	NA	NA
WP_011408949.1\|3262676_3264014_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA

DBSCAN-SWA_23

3272976 : 3340143

Ralstonia_phage(83.33%)

transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011408954.1\|3272976_3273987_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_011259602.1\|3273950_3275828_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_011259603.1\|3275831_3276335_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_011259604.1\|3276322_3277156_-	hypothetical protein	NA	NA	NA	NA
WP_011259605.1\|3277191_3277695_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_027703472.1\|3277794_3279309_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_024711387.1\|3279301_3279808_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_011257031.1\|3281165_3282134_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	4.3e-99	60.0
WP_155296489.1\|3282269_3283589_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_011260830.1\|3283759_3284995_+\|transposase	ISL3-like element ISXoo13 family transposase	NA	NA	NA	NA
WP_011258802.1\|3285180_3286149_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_115840162.1\|3286285_3287605_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_069970134.1\|3287671_3289594_-	hypothetical protein	NA	NA	NA	NA
WP_011259611.1\|3289618_3290356_-	hypothetical protein	NA	NA	NA	NA
WP_011408961.1\|3290386_3292729_-	hypothetical protein	NA	NA	NA	NA
WP_042465640.1\|3292746_3293493_-	hypothetical protein	NA	NA	NA	NA
WP_042465052.1\|3293521_3296356_-	hypothetical protein	NA	NA	NA	NA
WP_012445381.1\|3298855_3299455_-	NfuA family Fe-S biogenesis protein	NA	NA	NA	NA
WP_012445382.1\|3299542_3299899_+	4a-hydroxytetrahydrobiopterin dehydratase	NA	NA	NA	NA
WP_012445383.1\|3299895_3300318_+	energy transducer TonB	NA	NA	NA	NA
WP_011408967.1\|3300333_3300567_+	hypothetical protein	NA	NA	NA	NA
WP_069960235.1\|3300593_3300854_+	hypothetical protein	NA	NA	NA	NA
WP_011259619.1\|3303024_3304011_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_042465057.1\|3304421_3308135_+	Rne/Rng family ribonuclease	NA	NA	NA	NA
WP_094187765.1\|3308660_3309424_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_012445389.1\|3309527_3310175_-	response regulator	NA	NA	NA	NA
WP_011408973.1\|3310396_3311158_-	sulfurtransferase	NA	NA	NA	NA
WP_011257031.1\|3311315_3312284_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	4.3e-99	60.0
WP_011408974.1\|3312417_3312783_-	hypothetical protein	NA	NA	NA	NA
WP_011408975.1\|3312841_3313273_+	FKBP-type peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_011259625.1\|3313284_3314547_+	TIGR03862 family flavoprotein	NA	NA	NA	NA
WP_011408976.1\|3314530_3315823_-	nucleotide sugar dehydrogenase	NA	NA	NA	NA
WP_011408977.1\|3316192_3316963_+	4'-phosphopantetheinyl transferase superfamily protein	NA	NA	NA	NA
WP_011259629.1\|3317719_3318955_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_011408979.1\|3320254_3320512_-	stress-induced protein	NA	NA	NA	NA
WP_011408980.1\|3320951_3321935_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	7.5e-99	61.2
WP_011258802.1\|3322250_3323219_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_011407489.1\|3323355_3324675_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_011408981.1\|3324824_3325787_+\|transposase	IS1595-like element ISXo2 family transposase	NA	NA	NA	NA
WP_153296740.1\|3326036_3326195_-	hypothetical protein	NA	NA	NA	NA
WP_041182195.1\|3326226_3326406_-	hypothetical protein	NA	NA	NA	NA
WP_109181928.1\|3326770_3327736_-\|transposase	IS1595-like element ISXo5 family transposase	NA	NA	NA	NA
WP_011408985.1\|3328943_3329921_+	siroheme synthase	NA	NA	NA	NA
WP_042465070.1\|3330729_3330924_+	hypothetical protein	NA	NA	NA	NA
WP_011408987.1\|3332317_3332680_-	hypothetical protein	NA	NA	NA	NA
WP_011408988.1\|3332663_3333233_-	molybdenum cofactor guanylyltransferase	NA	NA	NA	NA
WP_011259640.1\|3333270_3334524_-	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_011408989.1\|3334729_3335107_+	hypothetical protein	NA	NA	NA	NA
WP_011259629.1\|3337035_3338271_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_011407587.1\|3339108_3340143_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	8.0e-43	32.8

DBSCAN-SWA_24

3481253 : 3609352

101

Ralstonia_phage(14.29%)

tRNA,protease,integrase,transposase

attL 3582661:3582720|attR 3602290:3603101

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_094187736.1\|3481253_3482017_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_125168762.1\|3482849_3483095_-	hypothetical protein	NA	NA	NA	NA
WP_011259756.1\|3483040_3485407_-	EAL domain-containing protein	NA	NA	NA	NA
WP_011409066.1\|3485403_3486078_-	hypothetical protein	NA	NA	NA	NA
WP_011259758.1\|3486287_3487226_-	isopenicillin N synthase family oxygenase	NA	NA	NA	NA
WP_011259759.1\|3487348_3488698_-	phosphoglucosamine mutase	NA	NA	NA	NA
WP_011259760.1\|3488694_3489582_-	acetyl-CoA carboxylase carboxyltransferase subunit beta	NA	NA	NA	NA
WP_011409067.1\|3489899_3490706_-	tryptophan synthase subunit alpha	NA	NA	NA	NA
WP_011259762.1\|3491151_3492369_-	tryptophan synthase subunit beta	NA	NA	NA	NA
WP_069959939.1\|3492474_3493443_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	5.4e-09	23.7
WP_011259764.1\|3493785_3494454_-	phosphoribosylanthranilate isomerase	NA	NA	NA	NA
WP_011259765.1\|3494450_3495224_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_103057773.1\|3495797_3497864_-	ferrous iron transporter B	NA	NA	NA	NA
WP_011259769.1\|3498430_3499456_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_011409070.1\|3499540_3500614_-	D-glycerate dehydrogenase	M1HTA3	Paramecium_bursaria_Chlorella_virus	2.1e-14	23.2
WP_011259771.1\|3500606_3501710_-	chorismate synthase	A0A291AU41	Pandoravirus	1.6e-73	40.4
WP_011259772.1\|3501720_3502647_-	50S ribosomal protein L3 N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_069959940.1\|3502727_3503378_+	SCO family protein	NA	NA	NA	NA
WP_069959941.1\|3503374_3504223_+	phosphatidylserine decarboxylase	NA	NA	NA	NA
WP_069959942.1\|3504773_3506357_-	transglycosylase SLT domain-containing protein	A0A2H4J9N7	uncultured_Caudovirales_phage	4.2e-11	31.5
WP_103073413.1\|3506543_3506999_+	DUF853 family protein	A0A248XCZ8	Klebsiella_phage	5.4e-12	43.6
WP_011409074.1\|3507067_3507535_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_103057205.1\|3507779_3508997_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_153296738.1\|3508957_3509245_-	hypothetical protein	NA	NA	NA	NA
WP_069960098.1\|3509355_3509862_+	transcription elongation factor GreB	NA	NA	NA	NA
WP_044756621.1\|3509983_3511384_-	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
WP_011409077.1\|3511646_3512222_+	dienelactone hydrolase family protein	NA	NA	NA	NA
WP_011409078.1\|3512218_3512653_+	HIT family protein	NA	NA	NA	NA
WP_011259782.1\|3512680_3512848_+	hypothetical protein	NA	NA	NA	NA
WP_011259783.1\|3513512_3513698_+	hypothetical protein	NA	NA	NA	NA
WP_011259784.1\|3513732_3514302_-	dCTP deaminase	S5VM63	Pseudomonas_phage	2.6e-72	70.1
WP_011259785.1\|3514394_3515246_-	iron-sulfur cluster carrier protein ApbC	NA	NA	NA	NA
WP_011259787.1\|3516633_3518649_+	M13 family metallopeptidase	NA	NA	NA	NA
WP_012445555.1\|3518919_3519618_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_011409081.1\|3519658_3520066_-	methylated-DNA--protein-cysteine methyltransferase	NA	NA	NA	NA
WP_011409082.1\|3520503_3521466_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_011409084.1\|3522749_3524000_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_011409085.1\|3524007_3525252_-	DUF418 domain-containing protein	NA	NA	NA	NA
WP_011259794.1\|3525479_3525959_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_027704197.1\|3526069_3526606_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	3.2e-19	40.5
WP_011259796.1\|3526715_3527465_+	C40 family peptidase	A0A0K2SUC1	Clostridium_phage	1.2e-19	38.5
WP_011259797.1\|3527672_3528164_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_011409088.1\|3529277_3530597_-	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_011259800.1\|3530741_3532448_+	alkaline phosphatase	NA	NA	NA	NA
WP_011259801.1\|3532481_3533786_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_011259802.1\|3533817_3534078_+	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_011259803.1\|3534079_3534955_+	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_027704198.1\|3536789_3537254_-	DUF4870 domain-containing protein	NA	NA	NA	NA
WP_012445570.1\|3537305_3537494_-	hypothetical protein	NA	NA	NA	NA
WP_069959944.1\|3537466_3537787_-	hypothetical protein	NA	NA	NA	NA
WP_012445571.1\|3537783_3539151_-\|protease	metalloprotease PmbA	NA	NA	NA	NA
WP_044756609.1\|3539296_3539878_+	ribosome-associated protein	NA	NA	NA	NA
WP_011259808.1\|3540134_3541580_-\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_011409097.1\|3542426_3546347_-	TIGR02099 family protein	NA	NA	NA	NA
WP_011259814.1\|3546480_3547980_-	ribonuclease G	NA	NA	NA	NA
WP_011409098.1\|3547979_3548552_-	Maf-like protein	NA	NA	NA	NA
WP_011409099.1\|3548690_3549425_+	SIMPL domain-containing protein	NA	NA	NA	NA
WP_011409100.1\|3549896_3553010_+	TonB-dependent receptor	NA	NA	NA	NA
WP_011409102.1\|3554428_3554899_-	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_109181984.1\|3555453_3555927_+	DUF839 domain-containing protein	NA	NA	NA	NA
WP_011259821.1\|3555984_3557100_-	J domain-containing protein	NA	NA	NA	NA
WP_011259822.1\|3557111_3557528_-	ribosome silencing factor	NA	NA	NA	NA
WP_027703805.1\|3557584_3558484_-	nicotinate-nucleotide adenylyltransferase	NA	NA	NA	NA
WP_011259823.1\|3558480_3559509_-	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_011409105.1\|3559531_3560167_-	hypothetical protein	NA	NA	NA	NA
WP_011259825.1\|3560680_3563323_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	2.7e-172	39.7
WP_011259826.1\|3563395_3564007_-	DUF998 domain-containing protein	NA	NA	NA	NA
WP_011409107.1\|3564211_3565069_+	thioredoxin	A0A1J0GW78	Streptomyces_phage	1.3e-11	41.8
WP_011409108.1\|3565324_3565774_+	DUF4442 domain-containing protein	NA	NA	NA	NA
WP_109181928.1\|3566073_3567039_-\|transposase	IS1595-like element ISXo5 family transposase	NA	NA	NA	NA
WP_094187715.1\|3567163_3567926_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_027704065.1\|3568536_3568830_+	hypothetical protein	NA	NA	NA	NA
WP_011259829.1\|3569303_3569537_+	DUF378 domain-containing protein	NA	NA	NA	NA
WP_011409111.1\|3569570_3570584_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_011259831.1\|3570551_3570743_-	hypothetical protein	NA	NA	NA	NA
WP_115801901.1\|3570833_3572153_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_041182217.1\|3572240_3573455_-\|transposase	IS4-like element ISXo14 family transposase	A0A0F7LAS3	uncultured_marine_virus	1.1e-54	33.4
WP_011259834.1\|3573600_3574128_+	hypothetical protein	NA	NA	NA	NA
WP_041182722.1\|3574124_3575090_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_094187771.1\|3575330_3576093_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011409116.1\|3576395_3578528_+	glycogen debranching protein GlgX	NA	NA	NA	NA
WP_011258351.1\|3579078_3580047_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	1.9e-99	59.7
WP_011258803.1\|3580207_3581176_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	1.5e-99	60.0
WP_082323400.1\|3582251_3582665_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
3582661:3582720	attL	NA	NA	NA	NA
WP_094187715.1\|3582661_3583425_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_094187763.1\|3584296_3585094_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011409118.1\|3585127_3585520_-	H-NS histone family protein	NA	NA	NA	NA
WP_027704094.1\|3585610_3586003_-	hypothetical protein	NA	NA	NA	NA
WP_075239728.1\|3588341_3588761_+\|integrase	tyrosine-type recombinase/integrase	C8CLF4	Xylella_phage	5.1e-41	65.2
WP_012445601.1\|3590477_3592262_-	autotransporter domain-containing esterase	NA	NA	NA	NA
WP_011259851.1\|3592452_3592653_+	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_011409125.1\|3593188_3593983_+	thiazole synthase	NA	NA	NA	NA
WP_011259853.1\|3594284_3595043_+\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_011259854.1\|3595118_3596981_+	SLC13 family permease	NA	NA	NA	NA
WP_011409127.1\|3597038_3597380_-	Rieske (2Fe-2S) protein	NA	NA	NA	NA
WP_011259856.1\|3597639_3597915_+	hypothetical protein	NA	NA	NA	NA
WP_011409129.1\|3600962_3601676_+	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_012445603.1\|3601736_3602159_+	large-conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
WP_094187715.1\|3602290_3603054_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011409134.1\|3606127_3607039_-	RNA methyltransferase	NA	NA	NA	NA
3602290:3603101	attR	NA	NA	NA	NA
WP_109182013.1\|3608386_3609352_-\|transposase	IS1595-like element ISXo5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_25

3656795 : 3733095

Liberibacter_phage(15.38%)

transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011407175.1\|3656795_3657764_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	5.6e-99	59.7
WP_011407587.1\|3658784_3659819_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	8.0e-43	32.8
WP_011259895.1\|3660202_3660928_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_011409154.1\|3661059_3661521_-	hypothetical protein	NA	NA	NA	NA
WP_069970137.1\|3662184_3663561_+\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	8.9e-74	53.4
WP_027704153.1\|3663634_3665755_-	S9 family peptidase	NA	NA	NA	NA
WP_027704154.1\|3666021_3666867_-	transporter	NA	NA	NA	NA
WP_011259903.1\|3667991_3669962_-	oligopeptide transporter, OPT family	NA	NA	NA	NA
WP_011259904.1\|3670390_3671788_+	endoproteinase ArgC	NA	NA	NA	NA
WP_027704156.1\|3671900_3672719_-	HDOD domain-containing protein	NA	NA	NA	NA
WP_094187840.1\|3673029_3676227_-	error-prone DNA polymerase	A0A1B1PA77	Streptomyces_phage	1.7e-80	24.8
WP_011259908.1\|3676462_3677881_-	DNA polymerase Y family protein	NA	NA	NA	NA
WP_082348427.1\|3677890_3678493_-	translesion DNA synthesis-associated protein ImuA	NA	NA	NA	NA
WP_011259910.1\|3678542_3679148_-	repressor LexA	A0A1W6JNS2	Morganella_phage	8.6e-13	39.2
WP_011259911.1\|3679297_3679519_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_011409165.1\|3679528_3679954_+	type II toxin-antitoxin system death-on-curing family toxin	A0A1B3AYM0	Gordonia_phage	5.8e-08	48.5
WP_143690655.1\|3680347_3680542_-	hypothetical protein	NA	NA	NA	NA
WP_011409167.1\|3681468_3682248_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_011409168.1\|3682462_3683092_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_027704159.1\|3683152_3683908_-	hypothetical protein	NA	NA	NA	NA
WP_041182227.1\|3684236_3685013_-	hypothetical protein	NA	NA	NA	NA
WP_069964802.1\|3685421_3686996_+	serine/threonine protein kinase	NA	NA	NA	NA
WP_039440923.1\|3687244_3687511_-	hypothetical protein	NA	NA	NA	NA
WP_069970138.1\|3687788_3690968_-	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	6.4e-75	30.8
WP_094187841.1\|3690967_3692119_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_011409179.1\|3692534_3692969_-	hypothetical protein	NA	NA	NA	NA
WP_069970186.1\|3692979_3694509_-	SAM-dependent DNA methyltransferase	A0A2H4PQP4	Staphylococcus_phage	7.4e-45	29.1
WP_011409181.1\|3694811_3695804_-	restriction endonuclease	A0A1B1IUE7	uncultured_Mediterranean_phage	1.5e-30	29.2
WP_044756557.1\|3695856_3696165_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_069970139.1\|3696745_3700219_+	type I restriction-modification system endonuclease	A0A1B1IW48	uncultured_Mediterranean_phage	1.9e-08	21.9
WP_041182233.1\|3700358_3701357_+	Abi family protein	NA	NA	NA	NA
WP_069960250.1\|3701403_3702948_+	type I restriction-modification system subunit M	A0A220A2U5	Liberibacter_phage	1.5e-13	23.9
WP_069964800.1\|3704374_3704683_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_047340450.1\|3704689_3704953_-	hypothetical protein	NA	NA	NA	NA
WP_082323166.1\|3705675_3706431_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_069970140.1\|3706724_3707756_-	hypothetical protein	NA	NA	NA	NA
WP_082323403.1\|3707764_3709699_-	hypothetical protein	NA	NA	NA	NA
WP_069963889.1\|3709610_3710636_-	hypothetical protein	NA	NA	NA	NA
WP_082323435.1\|3710638_3712651_-	hypothetical protein	NA	NA	NA	NA
WP_069959962.1\|3713135_3714155_-	hypothetical protein	NA	NA	NA	NA
WP_082323404.1\|3714159_3716103_-	hypothetical protein	NA	NA	NA	NA
WP_069959963.1\|3716014_3717037_-	hypothetical protein	NA	NA	NA	NA
WP_082323405.1\|3717046_3718990_-	hypothetical protein	NA	NA	NA	NA
WP_069959964.1\|3718901_3719918_-	hypothetical protein	NA	NA	NA	NA
WP_069959965.1\|3719926_3722794_-	hypothetical protein	NA	NA	NA	NA
WP_052658684.1\|3722812_3723718_-	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_069970142.1\|3723659_3726422_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	3.3e-43	27.5
WP_011259938.1\|3726514_3726868_-	hypothetical protein	NA	NA	NA	NA
WP_011259939.1\|3726898_3729628_-	type VI secretion system ATPase TssH	A0A223W0B1	Agrobacterium_phage	7.1e-91	29.6
WP_011259940.1\|3729713_3730805_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_069959967.1\|3730768_3732604_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_011409203.1\|3732606_3733095_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA

DBSCAN-SWA_26

3827489 : 3838316

Burkholderia_virus(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027703307.1\|3827489_3828293_-	sulfotransferase	M4QPS9	Synechococcus_phage	4.5e-25	27.3
WP_027703308.1\|3828723_3828906_+	hypothetical protein	NA	NA	NA	NA
WP_069960107.1\|3829373_3832328_+	aminomethyl-transferring glycine dehydrogenase	M4QFZ1	Prochlorococcus_phage	9.0e-257	49.9
WP_011260010.1\|3832657_3833107_+	hypothetical protein	A4JWV5	Burkholderia_virus	3.3e-09	34.1
WP_011409250.1\|3833103_3833799_+	VRR-NUC domain-containing protein	Q8W6S1	Burkholderia_virus	2.2e-36	46.1
WP_011409251.1\|3833806_3834877_+	DUF3396 domain-containing protein	E5E3X8	Burkholderia_phage	5.7e-60	36.6
WP_011409252.1\|3834873_3835959_+	DUF3396 domain-containing protein	E5E3X8	Burkholderia_phage	4.0e-61	37.9
WP_069960108.1\|3837359_3838316_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.8e-41	35.3

DBSCAN-SWA_27

4144565 : 4249945

Ralstonia_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155296496.1\|4144565_4146173_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_075242322.1\|4146334_4146598_+	HAMP domain-containing protein	NA	NA	NA	NA
WP_075242321.1\|4146602_4147262_+	histidine kinase	W8CYF6	Bacillus_phage	7.1e-13	23.4
WP_011260279.1\|4147448_4148813_-	glutamate--cysteine ligase	NA	NA	NA	NA
WP_011409411.1\|4149028_4149724_+	VIT family protein	NA	NA	NA	NA
WP_011409413.1\|4150670_4151294_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_011409414.1\|4151495_4152236_+	cytochrome c4	NA	NA	NA	NA
WP_011409415.1\|4152329_4152980_+	thiol:disulfide interchange protein DsbA/DsbL	NA	NA	NA	NA
WP_011260284.1\|4153071_4153887_+	thiol:disulfide interchange protein DsbA/DsbL	NA	NA	NA	NA
WP_069970187.1\|4153936_4154674_+	endonuclease	NA	NA	NA	NA
WP_011409419.1\|4156602_4157592_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	7.5e-99	61.2
WP_041182588.1\|4157714_4160288_+	pyridoxal-phosphate dependent enzyme	NA	NA	NA	NA
WP_109182012.1\|4160480_4161243_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011258802.1\|4161316_4162285_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_011409421.1\|4163018_4163285_+\|transposase	transposase	NA	NA	NA	NA
WP_094187728.1\|4164216_4165015_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011260292.1\|4166661_4167894_+	multifunctional CCA addition/repair protein	K4IEX3	Salmonella_phage	2.0e-72	41.7
WP_011409423.1\|4167933_4168896_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_011407237.1\|4169071_4170028_-\|transposase	IS30-like element IS1112a family transposase	Q9MBM9	Staphylococcus_prophage	2.1e-42	35.2
WP_011258802.1\|4170239_4171208_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_094187715.1\|4171543_4172306_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_109182013.1\|4175716_4176682_+\|transposase	IS1595-like element ISXo5 family transposase	NA	NA	NA	NA
WP_012444134.1\|4177143_4177374_-	hypothetical protein	NA	NA	NA	NA
WP_129593046.1\|4178042_4180040_+	poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA	NA	NA	NA	NA
WP_011409429.1\|4180041_4181940_+	poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB	NA	NA	NA	NA
WP_069970149.1\|4181941_4183195_+	poly-beta-1,6 N-acetyl-D-glucosamine synthase	NA	NA	NA	NA
WP_069959998.1\|4183191_4183797_+	poly-beta-1,6-N-acetyl-D-glucosamine biosynthesis protein PgaD	NA	NA	NA	NA
WP_044756434.1\|4184216_4185371_-	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
WP_011260300.1\|4185373_4186402_-	SIS domain-containing protein	NA	NA	NA	NA
WP_012444129.1\|4186408_4187476_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_011260302.1\|4187516_4188794_-	sugar MFS transporter	NA	NA	NA	NA
WP_011409432.1\|4188838_4189606_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_069959999.1\|4189820_4190987_-	DUF1624 domain-containing protein	NA	NA	NA	NA
WP_069964600.1\|4193542_4196440_-	glycoside hydrolase family 2 protein	L0N6M2	Herpes_simplex_virus	8.8e-23	25.2
WP_069960264.1\|4196590_4199281_-	TonB-dependent receptor	NA	NA	NA	NA
WP_011260311.1\|4201360_4202545_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011409442.1\|4202612_4203350_+	pteridine reductase	NA	NA	NA	NA
WP_011260313.1\|4203518_4204034_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_011260314.1\|4204125_4205628_-	hybrid sensor histidine kinase/response regulator	A0A2K9L5I4	Tupanvirus	1.1e-08	26.2
WP_011260315.1\|4205631_4206072_-	response regulator	NA	NA	NA	NA
WP_011409443.1\|4206068_4207880_-	PAS domain S-box protein	A0A2K9L0Z8	Tupanvirus	3.5e-09	28.3
WP_011409444.1\|4208165_4208528_-	BON domain-containing protein	NA	NA	NA	NA
WP_011260318.1\|4208687_4209740_+	oxidoreductase	NA	NA	NA	NA
WP_011260319.1\|4210079_4211021_-	decarboxylating 6-phosphogluconate dehydrogenase	M4SJX8	Cyanophage	5.9e-69	44.9
WP_075239460.1\|4211041_4212379_-	hypothetical protein	NA	NA	NA	NA
WP_011409446.1\|4212550_4212931_-	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_012444115.1\|4213055_4213817_-	DUF2242 domain-containing protein	NA	NA	NA	NA
WP_011409450.1\|4216065_4217469_-	nicotinate phosphoribosyltransferase	A0A218M332	Acidovorax_phage	8.1e-131	51.5
WP_011260326.1\|4217591_4218647_-	bifunctional nicotinamide-nucleotide adenylyltransferase/Nudix hydroxylase	A0A1B0V161	Roseobacter_phage	1.3e-80	47.1
WP_103057229.1\|4218819_4219674_+	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_011260328.1\|4219965_4222149_-	PDZ domain-containing protein	A0A0R6PIZ1	Moraxella_phage	2.8e-82	31.6
WP_044756429.1\|4222548_4223562_-	lipoyl synthase	NA	NA	NA	NA
WP_027703467.1\|4223576_4224275_-	lipoyl(octanoyl) transferase LipB	NA	NA	NA	NA
WP_011409453.1\|4224262_4224541_-	YbeD family protein	NA	NA	NA	NA
WP_069964757.1\|4225606_4226812_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	2.7e-66	41.2
WP_011260335.1\|4227312_4228728_-	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	4.3e-15	50.6
WP_011260336.1\|4228724_4229864_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_069963899.1\|4232253_4233210_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	8.1e-42	35.2
WP_143698369.1\|4233217_4233976_-	hypothetical protein	NA	NA	NA	NA
WP_075239457.1\|4233981_4235706_-	LysM peptidoglycan-binding domain-containing protein	A0A2H4JIA8	uncultured_Caudovirales_phage	2.6e-22	24.3
WP_082323410.1\|4235702_4238471_-	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_011260340.1\|4239232_4240351_-	rod shape-determining protein RodA	NA	NA	NA	NA
WP_011409461.1\|4240347_4242408_-	penicillin-binding protein 2	NA	NA	NA	NA
WP_011409462.1\|4242411_4242897_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_069970150.1\|4242893_4244270_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_012444096.1\|4244442_4245489_-	rod shape-determining protein	F2Y0P3	Organic_Lake_phycodnavirus	4.6e-06	21.2
WP_069970151.1\|4245764_4246697_+	carbohydrate kinase family protein	NA	NA	NA	NA
WP_069960002.1\|4247890_4248346_-	nucleoside deaminase	NA	NA	NA	NA
WP_069960003.1\|4248342_4248843_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_069970153.1\|4248943_4249945_-\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_28

4298267 : 4431653

104

Ralstonia_phage(25.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_094187715.1\|4298267_4299031_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_027704042.1\|4300078_4300864_+	DUF72 domain-containing protein	NA	NA	NA	NA
WP_011260388.1\|4301117_4302791_+	alpha,alpha-trehalase TreA	NA	NA	NA	NA
WP_011409497.1\|4303334_4303781_-	autotransporter	NA	NA	NA	NA
WP_012444053.1\|4304111_4304396_+	hypothetical protein	NA	NA	NA	NA
WP_027703841.1\|4304990_4305902_-	magnesium transporter	NA	NA	NA	NA
WP_027703842.1\|4306147_4307143_+	hypothetical protein	NA	NA	NA	NA
WP_044757313.1\|4307236_4308613_-	D-serine/D-alanine/glycine transporter	NA	NA	NA	NA
WP_069960010.1\|4309779_4311480_+	1,4-beta-cellobiosidase	NA	NA	NA	NA
WP_012444044.1\|4311888_4313661_+	cellulase family glycosylhydrolase	NA	NA	NA	NA
WP_094187849.1\|4313936_4314821_-	DMT family transporter	NA	NA	NA	NA
WP_044757311.1\|4315009_4315888_+	hypothetical protein	NA	NA	NA	NA
WP_080493954.1\|4316087_4316483_+	hypothetical protein	NA	NA	NA	NA
WP_011260398.1\|4317927_4319019_+	DUF1615 domain-containing protein	NA	NA	NA	NA
WP_011409507.1\|4320921_4323246_+	S9 family peptidase	NA	NA	NA	NA
WP_069960011.1\|4323441_4325388_-	S9 family peptidase	NA	NA	NA	NA
WP_011409509.1\|4325762_4325954_+	hypothetical protein	NA	NA	NA	NA
WP_011260404.1\|4326344_4327928_+	SDR family oxidoreductase	M1NLX1	Moumouvirus	6.5e-36	27.5
WP_027704189.1\|4328275_4328872_-	hypothetical protein	NA	NA	NA	NA
WP_069960267.1\|4330220_4331069_-	threonine aldolase	NA	NA	NA	NA
WP_011409514.1\|4331103_4332579_-	anthranilate synthase component I	S4VT78	Pandoravirus	3.1e-40	32.5
WP_011260408.1\|4333176_4334106_-	lipid kinase YegS	NA	NA	NA	NA
WP_011260409.1\|4334340_4334832_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011260410.1\|4334828_4335500_-	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_011409516.1\|4335894_4336224_-	DnaJ domain-containing protein	NA	NA	NA	NA
WP_044757306.1\|4337831_4338509_+	NYN domain-containing protein	A4JWQ6	Burkholderia_virus	8.8e-75	60.3
WP_011409520.1\|4341026_4341512_+	DUF962 domain-containing protein	NA	NA	NA	NA
WP_011409522.1\|4342050_4344879_+	monovalent cation/H+ antiporter subunit A	NA	NA	NA	NA
WP_011409523.1\|4344878_4345253_+	Na+/H+ antiporter subunit C	NA	NA	NA	NA
WP_069960013.1\|4345249_4346794_+	monovalent cation/H+ antiporter subunit D	NA	NA	NA	NA
WP_044756383.1\|4346790_4347297_+	Na+/H+ antiporter subunit E	NA	NA	NA	NA
WP_011260421.1\|4347293_4347578_+	K+/H+ antiporter subunit F	NA	NA	NA	NA
WP_011260422.1\|4347574_4347928_+	Na+/H+ antiporter subunit G	NA	NA	NA	NA
WP_094187715.1\|4348479_4349242_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011258802.1\|4349713_4350682_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_011409528.1\|4351113_4352439_-	homogentisate 1,2-dioxygenase	NA	NA	NA	NA
WP_011409529.1\|4352803_4353874_-	4-hydroxyphenylpyruvate dioxygenase	NA	NA	NA	NA
WP_069960268.1\|4354037_4354532_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_011409530.1\|4354888_4355479_-	thioredoxin family protein	NA	NA	NA	NA
WP_044756377.1\|4355490_4356999_-	MFS transporter	A0A0P0IY73	Acinetobacter_phage	1.3e-62	33.8
WP_011260428.1\|4357441_4358335_-	tryptophan 2,3-dioxygenase	NA	NA	NA	NA
WP_075242274.1\|4359703_4360369_+	pyruvate dehydrogenase E1 subunit alpha	NA	NA	NA	NA
WP_115801908.1\|4361001_4361967_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_011260435.1\|4362499_4362880_+	hypothetical protein	NA	NA	NA	NA
WP_094187715.1\|4363040_4363804_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_103073472.1\|4363898_4364804_-	hypothetical protein	NA	NA	NA	NA
WP_011260437.1\|4364872_4366168_+	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_069960017.1\|4366283_4366808_+	hypothetical protein	NA	NA	NA	NA
WP_011260439.1\|4367233_4368499_-	porphyrin biosynthesis protein	NA	NA	NA	NA
WP_011409539.1\|4368495_4369473_-	hypothetical protein	NA	NA	NA	NA
WP_012444011.1\|4369576_4370380_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_011260442.1\|4370555_4371365_+	glycosyltransferase family 25 protein	NA	NA	NA	NA
WP_109182023.1\|4371372_4372171_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_094187851.1\|4372213_4372861_-	hypothetical protein	NA	NA	NA	NA
WP_011409543.1\|4372955_4373531_-	hypothetical protein	NA	NA	NA	NA
WP_109181902.1\|4373742_4375062_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_011409545.1\|4375211_4376180_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_011260446.1\|4376305_4377058_-	HAD family hydrolase	NA	NA	NA	NA
WP_011260447.1\|4377095_4377536_-	EF-hand domain-containing protein	NA	NA	NA	NA
WP_011409547.1\|4377742_4378084_-	hypothetical protein	NA	NA	NA	NA
WP_011260449.1\|4378309_4378687_-	hypothetical protein	NA	NA	NA	NA
WP_011260450.1\|4378897_4379095_-	CPXCG motif-containing cysteine-rich protein	NA	NA	NA	NA
WP_069960019.1\|4379401_4380148_-	M15 family metallopeptidase	NA	NA	NA	NA
WP_044756487.1\|4380555_4381770_-\|transposase	IS4-like element ISXo14 family transposase	A0A0F7LAS3	uncultured_marine_virus	8.2e-55	33.7
WP_069965058.1\|4382627_4384040_+	NlpC-P60 family protein	NA	NA	NA	NA
WP_011260454.1\|4384036_4385134_+	dipeptide epimerase	NA	NA	NA	NA
WP_094187763.1\|4385288_4386087_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_099051302.1\|4386140_4386939_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011409552.1\|4387158_4388121_+\|transposase	IS1595-like element ISXo2 family transposase	NA	NA	NA	NA
WP_109182024.1\|4388568_4389332_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011260456.1\|4389613_4390390_+	hypothetical protein	NA	NA	NA	NA
WP_011409554.1\|4390386_4391703_+	amino acid permease	NA	NA	NA	NA
WP_069960021.1\|4392219_4393455_+\|transposase	ISL3-like element ISXoo13 family transposase	NA	NA	NA	NA
WP_011260459.1\|4394048_4394330_+	hypothetical protein	NA	NA	NA	NA
WP_069960022.1\|4394890_4395328_-	hypothetical protein	NA	NA	NA	NA
WP_011258802.1\|4395330_4396299_+\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_115801874.1\|4396511_4397831_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_011409559.1\|4398136_4399315_+	PQQ-dependent sugar dehydrogenase	NA	NA	NA	NA
WP_069960023.1\|4400310_4401273_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_011260467.1\|4403606_4405778_-	beta-glucosidase	NA	NA	NA	NA
WP_011409563.1\|4406005_4406362_-	dihydroneopterin aldolase	NA	NA	NA	NA
WP_011260469.1\|4406440_4407505_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	8.6e-101	57.1
WP_002808376.1\|4407785_4408001_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_069960024.1\|4408308_4408755_+	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	4.7e-24	45.9
WP_069960025.1\|4410232_4411195_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_011260472.1\|4411284_4413033_+	DNA primase	A0A1S5RF71	Helicobacter_phage	4.2e-44	34.5
WP_151420490.1\|4413276_4414596_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_155296490.1\|4414666_4414831_-	hypothetical protein	NA	NA	NA	NA
WP_059317500.1\|4414830_4415097_-	hypothetical protein	NA	NA	NA	NA
WP_033013369.1\|4415321_4416368_+	bile acid:sodium symporter	NA	NA	NA	NA
WP_069960027.1\|4416551_4418132_+	thioredoxin family protein	NA	NA	NA	NA
WP_011409570.1\|4418520_4419417_-	protoheme IX farnesyltransferase	NA	NA	NA	NA
WP_011260477.1\|4419419_4420583_-	heme A synthase	NA	NA	NA	NA
WP_011260478.1\|4420593_4421169_-	hypothetical protein	NA	NA	NA	NA
WP_011409571.1\|4421196_4421916_-	SURF1 family protein	NA	NA	NA	NA
WP_012443949.1\|4421976_4422195_+	twin transmembrane helix small protein	NA	NA	NA	NA
WP_011260481.1\|4422287_4423163_-	cytochrome c oxidase subunit 3	NA	NA	NA	NA
WP_024743269.1\|4423201_4423798_-	cytochrome c oxidase assembly protein	NA	NA	NA	NA
WP_011409573.1\|4423794_4423968_-	hypothetical protein	NA	NA	NA	NA
WP_011260484.1\|4423948_4425553_-	cytochrome c oxidase subunit I	NA	NA	NA	NA
WP_011260485.1\|4425591_4426545_-	cytochrome c oxidase subunit II	NA	NA	NA	NA
WP_011409574.1\|4426561_4427038_-	DUF2244 domain-containing protein	NA	NA	NA	NA
WP_011260487.1\|4427314_4430515_+	bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase PutA	NA	NA	NA	NA
WP_094187805.1\|4430674_4431653_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.9e-38	41.4

DBSCAN-SWA_29

4444951 : 4520740

Acidithiobacillus_phage(23.08%)

tRNA,integrase,transposase

attL 4450821:4450841|attR 4518940:4518960

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_094187806.1\|4444951_4446053_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.1e-39	40.5
WP_011409585.1\|4446657_4448889_-	NADP-dependent isocitrate dehydrogenase	NA	NA	NA	NA
WP_069960113.1\|4449078_4450791_+	hypothetical protein	NA	NA	NA	NA
4450821:4450841	attL	NA	NA	NA	NA
WP_069960029.1\|4450939_4452316_+\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	3.7e-80	56.5
WP_115801910.1\|4454523_4455322_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_143699981.1\|4456420_4456804_+	hypothetical protein	NA	NA	NA	NA
WP_075240159.1\|4457422_4457653_+	hypothetical protein	NA	NA	NA	NA
WP_011258802.1\|4457910_4458879_-\|transposase	IS5-like element ISXo1 family transposase	A0A077K814	Ralstonia_phage	8.7e-100	60.3
WP_069960033.1\|4459045_4460017_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	7.2e-38	34.9
WP_011409594.1\|4460209_4461394_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	5.0e-41	44.8
WP_011260517.1\|4461861_4462677_-	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A2I7SAX1	Vibrio_phage	7.4e-36	35.8
WP_069960034.1\|4463435_4464752_-	amidohydrolase	NA	NA	NA	NA
WP_011260520.1\|4465011_4466256_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_011260521.1\|4466348_4469597_+	MMPL family transporter	NA	NA	NA	NA
WP_011409597.1\|4469730_4472871_+	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_011409598.1\|4473160_4474528_-	VOC family protein	NA	NA	NA	NA
WP_012443929.1\|4474537_4474747_+	hypothetical protein	NA	NA	NA	NA
WP_109182121.1\|4475272_4476238_-\|transposase	IS1595-like element ISXo5 family transposase	NA	NA	NA	NA
WP_027703675.1\|4478084_4478555_+	thioesterase	NA	NA	NA	NA
WP_011409601.1\|4478583_4479006_+	hypothetical protein	NA	NA	NA	NA
WP_011260528.1\|4479081_4479516_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_011260529.1\|4479625_4480141_+	protein-export chaperone SecB	NA	NA	NA	NA
WP_011409602.1\|4480156_4481182_+	NAD(P)-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_011260531.1\|4481504_4482101_-	Ax21 family protein	NA	NA	NA	NA
WP_069970157.1\|4482458_4484186_+	ubiquinone-dependent pyruvate dehydrogenase	NA	NA	NA	NA
WP_011260533.1\|4484235_4485678_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_011260534.1\|4485662_4487009_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_011409603.1\|4487199_4487949_+	hypothetical protein	NA	NA	NA	NA
WP_011260536.1\|4488050_4488662_+	hypothetical protein	NA	NA	NA	NA
WP_011260537.1\|4488766_4489990_+	MFS transporter	NA	NA	NA	NA
WP_011260538.1\|4490331_4490808_-\|tRNA	tRNA (cytidine(34)-2'-O)-methyltransferase	NA	NA	NA	NA
WP_011409604.1\|4490834_4491296_-	hypothetical protein	NA	NA	NA	NA
WP_010370565.1\|4491681_4492002_+	DUF4156 domain-containing protein	NA	NA	NA	NA
WP_011260540.1\|4492103_4493120_+	3-oxoacyl-ACP synthase III	NA	NA	NA	NA
WP_011260541.1\|4493191_4494355_+	Fic family protein	NA	NA	NA	NA
WP_011260542.1\|4494351_4495983_+	site-specific DNA-methyltransferase	A0A2K5B2C1	Erysipelothrix_phage	1.7e-63	37.5
WP_042465275.1\|4495984_4498486_+	helicase SNF2	NA	NA	NA	NA
WP_011260544.1\|4498482_4499385_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_011409606.1\|4499606_4499990_-	YkgJ family cysteine cluster protein	NA	NA	NA	NA
WP_011260546.1\|4500308_4501979_+	AMP-binding protein	NA	NA	NA	NA
WP_011409607.1\|4502207_4503218_+	NAD-dependent epimerase/dehydratase family protein	A0A0E3FNQ3	Synechococcus_phage	1.5e-14	32.6
WP_011260548.1\|4503282_4503441_+	DUF1328 domain-containing protein	NA	NA	NA	NA
WP_011260549.1\|4503675_4505052_+\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	5.0e-77	55.1
WP_041182305.1\|4505062_4505596_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_011409609.1\|4506024_4507284_-	HD-GYP domain-containing protein	NA	NA	NA	NA
WP_011260552.1\|4507422_4508730_-	MFS transporter	NA	NA	NA	NA
WP_011407587.1\|4510814_4511849_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	8.0e-43	32.8
WP_011409611.1\|4512199_4512745_+	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_011409612.1\|4512770_4513037_-	proteinase inhibitor	NA	NA	NA	NA
WP_069970158.1\|4513211_4515050_+	dihydroxy-acid dehydratase	NA	NA	NA	NA
WP_069970159.1\|4515280_4516156_-\|integrase	integron integrase	A0A1P8DJJ6	Virus_Rctr41k	5.3e-56	48.5
WP_082323438.1\|4516239_4517616_+\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	3.5e-78	55.8
WP_012445230.1\|4517642_4518878_-\|transposase	ISL3-like element ISXoo13 family transposase	NA	NA	NA	NA
WP_103057293.1\|4519299_4519563_-	xanthomonadin biosynthesis protein	NA	NA	NA	NA
4518940:4518960	attR	NA	NA	NA	NA
WP_069970161.1\|4519756_4520740_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	2.6e-99	61.5

DBSCAN-SWA_30

4641631 : 4699348

Leptospira_phage(33.33%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_109182036.1\|4641631_4642597_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_011260658.1\|4642697_4643123_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_094187715.1\|4643165_4643928_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011260659.1\|4643990_4645022_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	2.0e-70	42.9
WP_011260660.1\|4646382_4647639_+	alanine--glyoxylate aminotransferase family protein	NA	NA	NA	NA
WP_011260661.1\|4647635_4648526_+	allantoinase PuuE	NA	NA	NA	NA
WP_012443820.1\|4648522_4648918_+	DUF3225 domain-containing protein	NA	NA	NA	NA
WP_075239612.1\|4648937_4649516_+	2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase	NA	NA	NA	NA
WP_143698279.1\|4649401_4650265_+	hydroxyisourate hydrolase	NA	NA	NA	NA
WP_155296491.1\|4650261_4651581_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_094187715.1\|4655023_4655787_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011260667.1\|4657182_4659267_-	S9 family peptidase	NA	NA	NA	NA
WP_011260668.1\|4659366_4661394_-	acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha	NA	NA	NA	NA
WP_011260669.1\|4661636_4663247_-	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	1.1e-19	51.5
WP_011260670.1\|4663257_4664421_-	isovaleryl-CoA dehydrogenase	NA	NA	NA	NA
WP_011409694.1\|4664549_4665170_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_012443812.1\|4665500_4665689_-	hypothetical protein	NA	NA	NA	NA
WP_011260672.1\|4665731_4666067_-	DUF3325 domain-containing protein	NA	NA	NA	NA
WP_075242289.1\|4667691_4668003_-	DUF3649 domain-containing protein	NA	NA	NA	NA
WP_011409699.1\|4669121_4669640_+	cytochrome c5 family protein	NA	NA	NA	NA
WP_012443806.1\|4669910_4671629_+	ExeM/NucH family extracellular endonuclease	NA	NA	NA	NA
WP_011260679.1\|4671719_4672106_-	MerC family mercury resistance protein	NA	NA	NA	NA
WP_011260680.1\|4672167_4673493_+	GTP-binding protein	NA	NA	NA	NA
WP_050580196.1\|4673607_4674921_-	hypothetical protein	NA	NA	NA	NA
WP_011260682.1\|4675019_4675745_-	hypothetical protein	NA	NA	NA	NA
WP_011409701.1\|4675961_4676624_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_011409702.1\|4676702_4677797_+	cell division protein ZapE	NA	NA	NA	NA
WP_011409705.1\|4679301_4682061_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	3.5e-146	35.9
WP_011409706.1\|4682313_4683903_-	sulfotransferase family protein	NA	NA	NA	NA
WP_011409707.1\|4683902_4686140_-\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_011409708.1\|4686428_4687337_-\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
WP_011409709.1\|4687426_4689241_+	type II/IV secretion system protein	NA	NA	NA	NA
WP_153303324.1\|4689626_4698452_-	hypothetical protein	NA	NA	NA	NA
WP_115801913.1\|4698550_4699348_+\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_31

4709524 : 4784231

Escherichia_phage(20.0%)

tRNA,tail,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011260702.1\|4709524_4710442_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	3.1e-83	62.5
WP_011259480.1\|4711045_4712383_+	xylose isomerase	NA	NA	NA	NA
WP_011409721.1\|4712608_4713676_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_011409722.1\|4713851_4716047_+	alpha-glucuronidase	NA	NA	NA	NA
WP_011409723.1\|4716043_4718008_+	9-O-acetylesterase	NA	NA	NA	NA
WP_011409724.1\|4718019_4719279_+	D-galactonate dehydratase family protein	Q6A202	Oenococcus_phage	3.5e-40	26.0
WP_011260707.1\|4719278_4720979_+	glycoside hydrolase family 43 protein	NA	NA	NA	NA
WP_080493943.1\|4720981_4723696_+	glycoside hydrolase family 3 protein	NA	NA	NA	NA
WP_011260709.1\|4723918_4725391_+	mannitol dehydrogenase family protein	G8DCZ3	Micromonas_pusilla_virus	4.5e-47	32.1
WP_069970164.1\|4726368_4727424_-	hypothetical protein	NA	NA	NA	NA
WP_069970165.1\|4727651_4729070_-	glucuronate isomerase	NA	NA	NA	NA
WP_069960283.1\|4729110_4730088_-	endo-1,4-beta-xylanase	NA	NA	NA	NA
WP_113014009.1\|4731504_4732986_-	MFS transporter	NA	NA	NA	NA
WP_155296492.1\|4733327_4736201_+	TonB-dependent receptor	NA	NA	NA	NA
WP_011409728.1\|4736299_4737787_+	MFS transporter	NA	NA	NA	NA
WP_011260718.1\|4737818_4738853_+	family 43 glycosylhydrolase	NA	NA	NA	NA
WP_094187716.1\|4739269_4740067_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_082324403.1\|4740943_4741081_-	hypothetical protein	NA	NA	NA	NA
WP_109182039.1\|4741373_4742330_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_094187715.1\|4743057_4743820_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_075242372.1\|4743837_4744938_+	EAL domain-containing protein	NA	NA	NA	NA
WP_011260725.1\|4745003_4746125_-	acyl-CoA desaturase	NA	NA	NA	NA
WP_011260726.1\|4746134_4747229_-	ferredoxin reductase	NA	NA	NA	NA
WP_011260727.1\|4747303_4747984_+	HTH-type transcriptional repressor FabR	NA	NA	NA	NA
WP_109182041.1\|4748016_4748815_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011409735.1\|4748943_4750263_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_069970189.1\|4750365_4751322_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	4.0e-41	35.6
WP_011260733.1\|4752788_4753247_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_011409738.1\|4753348_4753777_+	organic hydroperoxide resistance protein	NA	NA	NA	NA
WP_069960048.1\|4754023_4754887_-	DUF2884 family protein	NA	NA	NA	NA
WP_042465346.1\|4758063_4758330_-	hypothetical protein	NA	NA	NA	NA
WP_011260739.1\|4758491_4758740_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011409743.1\|4758948_4759707_-	hypothetical protein	NA	NA	NA	NA
WP_042465805.1\|4759703_4760399_-	hypothetical protein	NA	NA	NA	NA
WP_011409745.1\|4760497_4760830_-	hypothetical protein	NA	NA	NA	NA
WP_011409747.1\|4761301_4761736_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_069960049.1\|4761851_4762097_-	hypothetical protein	NA	NA	NA	NA
WP_011260743.1\|4762432_4762765_+	hypothetical protein	NA	NA	NA	NA
WP_011260744.1\|4763013_4763112_+	hypothetical protein	NA	NA	NA	NA
WP_027703652.1\|4763214_4764609_-	nucleoside hydrolase	NA	NA	NA	NA
WP_011260746.1\|4765537_4765828_-	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	1.5e-15	53.8
WP_012443754.1\|4765845_4766127_-	plasmid maintenance system killer protein	A0A222YWE2	Escherichia_phage	3.1e-10	40.7
WP_069960050.1\|4766221_4768474_-	exodeoxyribonuclease V subunit alpha	A0A0K2FLP8	Brevibacillus_phage	1.8e-10	21.9
WP_044756262.1\|4768661_4772735_-	exodeoxyribonuclease V subunit beta	S5MMD7	Bacillus_phage	4.1e-10	22.5
WP_044756261.1\|4772731_4776145_-	exodeoxyribonuclease V subunit gamma	NA	NA	NA	NA
WP_113175344.1\|4776261_4776483_+	hypothetical protein	NA	NA	NA	NA
WP_082323416.1\|4782561_4782804_-	hypothetical protein	NA	NA	NA	NA
WP_011409756.1\|4783089_4783635_+\|tail	phage tail protein	A0A0U4JXW2	Arthrobacter_phage	1.9e-11	32.9
WP_011260754.1\|4783703_4784231_+\|tail	phage tail protein	A0A218M5J0	Arthrobacter_phage	1.2e-15	33.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP013679

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection