CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP015223	Bacillus subtilis strain HRBS-10TDI13 plasmid unnamed, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP015222	Bacillus subtilis strain HRBS-10TDI13 chromosome, complete genome	2 crisprs	csa3,cas3,DEDDh,WYL,DinG	0	1	16	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015222_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015222_1

981521-981626

Orphan

Consensus_repeat	Method
AGAAAACAAAACCAACAATCAGCTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015222_1

>merge|NZ_CP015222|1|981521-981626|CRISPRCasFinder
AGAAAACAAAACCAACAATCAGCTGCTGGTCAAGGTCAATTTGGCACTGAATTTGCTAGCGAAACAAACGCTCAGCAAGTCAGAAAACAAAACCAGCAATCAGCTG

>NZ_CP015222|1|1|981521-981626|CRISPRCasFinder
AGAAAACAAAACCAACAATCAGCTG	CTGGTCAAGGTCAATTTGGCACTGAATTTGCTAGCGAAACAAACGCTCAGCAAGTC
AGAAAACAAAACCAGCAATCAGCTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015222.1\|WP_014479220.1\|973302_974163_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP015222.1\|WP_003243727.1\|989093_989978_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379641
NZ_CP015222.1\|WP_003223262.1\|980654_981407_+\|enoyl-[acyl-carrier-protein]-reductase-FabL	unknown	unknown	gnl\|CDD\|236145
NZ_CP015222.1\|WP_069837384.1\|975454_978040_+\|YfhO-family-protein	unknown	unknown	gnl\|CDD\|226888
NZ_CP015222.1\|WP_003243789.1\|971966_972236_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379438
NZ_CP015222.1\|WP_014479218.1\|972380_972899_+\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|214600
NZ_CP015222.1\|WP_003233542.1\|980348_980573_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015222.1\|WP_009966836.1\|982923_984666_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP015222.1\|WP_003244113.1\|974393_975383_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133030
NZ_CP015222.1\|WP_014479222.1\|979231_980341_+\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|130156
NZ_CP015222.1\|WP_087614160.1\|996982_998133_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP015222.1\|WP_014479219.1\|972983_973316_+\|SdpC-immunity-protein-SpdL	unknown	unknown	gnl\|CDD\|227945
NZ_CP015222.1\|WP_014479226.1\|988532_988886_-\|YgzB-family-protein	unknown	unknown	gnl\|CDD\|371346
NZ_CP015222.1\|WP_014476212.1\|978032_979016_-\|metal-dependent-hydrolase	unknown	unknown	gnl\|CDD\|224899
NZ_CP015222.1\|WP_003233532.1\|987464_987938_+\|thioredoxin-dependent-thiol-peroxidase	unknown	unknown	gnl\|CDD\|224146
NZ_CP015222.1\|WP_069837385.1\|984742_985804_-\|aromatic-acid-exporter-family-protein	unknown	unknown	gnl\|CDD\|226614
NZ_CP015222.1\|WP_015715541.1\|986023_987313_-\|glutamate-1-semialdehyde-2,1-aminomutase	unknown	unknown	gnl\|CDD\|183493
NZ_CP015222.1\|WP_003223285.1\|988060_988498_+\|peroxide-responsive-transcriptional-repressor-PerR	unknown	unknown	gnl\|CDD\|223806
NZ_CP015222.1\|WP_015252512.1\|981818_982163_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372951
NZ_CP015222.1\|WP_003223272.1\|982306_982837_+\|DUF402-domain-containing-protein	unknown	unknown	gnl\|CDD\|184219

Protein	Function_ID	Function_description	E-value
NZ_CP015222.1\|WP_014479220.1\|973302_974163_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	2.76887e-38
NZ_CP015222.1\|WP_003243727.1\|989093_989978_+\|hypothetical-protein	gnl\|CDD\|379641	pfam14540, NTF-like, Nucleotidyltransferase-like. Structural comparisons with Structure 1kny indicate that this N-terminal domain resembles a nucleotidyltransferase fold.	1.16999e-58
NZ_CP015222.1\|WP_003223262.1\|980654_981407_+\|enoyl-[acyl-carrier-protein]-reductase-FabL	gnl\|CDD\|236145	PRK08063, PRK08063, enoyl-[acyl-carrier-protein] reductase FabL.	2.59874e-172
NZ_CP015222.1\|WP_069837384.1\|975454_978040_+\|YfhO-family-protein	gnl\|CDD\|226888	COG4485, COG4485, Predicted membrane protein [Function unknown].	0
NZ_CP015222.1\|WP_003243789.1\|971966_972236_+\|hypothetical-protein	gnl\|CDD\|379438	pfam14043, WVELL, WVELL protein. This family includes the B. subtilis YfjH protein, which is functionally uncharacterized. This is not a homolog of E. coli YfjH, a synonym for IscX, which belongs to pfam04384. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length and contain a highly conserved WVELL motif.	4.98563e-41
NZ_CP015222.1\|WP_014479218.1\|972380_972899_+\|SH3-domain-containing-protein	gnl\|CDD\|214600	smart00287, SH3b, Bacterial SH3 domain homologues.	1.93802e-13
NZ_CP015222.1\|WP_009966836.1\|982923_984666_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	0
NZ_CP015222.1\|WP_003244113.1\|974393_975383_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	2.54502e-85
NZ_CP015222.1\|WP_014479222.1\|979231_980341_+\|A/G-specific-adenine-glycosylase	gnl\|CDD\|130156	TIGR01084, A/G-specific_adenine_glycosylase, A/G-specific adenine glycosylase. This equivalog model identifies mutY members of the pfam00730 superfamily (HhH-GPD: Helix-hairpin-helix and Gly/Pro rich loop followed by a conserved aspartate). The major members of the superfamily are nth and mutY. [DNA metabolism, DNA replication, recombination, and repair].	5.39938e-157
NZ_CP015222.1\|WP_087614160.1\|996982_998133_+\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	9.5844e-41
NZ_CP015222.1\|WP_014479219.1\|972983_973316_+\|SdpC-immunity-protein-SpdL	gnl\|CDD\|227945	COG5658, COG5658, Predicted integral membrane protein [Function unknown].	7.58487e-27
NZ_CP015222.1\|WP_014479226.1\|988532_988886_-\|YgzB-family-protein	gnl\|CDD\|371346	pfam11023, DUF2614, Zinc-ribbon containing domain. This is a family of proteins conserved in the Bacillaceae family. Some members are annotated as being protein YgzB. The function is not known.	7.28983e-70
NZ_CP015222.1\|WP_014476212.1\|978032_979016_-\|metal-dependent-hydrolase	gnl\|CDD\|224899	COG1988, COG1988, Predicted membrane-bound metal-dependent hydrolases [General function prediction only].	3.46531e-44
NZ_CP015222.1\|WP_003233532.1\|987464_987938_+\|thioredoxin-dependent-thiol-peroxidase	gnl\|CDD\|224146	COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones].	6.45936e-86
NZ_CP015222.1\|WP_069837385.1\|984742_985804_-\|aromatic-acid-exporter-family-protein	gnl\|CDD\|226614	COG4129, COG4129, Predicted membrane protein [Function unknown].	9.93201e-90
NZ_CP015222.1\|WP_015715541.1\|986023_987313_-\|glutamate-1-semialdehyde-2,1-aminomutase	gnl\|CDD\|183493	PRK12389, PRK12389, glutamate-1-semialdehyde aminotransferase; Provisional.	0
NZ_CP015222.1\|WP_003223285.1\|988060_988498_+\|peroxide-responsive-transcriptional-repressor-PerR	gnl\|CDD\|223806	COG0735, Fur, Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism].	2.19115e-56
NZ_CP015222.1\|WP_015252512.1\|981818_982163_+\|hypothetical-protein	gnl\|CDD\|372951	pfam14182, YgaB, YgaB-like protein. The YgaB-like protein family includes the B. subtilis YgaB protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length.	7.7337e-29
NZ_CP015222.1\|WP_003223272.1\|982306_982837_+\|DUF402-domain-containing-protein	gnl\|CDD\|184219	PRK13662, PRK13662, hypothetical protein; Provisional.	7.36814e-127

>NZ_CP015222.1|WP_003223262.1|980654_981407_+|enoyl-[acyl-carrier-protein]-reductase-FabL
MEQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPNREDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSLLV
>NZ_CP015222.1|WP_003233542.1|980348_980573_-|hypothetical-protein
MYVGRDMSELNMVSKKDWKNSELAYFHHAFQQIMPYLNEEGQSKYRELTQEIEARGGMKRNEADYSHGTRVSYD
>NZ_CP015222.1|WP_014479222.1|979231_980341_+|A/G-specific-adenine-glycosylase
MNVLEDKLKQKDIQQFRDDLISWFEREQRVLPWREDQDPYKVWVSEVMLQQTRVETVIPYFLRFVEQFPTVEALADADEEKVLKAWEGLGYYSRVRNLQSAVKEVKQEYGGIVPPDEKDFGGLKGVGPYTKGAVLSIAYNKPIPAVDGNVMRVMSRILSIWDDIAKPKTRTIFEDAIRAFISKEKPSEFNQGLMELGALICTPKSPSCLLCPVQQHCSAFEEGTERELPVKSKKKKPGIKTMAAIVLTDEDGQVYIHKRPSKGLLANLWEFPNLETQKGIKTEREQLIAFLENEYGIQADISDLQGVVEHVFTHLVWNISVFFGKVKQVSDTSKLKKVTKEELEQFAFPVSHQKIWKMAVEAAAISAAP
>NZ_CP015222.1|WP_014476212.1|978032_979016_-|metal-dependent-hydrolase
MDTGTHVVMGIALGGIATLDPVVGSDPAMAHAVMIATLAGSQAPDIDTVLKLKNNAVYIRNHRGFTHSIPAVLFWSVIIPAILYLFYPQADFLHLWLWTLLAVVLHVFVDIFNAYGTQAIRPFSKKWVALGLINTFDPFIFISHLAAIAIWYAGGSPGITFLSLYIILAGYYLVRLIMQLRIKRKLHEMIHDEIESIIISPTMKFRQWRIAVTTAHAFYVGRSMEGHVVILDTFNRVPVPETDVMHAAKQDDNIAAFLSFSPVYRWEVDTFKDHYEVRFIDLRYRSKGHYPFVAIVHIGHDLTIRSSYTGWIFSEEKLQKKLKLGSI
>NZ_CP015222.1|WP_069837384.1|975454_978040_+|YfhO-family-protein
MKRKHIMIYAASLLVSVLAHAFFVKEWAEGRYMTGPGDGLAQMIVFKKLLFDQYTHGNFFYNYSFGLGGGTFSQLGYYFSASFLFLAVSAAVWLLQAVQLIGEADTLFWAESAVFISIFKLSLIIFTSASVFHYLLKHRAASFTGAVLYGVSIIYFRHEAYWEFFTDTMVWLPLLVFGAEKIIRERRPAWFIVACSLTLINNFYFAYINLIFIGIYLLFRWLIRLEPHEEKRWIQIRLFLVSGFISFGISAAAFVPVVYGFLNNLRPPYSQKIEWLNFDDNILFSSRIIIVPAAFLLFLFIISFYKNRVFRLFAGLSLLFILFHFSPYAASVFNGFSAPQNRFEYVLAFTIAGAAAAGLSQLSDLKRKELLPAAAVVLLLYLYHIQRYKLDIWKPANESILLLLLMTIAALFAAAFAKKRAKMAVYGIIILSSLFVANSYQKYALSEGGDLDSVTKEYLTSEEYRGRESSELIRRLQKENDDPLMRIDWMNGVRNNTPIIYGFNGFSAYSSILNKDLLAFYWNDLSIDMGRESVSRYASLGDRANLYSLLYGKYYMTEKTNEASVPYGFKKHLETEHYAVYENQYMLPFVKTADAIYSESELDRLPALAKEQAMLKGIILKDPSGKTEQTPKQSNLITKSDITAKQAQYQNGLLTVTGENGGELIITPKQPSSAPGDYYVSFYLKSKAKDRGFALKVNDYVTTRKSNKSIYKTGVNNITVRVPKSGHISINLPKGTYELRNIALYEENYQTLKNAVMQNKTEKADKLNWNKNRLTFAYHLSKDQYIMLPIPYEKGWELKINGKTQKIEKADYAFIGFKAQKGDNHIELTYYPPYFKISAIISLVSLLLAVFYIRRKKPGSI
>NZ_CP015222.1|WP_003244113.1|974393_975383_+|glycosyltransferase-family-2-protein
MKQGLISIIIPSYNEGYNVKLIHESLKKEFKNIHYDYEIFFINDGSVDDTLQQIKDLAATCSRVKYISFSRNFGKEAAILAGFEHVQGEAVIVMDADLQHPTYLLKEFIKGYEEGYDQVIAQRNRKGDSFVRSLLSSMYYKFINKAVEVDLRDGVGDFRLLSRQAVNALLKLSEGNRFSKGLFCWIGFDQKIVFYENVERKNGTSKWSFSSLFNYGMDGVVSFNHKPLRLCFYTGIFILLLSIIYIIATFVKILTNGISVPGYFTIISAVLFLGGVQLLSLGIIGEYIGRIYYETKKRPHYLIKEANIPNKDLPETNELKSMRRLTKMH
>NZ_CP015222.1|WP_014479220.1|973302_974163_+|alpha/beta-hydrolase
MDGVKCQFVNTNGITLHVAAAGPEDGPLIVLLHGFPEFWYGWKNQIKPLVDAGYRVIAPDQRGYNLSDKPEGIDSYRIDTLRDDIIGLITQFTDEKAIVIGHDWGGAVAWHLASTRPEYLEKLIAINIPHPHVMKTVTPLYPPQWLKSSYIAYFQLPDIPEASLRENDYETLDKAIGLSDRPALFTSEDVSRYKEAWKQPGALTAMLNWYRALRKGSLAEKPSYETVPYRMIWGMEDRFLSRKLAKETERHCPNGHLIFVDEASHWINHEKPAIVNQLILEYLKNQ
>NZ_CP015222.1|WP_014479219.1|972983_973316_+|SdpC-immunity-protein-SpdL
MTDLVGGGLMIIAGILIKLFPPKSINSVYGYRTRRSMSDQRLWNEANRYSASLMILSGLVIAGMGLLLGSNLFILQLILLIAACVITFMLTEKRLKIMTHSQGGDRSGRS
>NZ_CP015222.1|WP_014479218.1|972380_972899_+|SH3-domain-containing-protein
MKKKQVMLALTAAAGLGLTALHSAPAAKAAPLHDISVSMPSSDTYIIKAGKLNVRTEPNHEGDILGTVSSEQKVKVDRFVNADWAQIHFKGKKAYISTHFLMKTASQAKTTKQTAFYAPTPENGKAKQLSSGTEVTILGWGFSENGGFDFTWAFVDYGGVKGYIHTKDLQMR
>NZ_CP015222.1|WP_003243789.1|971966_972236_+|hypothetical-protein
MNMYIEKLTNLLLEKNEMISYIQAKTWVELLWSDFEATYAKAGHAYQGEKMTEKIVTQWIENYGGQLHLFQSSRNDVNDYLNQSRGLLH
>NZ_CP015222.1|WP_015252512.1|981818_982163_+|hypothetical-protein
MSQRVCFTEIEMIKGGNVYTFIRLKEEPMTEFEKLVSEQMKTMDKLLDLQSELDRCKQIEAELRHLERDARLRGIQAEIAVKRKHLADIQDMFQKQTEQVIRSYRSSEKPSSFV
>NZ_CP015222.1|WP_003223272.1|982306_982837_+|DUF402-domain-containing-protein
MGYPKEGETIQIHSYKHNGLIHRIWNETTILKSTEMCVIGANDRTMVTESDGRTWITREPAICYFHARQWFNVIGMLREDGVHYYCNISSPFAYDGEAIKYIDYDLDVKVFPDMTYNILDEDEYDDHRKAMNYPKEIDSILRDYLNTLLHWIHQRQGPFAPEFVDMWYERYLRYTK
>NZ_CP015222.1|WP_009966836.1|982923_984666_+|ABC-transporter-ATP-binding-protein
MGVMKRYMQFVKPYKKQIFVTVLIGIVKFSIPLALPLLLKYVVDDIIQGGGTASDKTTSLFTIMAIMFALFLILRPPVEYYRQYFAQWTASKVLYDIRAKLFDHIQKLSLRFYANTRTGEVISRVINDVEQTKDFVITGLMNIWLDMLTILIVISIMLTLDVKLTLISIVLFPLYGISVKYFYGRLRKLTRERSQALAQVQGHLHERIQGMPVIRSFAIEDHEQAQFNEKNGHFLDKAIRHTNWNAKTFAVVNTITDLAPLIVIACAGYFVINGPLTVGTMVAFVGYIDRMYNPVRRLINSSTTLTQSIASMDRVFEFIDEPYELTDKPNAIKADQIRGGVEFQNVSFQYEKDKENILHDVSLKVNRGETVALVGMSGGGKSTLVSLIPRFYDVTSGRLLIDGTDIRDYEARSLRNQVGMVLQDTFLFSETIRENIAIGKPDATLEEIIEAAKAANAHEFIMSFPEGYETRVGERGVKLSGGQKQRISIARVFLKNPPLLILDEATSALDLESEHYIQEAMDKLAKDRTTFVVAHRLSTITHADKIVVMENGTIIEIGTHDELMDYESQYKHLFTIQNLN
>NZ_CP015222.1|WP_069837385.1|984742_985804_-|aromatic-acid-exporter-family-protein
MKLGARIFKTGIAITLALYLASWIGLPAPIFAGIAAIFAIQPSIYRSFLIIIDQVQANIIGAVIATVFGLIFGPSPIMIGLTAVIVITIMLKLKIEHTISIALVTVIAILESAVDDFLMFALIRTSTVILGVLSSFIVNLVFLPPKYETKLIHNTVENTEEIMKWIRLSMRQSTEHSILKEDIEKLKEKMIKLDQTYLLYKEERSYFKKTTYVKSRKLVLFRQAIITANRALDTLKKLHRLENEIYHMPEEFQETLTEELDYLLYWHERILMRFVGKIKPHDDAVEEGIRYKQLLTKSFLKNQQNTDEELIDYNMLNIMASAVEYREQLEHLETLITSFQTYHPKDCEIETEE
>NZ_CP015222.1|WP_015715541.1|986023_987313_-|glutamate-1-semialdehyde-2,1-aminomutase
MHTKSIELHNEALQHIVGGVNSPSRSYKAVGGGSPVAMEKASGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITEAIKKAAENGVLYGTPTKHEVTFAKMLKEAIPAMDKVRFVNSGTEAVMTTIRVARAYTGRTKIIKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPKSIANEVITVPFNDIDSYKAALDKWGSEIAAVLVEPIVGNFGIVEPKEGFLEKVNELTHNAGALVIYDEVITAFRFMYGGAQDLLQVKPDLTALGKIIGGGLPIGAYGGKQEIMEQVAPLGPAYQAGTMAGNPASILSGIACLEVLKEKGVYEKLDHLGAMLEEGILKHAETHGITITVNRLKGALTVYFSDEKVENYEQAERSDGETFATFFKLMLERGINLAPSKYEAWFITTAHTEQDIKDTLAAVEDAFKHLKN
>NZ_CP015222.1|WP_003233532.1|987464_987938_+|thioredoxin-dependent-thiol-peroxidase
MTIEIGQKAPDLELKGDHGETVKLSDYKGKYIVLYFYPKDMTPGCTTEACDFRDSHESFAELDAVIIGVSPDSQEKHGKFKEKHNLPFLLLVDDEHKLAEAFDVWKLKKNFGKEYMGIERSTFLIDKEGRLIKEWRKVKVKDHVAEALQTLKDMSEK
>NZ_CP015222.1|WP_003223285.1|988060_988498_+|peroxide-responsive-transcriptional-repressor-PerR
MAAHELKEALETLKETGVRITPQRHAILEYLVNSMAHPTADDIYKALEGKFPNMSVATVYNNLRVFRESGLVKELTYGDASSRFDFVTSDHYHAICENCGKIVDFHYPGLDEVEQLAAHVTGFKVSHHRLEIYGVCQECSKKENH
>NZ_CP015222.1|WP_014479226.1|988532_988886_-|YgzB-family-protein
MAKYSSKINKIRTFALSLVFVGFIIMYIGIFFKESVLLSSLFMILGLLSIGLSTVVYFWIGMLSTKAVRVICPGCDKETKVLGRVDMCMHCREPLTLDKGLEGKEFDESYNKKKMSK
>NZ_CP015222.1|WP_003243727.1|989093_989978_+|hypothetical-protein
MENLLRPIYQERASHPNTLAVIMIERRNKTSSLTDNFDAALLVIVKDADEPVFIKHYEFDHQTASLHVVTDSQIQEWILLGTNRRIIDWIVNGRVLFDRNEYVVELIDRLNTFPFAERKLKIGLEYGKLIRRYVEGKAFFEANQFLDAYNAVVHALHHLARIEVIDRGFHPETTVWSQVRQMEPQVYKLYSELIESHESLEKRLELLFLANDFLIHSKAEIGSAHLFEVMKEKDIWQFGELLQHHDLKHFTQDLGVMLDYLTEKGLINVCQIETKGQAVYHRGYSFKKGVDSDS
>NZ_CP015222.1|WP_087614160.1|996982_998133_+|IS3-family-transposase
MGTRVSYPVEVKQKAVEMRLAGVPMKEIMQELNIKNNTQIKTWVRWYKAGDTHRFEQPVGKQYTYGKGPEYSSELEKLQAENRYLRQQNEVFKKVQRIGKEVDSQTSVELVEELHSTMTVQDICIHLGISRSSYYRWKKNLKKDHPKRHLEKQIGTLCREHQYRYGYRKITAILKKRMCINHKTVQRIMQKNQWQCRVKVKKRKKNGQPYAVVDNILDRNFQSDHPLEKLVTDITYLPYGQKQLYLSSILDVYNGEVIAFTIGDKQDTDFVLHTLDQLPTLPENCVLHSDQGSVYTSYEYQKAVKTKGITMSMSRKGTPADNASIESFHSSLKSETFYLNSIDRTTTAIVERTVIEYIHYYNNIRIQTKLNNQSPINYRQLAV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015222_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015222_2

3048795-3048902

Orphan

Consensus_repeat	Method
TGATGGGAATCGAACCCACGACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015222_2

>merge|NZ_CP015222|2|3048795-3048902|CRISPRCasFinder
TGATGGGAATCGAACCCACGACATCAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGATTGATGGGAATCGAACCCACGAATG

>NZ_CP015222|2|2|3048795-3048902|CRISPRCasFinder
TGATGGGAATCGAACCCACGACAT	CAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGAT
TGATGGGAATCGAACCCACGAATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015222.1\|WP_014480656.1\|3057010_3058540_-\|flotillin-lipid-rafts-scaffold-protein-FloT	unknown	unknown	gnl\|CDD\|225177
NZ_CP015222.1\|WP_033881498.1\|3059252_3059741_+\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
NZ_CP015222.1\|WP_003243227.1\|3061992_3063201_-\|choline-dehydrogenase	unknown	unknown	gnl\|CDD\|341481
NZ_CP015222.1\|WP_014480653.1\|3042655_3044110_-\|glycogen-synthase-GlgA	unknown	unknown	gnl\|CDD\|234809
NZ_CP015222.1\|WP_072592554.1\|3038621_3039695_+\|spore-coat-kinase-CotI	unknown	unknown	gnl\|CDD\|131952
NZ_CP015222.1\|WP_014480648.1\|3036228_3037284_-\|spore-coat-protein-CotS	unknown	unknown	gnl\|CDD\|131952
NZ_CP015222.1\|WP_032727091.1\|3058560_3059085_-\|membrane-protein	unknown	unknown	gnl\|CDD\|376684
NZ_CP015222.1\|WP_015483611.1\|3063217_3064690_-\|betaine-aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143437
NZ_CP015222.1\|WP_003229018.1\|3045161_3046304_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997
NZ_CP015222.1\|WP_014480647.1\|3035798_3036227_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015222.1\|WP_014480651.1\|3039774_3040242_+\|TspO/MBR-family-protein	unknown	unknown	gnl\|CDD\|226007
NZ_CP015222.1\|WP_003228966.1\|3055851_3056430_+\|energy-coupled-thiamine-transporter-ThiT	unknown	unknown	gnl\|CDD\|226377
NZ_CP015222.1\|WP_014480661.1\|3064888_3065431_+\|transcriptional-regulator-GbsR	unknown	unknown	gnl\|CDD\|224427
NZ_CP015222.1\|WP_014480655.1\|3056471_3056993_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224168
NZ_CP015222.1\|WP_069837716.1\|3061326_3061905_-\|molybdenum-cofactor-sulfurase	unknown	unknown	gnl\|CDD\|377051
NZ_CP015222.1\|WP_014478984.1\|3059859_3061212_-\|IS1182-family-transposase	unknown	unknown	gnl\|CDD\|372705
NZ_CP015222.1\|WP_004398841.1\|3044106_3045138_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	unknown	unknown	gnl\|CDD\|273966
NZ_CP015222.1\|WP_069837715.1\|3046300_3048184_-\|1,4-alpha-glucan-branching-enzyme	unknown	unknown	gnl\|CDD\|273667
NZ_CP015222.1\|WP_014480652.1\|3040272_3042669_-\|glycogen/starch/alpha-glucan-phosphorylase	unknown	unknown	gnl\|CDD\|273967
NZ_CP015222.1\|WP_014480649.1\|3037298_3038432_-\|spore-coat-protein-CotSA	unknown	unknown	gnl\|CDD\|340831

Protein	Function_ID	Function_description	E-value
NZ_CP015222.1\|WP_069837716.1\|3061326_3061905_-\|molybdenum-cofactor-sulfurase	gnl\|CDD\|377051	pfam03473, MOSC, MOSC domain. The MOSC (MOCO sulfurase C-terminal) domain is a superfamily of beta-strand-rich domains identified in the molybdenum cofactor sulfurase and several other proteins from both prokaryotes and eukaryotes. These MOSC domains contain an absolutely conserved cysteine and occur either as stand-alone forms or fused to other domains such as NifS-like catalytic domain in Molybdenum cofactor sulfurase. The MOSC domain is predicted to be a sulfur-carrier domain that receives sulfur abstracted by the pyridoxal phosphate-dependent NifS-like enzymes, on its conserved cysteine, and delivers it for the formation of diverse sulfur-metal clusters.	8.64446e-05
NZ_CP015222.1\|WP_033881498.1\|3059252_3059741_+\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	2.35984e-17
NZ_CP015222.1\|WP_014480653.1\|3042655_3044110_-\|glycogen-synthase-GlgA	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0
NZ_CP015222.1\|WP_072592554.1\|3038621_3039695_+\|spore-coat-kinase-CotI	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	4.64632e-132
NZ_CP015222.1\|WP_014480648.1\|3036228_3037284_-\|spore-coat-protein-CotS	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	6.9211e-130
NZ_CP015222.1\|WP_032727091.1\|3058560_3059085_-\|membrane-protein	gnl\|CDD\|376684	pfam01957, NfeD, NfeD-like C-terminal, partner-binding. NfeD-like proteins are widely distributed throughout prokaryotes and are frequently associated with genes encoding stomatin-like proteins (slipins). There appear to be three major groups: an ancestral group with only an N-terminal serine protease domain and this C-terminal beta sheet-rich domain which is structurally very similar to the OB-fold domain, associated with its neighboring slipin cluster; a second major group with an additional middle, membrane-spanning domain, associated in some species with eoslipin and in others with yqfA; a final 'artificial' group which unites truncated forms lacking the protease region and associated with their ancestral gene partner, either yqfA or eoslipin. This NefD, C-terminal, domain appears to be the major one for relating to the associated protein. NfeD homologs are clearly reliant on their conserved gene neighbor which is assumed to be necessary for function, either through direct physical interaction or by functioning in the same pathway, possibly involve with lipid-rafts.	0.000254791
NZ_CP015222.1\|WP_015483611.1\|3063217_3064690_-\|betaine-aldehyde-dehydrogenase	gnl\|CDD\|143437	cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like. Included in this CD is the NAD+-dependent, betaine aldehyde dehydrogenase (BADH, GbsA, EC=1.2.1.8) of Bacillus subtilis involved in the synthesis of the osmoprotectant glycine betaine from choline or glycine betaine aldehyde.	0
NZ_CP015222.1\|WP_003229018.1\|3045161_3046304_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
NZ_CP015222.1\|WP_014480652.1\|3040272_3042669_-\|glycogen/starch/alpha-glucan-phosphorylase	gnl\|CDD\|273967	TIGR02093, Glycogen_phosphorylase, glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP015222.1\|WP_014480651.1\|3039774_3040242_+\|TspO/MBR-family-protein	gnl\|CDD\|226007	COG3476, COG3476, Tryptophan-rich sensory protein (mitochondrial benzodiazepine receptor homolog) [Signal transduction mechanisms].	2.06085e-39
NZ_CP015222.1\|WP_003228966.1\|3055851_3056430_+\|energy-coupled-thiamine-transporter-ThiT	gnl\|CDD\|226377	COG3859, COG3859, Predicted membrane protein [Function unknown].	1.328e-72
NZ_CP015222.1\|WP_014480661.1\|3064888_3065431_+\|transcriptional-regulator-GbsR	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	1.21185e-72
NZ_CP015222.1\|WP_014480656.1\|3057010_3058540_-\|flotillin-lipid-rafts-scaffold-protein-FloT	gnl\|CDD\|225177	COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown].	1.34239e-122
NZ_CP015222.1\|WP_003243227.1\|3061992_3063201_-\|choline-dehydrogenase	gnl\|CDD\|341481	cd08551, Fe-ADH, iron-containing alcohol dehydrogenases (Fe-ADH)-like. This family contains large metal-containing alcohol dehydrogenases (ADH), known as iron-containing alcohol dehydrogenases. They contain a dehydroquinate synthase-like protein structural fold and mostly contain iron. They are distinct from other alcohol dehydrogenases which contains different protein domains. There are several distinct families of alcohol dehydrogenases: Zinc-containing long-chain alcohol dehydrogenases, insect-type, or short-chain alcohol dehydrogenases, iron-containing alcohol dehydrogenases, among others. The iron-containing family has a Rossmann fold-like topology that resembles the fold of the zinc-dependent alcohol dehydrogenases, but lacks sequence homology, and differs in strand arrangement. ADH catalyzes the reversible oxidation of alcohol to acetaldehyde with the simultaneous reduction of NAD(P)+ to NAD(P)H.	1.69004e-175
NZ_CP015222.1\|WP_014478984.1\|3059859_3061212_-\|IS1182-family-transposase	gnl\|CDD\|372705	pfam13751, DDE_Tnp_1_6, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	2.0713e-30
NZ_CP015222.1\|WP_004398841.1\|3044106_3045138_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP015222.1\|WP_069837715.1\|3046300_3048184_-\|1,4-alpha-glucan-branching-enzyme	gnl\|CDD\|273667	TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP\|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI\|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP\|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP015222.1\|WP_014480655.1\|3056471_3056993_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224168	COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane].	3.65478e-10
NZ_CP015222.1\|WP_014480649.1\|3037298_3038432_-\|spore-coat-protein-CotSA	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	2.38164e-74

>NZ_CP015222.1|WP_069837715.1|3046300_3048184_-|1,4-alpha-glucan-branching-enzyme
MAAASPTAHDVYLFHEGSLFKSYQLFGSHYRELNGKSGYEFCVWAPHASEVRVAGDFNSWSGEEHVMHRVNDNGIWTLFIPGIGEKERYKYEIVTNNGEIRLKADPYAIYSEVRPNTASLTYNLEGYSWQDQKWQKKQKAKTLYEKPVFIYELHLGSWKKHSDGRHYSYKELSQTLIPYIKEHGFTHIELLPMYEHPYDRSWGYQGTGYYSPTSRFGTPHDLMKFVDECHQQNIGVILDWVPGHFCKDAHGLYMFDGEPLYEYKEERDRENWLWGTANFDLGKPEVHSFLISNALYWAEFYHIDGFRVDAVANILYWPNQDERHTNPYAVEFLKKLNQTMREAYPHVMMIAEDSTEWPQVTGAVEEGGLGFHYKWNMGWMNDVLKYMETPPEERRHCHQLISFSLLYAFSEHFVLPFSHDEVVYGKKSLLNKMPGDYWQKFAQYRLLLGYMTVHPGKKLIFMGSEFAQFDEWKDTEQLDWFLDSFPMHQKASVFTQDLLRFYQKSKILYEHDHRAQSFEWIDVHNDEQSIFSFIRYGKKHGEALVIICNFTPVVYHQYDVGVPFFTQYIEVLNSDSETYGGSGQINKKPLSAKKGALHHKPCYIMMTIPPYGISILRAVKKRGEIKR
>NZ_CP015222.1|WP_003229018.1|3045161_3046304_-|glucose-1-phosphate-adenylyltransferase
MKKQCVAMLLAGGKGSRLSGLTKNMAKPAVSFGGKYRIIDFTLSNCSNSGIDTVGILTQYQPLELNSYIGIGSAWDLDRYNGGVTVLPPYAESSEVKWYKGTASAIYENLNYLNQYDPEYVLILSGDHIYKMDYGKMLDYHIEKKADVTISVIEVGWEEASRFGIMKANPDGTITHFDEKPKFPKSNLASMGIYIFNWPLLKQYLEMDDQNPYSSHDFGKDIIPLLLEEKKKLSAYPFKGYWKDVGTVQSLWEANMDLLKEDSELKLFERKWKIYSVNPNQPPQFISSDAQVQDSLVNEGCVVYGNVSHSVLFQGVTVGKHTTVTSSVIMPDVTIGEHVVIENAIVPNGMVLPDGAVIRSEKDIEEVLLVSEEFVEKELI
>NZ_CP015222.1|WP_004398841.1|3044106_3045138_-|glucose-1-phosphate-adenylyltransferase-subunit-GlgD
MFNNQMLGVIDETTYKHSLQDLTAQRSLGAIPFAGRYRLIDFMLSNMVNADIRSVAIFPKYRYRSLMDHLGAGKEWDLHRKKDGLFFFPSPHLHHEYDEFGSFRQFSDHLDYFHRSTQQYAVISNSHTVCNIQFQYVLKRHQEVGCDVTEVFQDGQSLQIYIMSTTLLKDLIYGHSEKGYKTIQEAVEKESSALTICPYEYSGYAAVIDSVEKYYTHSMELIQPRFWQQVFLPQQPIYTKVKDEPPTKYGKHSTVKNSLVANGCVLEGEVENCILFRAVHVGKGTKLKNCIIMQKTQIGEDCLLEQVISDKDVKIGKATEAAGTAEQPLVLRKGLVQGELMNS
>NZ_CP015222.1|WP_014480653.1|3042655_3044110_-|glycogen-synthase-GlgA
MKILLAVSECTPFVKSGGLADVAGALPKALARLGNAVAVMLPKYSQIPEPWKKRMKKKAECTVAVGWRQQYCGIEHMAEDDVNYYFIDNEYYFNRDSLYGHYDDGERFAYFSRAVLEAAKVVNVPADIVHTHDWHTAMVNYLLKEEYRKHPFYERMKSVLTIHNLQFQGIFPPDVTHDLLGLEMDHFHYERLECNSFVNFMKAGIIAADHVTTVSPTYRNEILTPYYGEQLEQVLQYREDDVTGILNGIDDTFYQPKSDPYIEAQYDSGDLACKLENKTKLQRRMGLPEKNDIPLISMVTRLTKQKGLDLVRRIMHELLEEQDIQLVVLGTGEREFEDYFRYAEFAFHEKCRAYIGFDEPLAHQIYAGSDMFLMPSKFEPCGLGQLIALQYGAIPIVRETGGLYDTVRAYQEEEGTGNGFTFSAFNAHDLKFTIERALAFYRQQDVWKSIVKTAMNADYSWGKSAKEYQRIFEQVTRSGRDVLE
>NZ_CP015222.1|WP_014480652.1|3040272_3042669_-|glycogen/starch/alpha-glucan-phosphorylase
MFSSKERFADLFLKRLEMTCGKSFKDSVKLDQYKTLGNMVREYISANWIETNEKSRSNSGKQTYYLSIEFLLGQLLEQNLMNLGVRDVVEAGLKEIGINLEEILQIENDAGLGNGGLGRLAACFLDSLASLNLPGHGMGIRYKHGLFEQKIVDGHQVELPEQWLKNGNVWEVRNADQAVDVPFWGEVHMTEKSGRLHFRHEQATIVTAVPYDIPIIGYETGTVNTLRLWNAEPYAHYHGGNILSYKRETEAVSEFLYPDDTHDEGKILRLKQQYFLVCASLKSIVNNYRKTHKSLSGLHKEVSIHINDTHPALAVPELMRILLDEENMSWEEAWHITVHTISYTNHTTLSEALEKWPIHLFKPLLPRMYMIIEEINERFCRAVWEKYPGDWKRIEDMAITAHGVVKMAHLAIVGSYSVNGVAKIHSDILKEREMRDFHLLFPNRFNNKTNGIAHRRWLLKANPGLSAIITEAIGDEWVKQPESLIRLEPYATDPAFIEQFQNNKSKKKQELADLIFCTAGVVVNPDSIFDVQVKRLHAYKRQLLNVLHIMYLYNRLKEDAGFSIYPQTFIFGAKASPSYYYAKKIIKLIHSVAEKVNYDPAVKQLIKVVFLENYRVSMAERIFTASDVSEQISTASKEASGTGNMKFMMNGALTIGTHDGANIEILERVGPDCIYTFGLKADEVLSYQENGGYRSREYYQHDRRIRQVADQLINGFFEGEADEFESIFDSLLPHNDEYFVLKDFSSYADAQERIQADYRERRKWSERSIVNIAHSGYFSSDRTIREYAKDIWGIKPMM
>NZ_CP015222.1|WP_014480651.1|3039774_3040242_+|TspO/MBR-family-protein
MKKIVGALAVFVITYALFSAAGYLFPVDQEWYNSLKKPDWTPSVTAIGIIWATLFALISLSAAIVYAAFSFKGAKSFRFTLLINYVLNQAFSYFQFTQKNLLAASLDCLLVAITAIVLLIIAKKYNRAASYLLLPYYLWSAFATFLSFTINSMNL
>NZ_CP015222.1|WP_072592554.1|3038621_3039695_+|spore-coat-kinase-CotI
MCPLMAENHEVIEEGNSSELPLSAEDAKKLTELAENVLQGWDVQAEKIDVIQGNQMALVWKVHTDSGALCLKRIHRPEKKALFSIFAQDYLAKKGMNVPGILPNKKGSLYSKHGSFLFVVYDWIEGRPFELTVKQDLEFIMKGLADFHTASVGYQPPNGVPVFTKLGRWPNHYTKRCKQMETWKLMAEAEKEDPFSQFYLQEIDGFIEDGLRIKDRLLQSTYVPWTEQLKKSPNLCHQDYGTGNTLLGENEQIWVIDLDTVSFDLPIRDLRKMIIPLLDTTGVWDEETFHVMLNAYESRAPLTEEQKQVMFIDMLFPYELYDVIREKYVRKSALPKEELESAFEYERIKANALRQLI
>NZ_CP015222.1|WP_014480649.1|3037298_3038432_-|spore-coat-protein-CotSA
MKIALIATEKLPVPSVRGGAIQIYLEAVAPLIAKKHEVTVFSIKDPNLADREKVDGVHYVHLDEDRYEEAVGEELKKSRFDLVHVCNRPSWVPKLKKKAPDAVFILSVHNEMFAYDKISQAEGEICIDSVAQIVTVSDYIGQTITSRFPSARSKTKTVYSGVDLKAYHPRWTNEGQRAREEMRSELGLHGKKIVLFVGRLSKVKGPHILLQALPDIIEEHPDVMMVFIGSKWFGDNELNNYVKHLHTLGAMQKDHVTFIQFVKPKDIPRLYTMSDVFVCSSQWQEPLARVHYEAMAAGLPIITSNRGGNPEVIEEGKNGYIIHDFENPKQYAERINDLLSSSEKRERLGKYSRREAENKFGWQRVAENLLSVYEKNR
>NZ_CP015222.1|WP_014480648.1|3036228_3037284_-|spore-coat-protein-CotS
MYQKEHEEQIVSEILSYYPFHIDHVALKSNKSGRKIWEVETDHGPKLLKEAQMKPERMLFITQAHAHLQEQGLPIAPIHQTKNGGSCLGTDQVSYSLYDKVTGKEMIYYDAEQMKKVMSFAGHFHHASKGYVCTDESKKRSRLGKWHKLYRWKLQELEGNMQIAASYPDDVFSQTFLKHADKMLARGKEALQALDDSEYETWTKETLEHGGFCFQDFTLARLTEIEGEPFLKELHSITYDLPSRDLRILLNKVMVKLSVWDTDFMVALLAAYDAVYPLTEKQYEVLWIDLAFPHLFCAIGHKYYLKQKKTWSDEKYNWALQNMISVEGSKDSFLDNLPELYKKIKAYREAN
>NZ_CP015222.1|WP_014480647.1|3035798_3036227_-|hypothetical-protein
MRSSRQKASISKLDLDQFVFTPPGPMGWQAHDSIPAEKGEEEKHLDMGSIRELPHINASKEYQEETKEKETDHKIVDDEEETKFETTPEPEEERDSKRSAPPYEEEDEEEPDVAEEARVEIIILPSESKPAPWFSQTVKRKA
>NZ_CP015222.1|WP_003228966.1|3055851_3056430_+|energy-coupled-thiamine-transporter-ThiT
MNQSKQLVRLIEIAIMTAAAVILDIVSGMFLSMPQGGSVSIMMIPIFLISFRWGVKAGLTTGLLTGLVQIAIGNLFAQHPVQLLLDYIVAFAAIGISGCFASSVRKAAVSKTKGKLIVSVVSAVFIGSLLRYAAHVISGAVFFGSFAPKGTPVWIYSLTYNATYMVPSFIICAIVLCLLFMTAPRLLKSDKA
>NZ_CP015222.1|WP_014480655.1|3056471_3056993_-|GNAT-family-N-acetyltransferase
MVTVREAKLEDIKDIAKVHVDSWRTTYHEIIPIDYLNSLNYKEFEDKWKSRSLKGVFVAQDEMDSVFGFASFGPIRSEQEGYDGELYAIYLLEERQRQGAGRALLAKGAEYLLQHGFSSMFVWVIEQNPSIIFYQAYSPERVAEDNFEIAGVRLKEVGLGWPDLSALKTLLNR
>NZ_CP015222.1|WP_014480656.1|3057010_3058540_-|flotillin-lipid-rafts-scaffold-protein-FloT
MTMPIIMIIGVVFFLLIALIAVFITKYRTAGPDEALIVTGSYLGNKNVHVDEGGNRIKIVRGGGTFVLPVFQQAEPLSLLSSKLDVSTPEVYTEQGVPVMADGTAIIKIGGSIGEIATAAEQFLGKSKDDREQEAREVLEGHLRSILGSMTVEEIYKNREKFSQEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLESLGKPRIAQVKRDADIATAEADKETRIKRAEADKDAKKSELERATEIAEAEKLNQLKMAEFRREQDTAKANADQAYDLETARARQQVTEQEMQVKIIERQKQIELEEKEILRRERQYDSEVKKKADADRYSVEQSAAAEKAKQLAEADAKKYSIEAMAKAEAEKVRIDGLAKAEAEKAKGETEAEVIRLKGLAEAEAKEKIAAAFEQYGQAAIFDMIVKMLPEYAKQAAAPLSNIDKITVVDTGGSGESSGANKVTSYATNLMSSLQESLKASSGIDVKEMLENFSGKGNVKQSINELTNEIKEAKTVQKSE
>NZ_CP015222.1|WP_032727091.1|3058560_3059085_-|membrane-protein
MELFGVPIQTIYLYTLIIAGSLTLLFLFFGDVFAGLSEGIPFLNPTLVLSFFTCFSAGGYIGELVLPLSSLLIALLSCILSIMLVVLLHIFVLVPLSSAEESLAYREDDLRGRLGKVITAVPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDINNGVLSVTPHEPI
>NZ_CP015222.1|WP_033881498.1|3059252_3059741_+|DinB-family-protein
MSIFNEARLETWNELKGLSDEKLNQKPSAEEWSIREVLDHLKKIDMTAQKMLKERVKDAPIKEIEEKSLEVAQDRNNKRKAPSHLEPAHDFISGSQMKRELDVVREQLTAAIASLKEEDFERVLPHPVFQELTVRQWIDFIGHHEKRHLSQMKEIKEKIERA
>NZ_CP015222.1|WP_014478984.1|3059859_3061212_-|IS1182-family-transposase
MFHTRNSSQNTAEFVLLDQLVEEDHLLRKIDKHIDFSFIIEKVKPYYSENKGRPSLDPLILFKMMFIGYLYGIRSERQLEKEIYYNMAYRWFLGLNINDPVPHHSTISWNRRTRFKDTTIFQDIFDEIVLQAINHDMVGGRVLFTDSTHLKANANKHKYTRKTIAQDTQNYIKDLNEAIQEDREEHGKKPLTAKEEVKAEKEIRHSTTDPESGYLYRENKPEGFFYLDHRTTDMKYNIITDAYVTPGNVHDSVPYLDRLDHQIARFGFQVEAVALDSGYLTTPICKGLSDRQIFGVIAHRRYHPIRGLFPKWKFHYDSEQDRYICPNHQTLTYSTTDRKGYRSYKSNPEICSSCPLLENCTKSKNRQKVITRHVWEDHKEKVRQNRLSVSGKNLYKKRKEKIERSFADSKQLHGLRYCRLRGKRNVSEQVLLTAACQNMKKIATYLAKQG
>NZ_CP015222.1|WP_069837716.1|3061326_3061905_-|molybdenum-cofactor-sulfurase
MWKRMTAKAEGLYIAETESFVTKQMDKLDFDYGGIPGDLHFGLTKKAGAREPMFSRGTEIFNRRQISIVSIEECNEIALKMGVPRILPEWLGANVAVSGMPDLTSLKEGSRIIFPSGAALLCEGENDPCIQPGEVIQSYYPDKPKLTPAFVHHALGIRGIVCIVERPGAVYTGDEIEVHSYQRKVKRKAERV
>NZ_CP015222.1|WP_003243227.1|3061992_3063201_-|choline-dehydrogenase
MTLNMKVESMQKFHTFEIPTVIKHGIGAIKHTGEEVAALGVSKALLVTDPGIYKAGVADPVIESLKEAGIEVVLFNKVEPNPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVEATHEGSVLDYEAADGKKPLENRIPPLTTIPTTAGTGSEVTQWAVITDEEREFKFNTGGPLIAAHLTIIDPELHVSMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYIKRAFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGPVMEYNWKGYPEKFARIAKAFGIDTSKMTTEEAAKASVNWMYDLVEDLEVPTLEEQGVSPDMIERLSKEAMKDPQTFGNPRDLNEKAYNWIYKRCFNLTPKTV
>NZ_CP015222.1|WP_015483611.1|3063217_3064690_-|betaine-aldehyde-dehydrogenase
MSQTLFIDGEWISAEKEQIRSIINPFNQEEIATVSEGGREDAIKAIAAARRAFDKGEWSSLSGLERGKIVLKIAELIRRDLEELAELESLDTGKTLEESKADMDDIANVFQYYAGLADKDGGEIISSPIPDSESKIIREPIGVCGQITPWNYPLLQASWKIAPALAAGNTIVMKPSEITPLTTIKVFKLMEEAGVPKGVANLVLGPGATVGDELAVNKDVDLISFTGGIETGKKIMRAASGNVKKIALELGGKNPNIVFKDADLEVAVDQALNAVFFHAGQVCSAGSRLLVEDAIHDQFLAELVKRAKRIKLGNGFHAETESGPLISAEHRAKVEKYVEIGIEEGAKLETGGKRPEDPALQNGFFYEPTIFSNCNSDMRIVQEEVFGPVLTVETFSSEEEVIELANDTIYGLAGAVWSKDIEKCERVAARLRMGTVWINDFHPYFAQAPWGGYKQSGFGRELGKIGLEEYTEVKHVYRNTKPAAVNWFNS
>NZ_CP015222.1|WP_014480661.1|3064888_3065431_+|transcriptional-regulator-GbsR
MDENPEFAAIEQARDLVIDSIAETMDLYGITRSVGILYGTMYMRDEMTLDEMREELQMSKPSMSTGVKKLQDLNVVKKTFHRGIRKHTFVAEKDFFKFFTNFFPPKWEREVQVNVAAIEEAQADLQKVLCKEDLDEDIKNEALQLYDQLESSKAYYDWLKRLAESVQTGEIFKFIPIETK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP015222_2	2.1\|3048819\|60\|NZ_CP015222\|CRISPRCasFinder	3048819-3048878	60	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	10417-10476	7	0.883
NZ_CP015222_2	2.1\|3048819\|60\|NZ_CP015222\|CRISPRCasFinder	3048819-3048878	60	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	70764-70823	7	0.883
NZ_CP015222_2	2.1\|3048819\|60\|NZ_CP015222\|CRISPRCasFinder	3048819-3048878	60	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	1318-1377	7	0.883
NZ_CP015222_2	2.1\|3048819\|60\|NZ_CP015222\|CRISPRCasFinder	3048819-3048878	60	NZ_CP010587	Bacillus megaterium Q3 plasmid p1, complete sequence	838-897	7	0.883
NZ_CP015222_2	2.1\|3048819\|60\|NZ_CP015222\|CRISPRCasFinder	3048819-3048878	60	NZ_CP023319	Bacillus megaterium strain A plasmid p2, complete sequence	75825-75884	7	0.883
NZ_CP015222_2	2.1\|3048819\|60\|NZ_CP015222\|CRISPRCasFinder	3048819-3048878	60	NC_020451	Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence	1960-2019	9	0.85
NZ_CP015222_2	2.1\|3048819\|60\|NZ_CP015222\|CRISPRCasFinder	3048819-3048878	60	NZ_CP015440	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence	64773-64832	12	0.8
NZ_CP015222_2	2.1\|3048819\|60\|NZ_CP015222\|CRISPRCasFinder	3048819-3048878	60	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	483791-483850	13	0.783
NZ_CP015222_2	2.1\|3048819\|60\|NZ_CP015222\|CRISPRCasFinder	3048819-3048878	60	NZ_LR134399	Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence	57361-57420	14	0.767

1. spacer 2.1|3048819|60|NZ_CP015222|CRISPRCasFinder matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

2. spacer 2.1|3048819|60|NZ_CP015222|CRISPRCasFinder matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

3. spacer 2.1|3048819|60|NZ_CP015222|CRISPRCasFinder matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

4. spacer 2.1|3048819|60|NZ_CP015222|CRISPRCasFinder matches to NZ_CP010587 (Bacillus megaterium Q3 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

5. spacer 2.1|3048819|60|NZ_CP015222|CRISPRCasFinder matches to NZ_CP023319 (Bacillus megaterium strain A plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

6. spacer 2.1|3048819|60|NZ_CP015222|CRISPRCasFinder matches to NC_020451 (Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence) position: , mismatch: 9, identity: 0.85

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcattttagttatggcccggg	Protospacer
****************************************** ***   * ***  **.

7. spacer 2.1|3048819|60|NZ_CP015222|CRISPRCasFinder matches to NZ_CP015440 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence) position: , mismatch: 12, identity: 0.8

cagcttggaaggctgaggttttaccactaaactacacccgca-------atttttatttg	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcataataatatataccattg	Protospacer
******************************************       ** * .  ***

8. spacer 2.1|3048819|60|NZ_CP015222|CRISPRCasFinder matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.783

cagcttggaaggctgaggttttaccactaaactacacccgc--------aatttttattt	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatggttaaaagttttgcca	Protospacer
*****************************************        ** ****...

9. spacer 2.1|3048819|60|NZ_CP015222|CRISPRCasFinder matches to NZ_LR134399 (Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence) position: , mismatch: 14, identity: 0.767

cagcttggaaggctgaggttttaccactaaactacacccgc---------aatttttatt	CRISPR spacer
cagcttggaaggctgtagttttaccactaaactacacccgcatagtaagtagttcttagt	Protospacer
*************** .************************         *.**.*** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

655705 : 749433

101

uncultured_Caudovirales_phage(27.08%)

integrase,capsid,terminase,portal,coat,tail,plate,transposase,tRNA,head,protease,holin

attL 666089:666107|attR 709350:709368

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014479022.1\|655705_656182_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_014479023.1\|656162_656852_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_014479024.1\|656861_657317_+	ribosomal-protein-alanine N-acetyltransferase	NA	NA	NA	NA
WP_003234076.1\|657309_658350_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	8.8e-66	43.9
WP_069837285.1\|658575_660504_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	5.3e-56	29.3
WP_003243499.1\|660629_661142_+	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
WP_003234073.1\|661138_661786_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_003234072.1\|661807_661981_+	sec-independent protein translocase protein TatAY	NA	NA	NA	NA
WP_015252680.1\|661987_662752_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.5e-22	30.8
WP_003225680.1\|662983_663175_-	YdiK family protein	NA	NA	NA	NA
WP_003234069.1\|663171_663906_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003155970.1\|664144_664429_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	2.2e-19	51.6
WP_003234067.1\|664475_666107_+	chaperonin GroEL	A0A219YK78	uncultured_virus	3.7e-159	57.7
666089:666107	attL	NA	NA	NA	NA
WP_069837286.1\|666196_667396_-\|integrase	site-specific integrase	S6C485	Thermus_phage	4.1e-83	46.3
WP_069837287.1\|667412_667919_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	2.6e-63	69.9
WP_080480832.1\|668322_668688_-	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	1.4e-21	48.7
WP_069837288.1\|668822_669059_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_069837289.1\|669071_669386_+	hypothetical protein	A0A2H4JDL0	uncultured_Caudovirales_phage	2.4e-11	45.3
WP_069837290.1\|669382_670111_+	phage regulatory protein	A0A2H4J4N4	uncultured_Caudovirales_phage	5.0e-84	62.5
WP_069837291.1\|670167_670737_+	helix-turn-helix transcriptional regulator	A0A2H4J884	uncultured_Caudovirales_phage	4.5e-64	58.5
WP_069837292.1\|670733_670991_+	hypothetical protein	A0A2H4J4M9	uncultured_Caudovirales_phage	2.2e-10	42.2
WP_069837293.1\|670987_671185_+	hypothetical protein	NA	NA	NA	NA
WP_069837294.1\|671287_671638_+	hypothetical protein	NA	NA	NA	NA
WP_041339356.1\|671637_671829_+	hypothetical protein	NA	NA	NA	NA
WP_069837295.1\|671825_672743_+	hypothetical protein	A0A0A7RUE9	Clostridium_phage	4.7e-87	62.5
WP_080480833.1\|672762_673500_+	hypothetical protein	A0A0A7RVR3	Clostridium_phage	2.3e-52	44.9
WP_069837297.1\|673696_674389_+	DnaD domain protein	A0A1L2JY26	Aeribacillus_phage	2.1e-07	41.0
WP_069837298.1\|674309_675125_+	ATP-binding protein	A6XMI1	Bacillus_virus	1.8e-61	48.5
WP_069837300.1\|675355_675784_+	RusA family crossover junction endodeoxyribonuclease	S6B1L9	Thermus_phage	6.6e-44	64.5
WP_069837301.1\|675864_676071_+	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	2.1e-19	75.4
WP_069837302.1\|676102_676387_+	hypothetical protein	NA	NA	NA	NA
WP_064911548.1\|676383_676632_+	hypothetical protein	A0A2H4JA61	uncultured_Caudovirales_phage	7.8e-05	42.3
WP_069837303.1\|676881_677247_+	hypothetical protein	NA	NA	NA	NA
WP_069837304.1\|677260_678463_+	hypothetical protein	NA	NA	NA	NA
WP_069150170.1\|678716_678902_+	hypothetical protein	NA	NA	NA	NA
WP_069837305.1\|678922_679384_+	sigma-70 family RNA polymerase sigma factor	A0A2H4J4R7	uncultured_Caudovirales_phage	4.1e-23	46.0
WP_069837306.1\|679666_679981_+	hypothetical protein	NA	NA	NA	NA
WP_069837307.1\|680382_680748_+	HNH endonuclease	A0A1U7Q1S7	Geobacillus_virus	9.4e-31	55.0
WP_019712672.1\|680975_681491_+\|terminase	phage terminase small subunit P27 family	A6M947	Geobacillus_virus	2.8e-33	43.4
WP_069837308.1\|681487_683197_+\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	6.0e-205	62.5
WP_041337954.1\|683209_683401_+	DUF1056 family protein	NA	NA	NA	NA
WP_069837309.1\|683401_684709_+\|portal	phage portal protein	D6R3Y6	Bacillus_phage	9.3e-105	46.4
WP_069837310.1\|684656_685394_+\|protease	Clp protease ClpP	A0A2I7SCY8	Paenibacillus_phage	2.6e-56	57.1
WP_069837311.1\|685433_686720_+\|capsid	phage major capsid protein	A0A288WG01	Bacillus_phage	2.7e-80	45.2
WP_069837312.1\|686746_687199_+	collagen-like protein	D6R3Z0	Bacillus_phage	1.3e-10	57.1
WP_046160658.1\|687216_687519_+\|head,tail	phage gp6-like head-tail connector protein	A0A0S2GLH6	Bacillus_phage	4.7e-12	46.3
WP_069837313.1\|687508_687823_+\|head	phage head closure protein	A0A2H4JCB1	uncultured_Caudovirales_phage	1.3e-12	37.3
WP_060399178.1\|687822_688221_+	hypothetical protein	NA	NA	NA	NA
WP_069837314.1\|688217_688610_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_069837315.1\|688624_689239_+\|tail	phage tail protein	J7KKC8	Streptococcus_phage	3.7e-11	35.1
WP_063695019.1\|689303_689681_+	hypothetical protein	NA	NA	NA	NA
WP_069837316.1\|689880_694368_+\|tail	phage tail tape measure protein	A6M961	Geobacillus_virus	1.2e-66	41.5
WP_046160652.1\|694361_695201_+\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	3.4e-92	58.6
WP_069837317.1\|695215_696919_+	alkaline phosphatase	D6R400	Bacillus_phage	4.3e-179	55.5
WP_069837318.1\|696970_698527_+	hypothetical protein	M4ZSB3	Bacillus_phage	1.5e-250	82.9
WP_069837319.1\|698563_699685_+\|plate	phage baseplate upper protein	M4ZRP1	Bacillus_phage	7.5e-196	92.5
WP_031600553.1\|699700_700000_+	hypothetical protein	M4ZR44	Bacillus_phage	2.0e-39	79.2
WP_031600554.1\|699996_700167_+	XkdX family protein	NA	NA	NA	NA
WP_069837320.1\|700218_700431_+	hypothetical protein	A0A290GDY2	Caldibacillus_phage	1.9e-15	59.4
WP_069837321.1\|700445_700709_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	2.1e-24	66.7
WP_069837322.1\|700766_701735_+	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	1.0e-63	67.4
WP_069837323.1\|701768_702185_-	hypothetical protein	A0A2H4J4V0	uncultured_Caudovirales_phage	6.7e-41	57.2
WP_069837324.1\|702196_703816_-	ribonuclease YeeF family protein	A0A1P8CWI7	Bacillus_phage	4.3e-75	59.7
WP_069837325.1\|704061_704721_-	hypothetical protein	Q9AZW5	Lactococcus_phage	6.7e-11	32.9
WP_015715413.1\|704885_705368_-	hypothetical protein	NA	NA	NA	NA
WP_121509397.1\|705737_705947_+	hypothetical protein	NA	NA	NA	NA
WP_010329782.1\|705924_706155_+	DNA-binding protein	NA	NA	NA	NA
WP_069837327.1\|707778_708213_+	hypothetical protein	NA	NA	NA	NA
WP_069837328.1\|708218_708938_+	hypothetical protein	NA	NA	NA	NA
WP_069837329.1\|708956_709145_-	hypothetical protein	A0A2H4J4T3	uncultured_Caudovirales_phage	3.1e-14	58.3
WP_014479028.1\|710487_711291_+	sce7726 family protein	NA	NA	NA	NA
709350:709368	attR	NA	NA	NA	NA
WP_014479029.1\|711291_712236_+	sce7725 family protein	NA	NA	NA	NA
WP_014479030.1\|712551_715053_-	glucitol operon transcriptional regulator GutR	NA	NA	NA	NA
WP_033881543.1\|715254_716316_+	sorbitol dehydrogenase	NA	NA	NA	NA
WP_014479032.1\|716389_717781_+	MFS transporter	NA	NA	NA	NA
WP_069837330.1\|717875_718838_+	carbohydrate kinase	NA	NA	NA	NA
WP_069837331.1\|719033_719717_+	PspA/IM30 family protein	NA	NA	NA	NA
WP_041336778.1\|719782_720808_+	hypothetical protein	NA	NA	NA	NA
WP_041352251.1\|720807_721572_+	YgcG family protein	NA	NA	NA	NA
WP_003234032.1\|721602_722574_+	hypothetical protein	NA	NA	NA	NA
WP_069837332.1\|724228_725650_+	myo-inositol transporter IolT	NA	NA	NA	NA
WP_003234015.1\|725697_726738_-	(R,R)-butanediol dehydrogenase	NA	NA	NA	NA
WP_003234013.1\|727174_727546_+	cell wall metabolism protein WalM	NA	NA	NA	NA
WP_014479042.1\|727611_728658_+	hypothetical protein	NA	NA	NA	NA
WP_087614160.1\|728771_729921_+\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
WP_014479044.1\|729981_730140_-	hypothetical protein	NA	NA	NA	NA
WP_003234008.1\|730329_730539_-	hypothetical protein	NA	NA	NA	NA
WP_014479045.1\|730621_731437_-	alpha/beta hydrolase	H9NCP0	Mycobacterium_phage	2.4e-10	30.8
WP_014479048.1\|732521_734063_-\|coat	outer spore coat copper-dependent laccase CotA	NA	NA	NA	NA
WP_069837333.1\|734214_735624_-	GABA permease	NA	NA	NA	NA
WP_032678949.1\|735661_735949_-	hypothetical protein	NA	NA	NA	NA
WP_015382984.1\|736022_736895_+	manganese transporter MneS	NA	NA	NA	NA
WP_069837334.1\|737045_738008_+	MoxR family ATPase	NA	NA	NA	NA
WP_041056883.1\|738007_739204_+	DUF58 domain-containing protein	NA	NA	NA	NA
WP_014479053.1\|739225_741439_+	DUF4129 domain-containing protein	NA	NA	NA	NA
WP_003244399.1\|741601_743143_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	5.7e-21	30.5
WP_069837335.1\|743251_743785_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_069837336.1\|743766_745233_+	DUF4179 domain-containing protein	NA	NA	NA	NA
WP_069837337.1\|745616_746939_+	hypoxanthine/guanine permease PbuG	A0A0R6PHV4	Moraxella_phage	1.3e-37	30.0
WP_014479057.1\|747149_747953_+	hypothetical protein	NA	NA	NA	NA
WP_014478984.1\|748080_749433_+\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.4e-87	41.8

DBSCAN-SWA_2

752763 : 761129

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003233955.1\|752763_754059_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	25.7
WP_014479060.1\|754132_754858_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	1.2e-45	44.1
WP_003219409.1\|754850_755105_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003243954.1\|755101_755785_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_069837338.1\|755768_757997_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	5.5e-158	40.0
WP_003233947.1\|757972_759403_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-52	32.5
WP_014479061.1\|759504_760545_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.7e-64	42.0
WP_014479062.1\|760541_761129_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.4e-28	41.0

DBSCAN-SWA_3

808787 : 875022

Tupanvirus(20.0%)

transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046380839.1\|808787_809234_+\|coat	spore coat protein YeeK	NA	NA	NA	NA
WP_046380840.1\|809348_809933_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_046380841.1\|810012_810459_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_069837349.1\|810455_811301_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_003219489.1\|811447_811696_+\|coat	spore coat associated protein CotJA	NA	NA	NA	NA
WP_003219491.1\|811679_811943_+\|coat	spore coat protein CotJB	NA	NA	NA	NA
WP_014479096.1\|811957_812527_+\|coat	spore coat protein CotJC	NA	NA	NA	NA
WP_046380843.1\|812651_813194_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_072173406.1\|813632_814262_+	YesL family protein	NA	NA	NA	NA
WP_069837350.1\|814258_815992_+	two-component system sensor histidine kinase YesM	Q9EYF3	Enterobacteria_phage	6.9e-23	27.5
WP_069837351.1\|817198_818482_+	carbohydrate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_014479106.1\|819411_820302_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_014479107.1\|820317_821352_+	rhamnogalacturonyl hydrolase YesR	NA	NA	NA	NA
WP_014479108.1\|821374_823660_+	transcriptional regulator YesS	NA	NA	NA	NA
WP_031600252.1\|823673_824372_+	rhamnogalacturonan acetylesterase	NA	NA	NA	NA
WP_014479110.1\|824364_825027_+	YesU family protein	NA	NA	NA	NA
WP_069837352.1\|825023_825650_+	YesL family protein	NA	NA	NA	NA
WP_069837353.1\|827667_829506_+	rhamnogalacturonan lyase	NA	NA	NA	NA
WP_003233813.1\|829664_830318_+	rhamnogalacturonan acetylesterase	NA	NA	NA	NA
WP_069837354.1\|830325_832317_+	beta-galactosidase YesZ	NA	NA	NA	NA
WP_069703938.1\|835055_836570_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_014479122.1\|836624_837581_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_003242715.1\|837594_838482_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_069837355.1\|838490_839831_+	alpha-glucosidase/alpha-galactosidase	NA	NA	NA	NA
WP_014479125.1\|839905_840601_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_014479126.1\|840637_840964_-	heme-degrading oxygenase HmoA	NA	NA	NA	NA
WP_003233803.1\|841067_841430_-	VOC family protein	NA	NA	NA	NA
WP_069837356.1\|841521_842112_-	hypothetical protein	NA	NA	NA	NA
WP_014479128.1\|842309_843182_+	STAS domain-containing protein	NA	NA	NA	NA
WP_003244522.1\|843335_843503_+	YezD family protein	NA	NA	NA	NA
WP_014479129.1\|843612_844257_+	hypothetical protein	NA	NA	NA	NA
WP_031600260.1\|844375_844663_+	hypothetical protein	NA	NA	NA	NA
WP_087614162.1\|844904_846017_+	restriction endonuclease	NA	NA	NA	NA
WP_069837357.1\|846238_847300_-	DUF3900 domain-containing protein	NA	NA	NA	NA
WP_017695589.1\|847449_850635_+	cytochrome P450	V5UQK0	Mycobacterium_phage	2.3e-80	37.5
WP_069837919.1\|851081_853001_+	LTA synthase family protein	W6LM83	Streptococcus_phage	3.0e-128	43.5
WP_014479136.1\|853236_854001_+	glucose-1-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_003244102.1\|854007_854976_+	NAD-dependent epimerase/dehydratase family protein	A0A2K9L0I7	Tupanvirus	1.1e-30	29.3
WP_069837358.1\|854999_855911_+	hypothetical protein	NA	NA	NA	NA
WP_046160185.1\|855939_857118_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_015252589.1\|857118_858054_+	hypothetical protein	NA	NA	NA	NA
WP_014479139.1\|858083_859313_-	MFS transporter	NA	NA	NA	NA
WP_014479140.1\|859424_860132_-	noncanonical pyrimidine nucleotidase, YjjG family	NA	NA	NA	NA
WP_003233771.1\|860223_861609_-	amino acid permease	NA	NA	NA	NA
WP_014479141.1\|861858_863316_+	benzaldehyde dehydrogenase	NA	NA	NA	NA
WP_003233767.1\|863329_864190_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.2e-09	41.0
WP_014479142.1\|864324_866214_+	ABC-F family ATP-binding cassette domain-containing protein	A0A1V0SGN0	Hokovirus	6.1e-41	31.9
WP_014476106.1\|866336_866783_+	hypothetical protein	NA	NA	NA	NA
WP_014479143.1\|866907_867330_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_003233759.1\|867395_868586_+	MFS transporter	NA	NA	NA	NA
WP_087614160.1\|869122_870272_+\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
WP_014479146.1\|870338_871895_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	9.5e-56	29.3
WP_014479147.1\|872067_873198_+	DEAD/DEAH box helicase	A0A1V0SIR5	Klosneuvirus	2.8e-41	30.9
WP_046160188.1\|873266_873713_+	N-acetyltransferase	NA	NA	NA	NA
WP_031600262.1\|873774_875022_-\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6

DBSCAN-SWA_4

1269205 : 1317173

Planktothrix_phage(44.44%)

tRNA,transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087614160.1\|1269205_1270356_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
WP_003245356.1\|1270533_1270713_+	YjzC family protein	NA	NA	NA	NA
WP_003245236.1\|1270759_1270945_-	DUF2929 domain-containing protein	NA	NA	NA	NA
WP_014479433.1\|1271193_1271928_+	hypothetical protein	NA	NA	NA	NA
WP_014479435.1\|1272009_1272567_+	hypothetical protein	NA	NA	NA	NA
WP_069837427.1\|1272657_1273611_+	transcriptional regulator Med	NA	NA	NA	NA
WP_046380930.1\|1273625_1273817_+	competence protein ComG	NA	NA	NA	NA
WP_003232972.1\|1273846_1274086_-\|coat	spore coat protein YjzB	NA	NA	NA	NA
WP_003232971.1\|1274250_1275189_+	beta-ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_003244890.1\|1275211_1276453_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_003232967.1\|1276528_1277314_+	DUF2268 domain-containing protein	NA	NA	NA	NA
WP_003232965.1\|1277504_1278491_+	oligopeptide ABC transporter ATP-binding protein AppD	G9BWD6	Planktothrix_phage	5.7e-22	32.9
WP_069837428.1\|1278487_1279477_+	oligopeptide ABC transporter ATP-binding protein AppF	G9BWD6	Planktothrix_phage	9.4e-17	30.1
WP_069837429.1\|1279564_1281196_+	peptide-binding protein	NA	NA	NA	NA
WP_003245828.1\|1281271_1282222_+	oligopeptide ABC transporter permease AppB	NA	NA	NA	NA
WP_014479441.1\|1282238_1283150_+	oligopeptide ABC transporter permease AppC	NA	NA	NA	NA
WP_003239298.1\|1283355_1284108_+	DUF3603 family protein	A0A0A0RP53	Bacillus_phage	5.4e-49	43.9
WP_003245134.1\|1284142_1285135_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_014479443.1\|1285878_1287516_+	oligopeptide ABC transporter substrate-binding protein OppA	NA	NA	NA	NA
WP_014479444.1\|1287623_1288559_+	oligopeptide ABC transporter permease OppB	NA	NA	NA	NA
WP_003232954.1\|1288562_1289480_+	oligopeptide ABC transporter permease OppC	NA	NA	NA	NA
WP_077670618.1\|1289484_1290561_+	oligopeptide ABC transporter ATP-binding protein OppD	G9BWD6	Planktothrix_phage	2.1e-17	30.8
WP_003245567.1\|1290562_1291480_+	oligopeptide ABC transporter ATP-binding protein OppF	G9BWD6	Planktothrix_phage	1.6e-23	34.8
WP_072592593.1\|1291587_1292805_+	MFS transporter	NA	NA	NA	NA
WP_014476435.1\|1293727_1294123_+	transcriptional regulator Spx	NA	NA	NA	NA
WP_014479447.1\|1294165_1294822_-	TerC family protein	A0A2R2YAT9	Pseudomonas_phage	1.1e-29	38.0
WP_119122854.1\|1294991_1295132_+	hypothetical protein	NA	NA	NA	NA
WP_014479448.1\|1295098_1295755_+	adaptor protein MecA	NA	NA	NA	NA
WP_003245684.1\|1295749_1295872_-	hypothetical protein	NA	NA	NA	NA
WP_014479449.1\|1295915_1297067_+	competence protein CoiA	NA	NA	NA	NA
WP_014479450.1\|1297113_1299126_+	oligoendopeptidase F	NA	NA	NA	NA
WP_003244944.1\|1299163_1299331_-	hypothetical protein	NA	NA	NA	NA
WP_003245184.1\|1299645_1300545_-	adaptor protein SpxH	NA	NA	NA	NA
WP_003232928.1\|1300541_1300940_-	group 2 truncated hemoglobin YjbI	NA	NA	NA	NA
WP_072592594.1\|1301194_1301740_-	bifunctional muramidase/murein lytic transglycosylase	A0A1P8CWQ1	Bacillus_phage	5.1e-41	73.7
WP_014479452.1\|1301943_1302516_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_041850975.1\|1302640_1303009_+	hypothetical protein	NA	NA	NA	NA
WP_003245294.1\|1303037_1303673_+	GTP diphosphokinase	NA	NA	NA	NA
WP_003232918.1\|1303691_1304492_+	NAD kinase	NA	NA	NA	NA
WP_072592595.1\|1304554_1305406_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_003232912.1\|1305418_1306153_-	bis(5'-nucleosyl)-tetraphosphatase PrpE	A8E2N0	Enterococcus_phage	7.2e-06	24.8
WP_069837430.1\|1306388_1308233_+	sodium:proton antiporter	NA	NA	NA	NA
WP_014479456.1\|1308481_1309192_+	thiaminase II	NA	NA	NA	NA
WP_014479457.1\|1309166_1309784_+	thiazole tautomerase TenI	NA	NA	NA	NA
WP_014479458.1\|1309767_1310877_+	glycine oxidase ThiO	NA	NA	NA	NA
WP_072592596.1\|1310876_1311077_+	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_072592522.1\|1311073_1311844_+	thiazole synthase	NA	NA	NA	NA
WP_014479461.1\|1311840_1312851_+	thiazole biosynthesis adenylyltransferase ThiF	NA	NA	NA	NA
WP_014479462.1\|1312869_1313685_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_003232896.1\|1313820_1314597_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_031600370.1\|1314697_1315381_+\|coat	spore coat protein CotO	NA	NA	NA	NA
WP_014479464.1\|1315473_1315923_-\|coat	spore coat protein CotZ	NA	NA	NA	NA
WP_014479465.1\|1316050_1316539_-\|coat	spore coat protein CotY	NA	NA	NA	NA
WP_014479466.1\|1316690_1317173_-\|coat	spore coat protein X	NA	NA	NA	NA

DBSCAN-SWA_5

1359200 : 1439296

uncultured_Caudovirales_phage(26.83%)

terminase,portal,transposase,plate,tRNA,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031600391.1\|1359200_1360412_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	2.2e-23	26.8
WP_014479509.1\|1360542_1361049_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_009967031.1\|1361267_1361663_-	hypothetical protein	NA	NA	NA	NA
WP_014479511.1\|1361891_1362371_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_003232825.1\|1362410_1362605_-	DUF4177 domain-containing protein	NA	NA	NA	NA
WP_014479512.1\|1362736_1363066_-	YjdJ family protein	NA	NA	NA	NA
WP_080480847.1\|1363614_1364595_-	protoheme IX farnesyltransferase	NA	NA	NA	NA
WP_014479515.1\|1364727_1364961_-	hypothetical protein	NA	NA	NA	NA
WP_069837442.1\|1365213_1366617_+	peptidoglycan-N-acetylmuramic acid deacetylase PdaC	NA	NA	NA	NA
WP_014479517.1\|1366656_1367130_-	YjfA family protein	NA	NA	NA	NA
WP_014476499.1\|1367253_1367421_-	putative motility protein	NA	NA	NA	NA
WP_033881521.1\|1368456_1368855_-	DUF2809 domain-containing protein	NA	NA	NA	NA
WP_014479521.1\|1368955_1369531_-	YjgB family protein	NA	NA	NA	NA
WP_069837443.1\|1369676_1372634_+	formate dehydrogenase subunit alpha	NA	NA	NA	NA
WP_069837444.1\|1372626_1373172_+	DUF1641 domain-containing protein	NA	NA	NA	NA
WP_014479525.1\|1373383_1374028_+	DUF4352 domain-containing protein	NA	NA	NA	NA
WP_072592527.1\|1374102_1374729_+	NUDIX hydrolase	NA	NA	NA	NA
WP_014478984.1\|1374853_1376206_+\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.4e-87	41.8
WP_003232791.1\|1376334_1376613_-	hypothetical protein	NA	NA	NA	NA
WP_014479527.1\|1377003_1378194_+	monooxygenase YjiB	NA	NA	NA	NA
WP_038828749.1\|1378216_1379395_+	UDP-glucosyltransferase	Q0IKX4	Leucania_separata_nucleopolyhedrovirus	5.6e-08	28.3
WP_003232781.1\|1379435_1379624_-	hypothetical protein	A0A1P8CWV7	Bacillus_phage	3.4e-21	77.6
WP_069837445.1\|1379797_1380610_+	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_003232776.1\|1382239_1382992_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_003232774.1\|1382991_1383744_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.4e-18	31.4
WP_014479530.1\|1383863_1384838_-	multidrug resistance efflux transporter family protein	NA	NA	NA	NA
WP_003220510.1\|1385854_1386277_+	DUF1641 domain-containing protein	NA	NA	NA	NA
WP_003232765.1\|1386316_1387495_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_069837447.1\|1387692_1389114_+	glucuronate isomerase	NA	NA	NA	NA
WP_015383410.1\|1390664_1391678_+	ureidoglycolate dehydrogenase	NA	NA	NA	NA
WP_069837448.1\|1391683_1392703_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_046160300.1\|1392727_1393807_+	mannonate dehydratase	NA	NA	NA	NA
WP_046160301.1\|1393803_1394640_+	SDR family oxidoreductase	M1NMS3	Moumouvirus	2.7e-09	30.4
WP_069837449.1\|1394687_1395956_+	MFS transporter	NA	NA	NA	NA
WP_069837450.1\|1396043_1397045_+	LacI family transcriptional regulator	NA	NA	NA	NA
WP_069837451.1\|1397120_1398563_+	tagaturonate reductase	NA	NA	NA	NA
WP_069837452.1\|1398559_1400053_+	altronate dehydratase	NA	NA	NA	NA
WP_014476525.1\|1400091_1400856_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_014478984.1\|1401166_1402519_+\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.4e-87	41.8
WP_014479541.1\|1402661_1403126_-	hypothetical protein	NA	NA	NA	NA
WP_087614160.1\|1404416_1405567_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
WP_015252291.1\|1405979_1407116_+	response regulator aspartate phosphatase RapA	A0A1P8CWN8	Bacillus_phage	4.9e-94	47.4
WP_003245487.1\|1407105_1407240_+	phosphatase RapA inhibitor PhrA	NA	NA	NA	NA
WP_014479545.1\|1407637_1408591_+	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	1.6e-66	73.8
WP_014479546.1\|1408630_1409008_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	7.9e-17	42.3
WP_014479547.1\|1409112_1409715_+	poly-gamma-glutamate hydrolase family protein	F8WQ53	Bacillus_phage	1.4e-44	48.7
WP_003245071.1\|1409791_1410628_+	manganese catalase	NA	NA	NA	NA
WP_003232721.1\|1410671_1411268_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	8.1e-40	51.7
WP_003232719.1\|1411430_1411772_-	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	1.3e-18	45.8
WP_003232712.1\|1411950_1412130_+	hypothetical protein	NA	NA	NA	NA
WP_003232710.1\|1412116_1412953_+	hypothetical protein	S6BFM4	Thermus_phage	6.7e-24	27.8
WP_080478406.1\|1412852_1413653_+	ATP-binding protein	A6XMI1	Bacillus_virus	5.0e-61	51.7
WP_032677395.1\|1413652_1413820_+	hypothetical protein	NA	NA	NA	NA
WP_046160305.1\|1413904_1414255_+	phage-like element PBSX protein XkdD	NA	NA	NA	NA
WP_014476537.1\|1414251_1414458_+	phage-like element PBSX protein XtrA	A0A2H4J4M6	uncultured_Caudovirales_phage	2.1e-11	50.0
WP_014479550.1\|1414573_1415083_+	sigma-70 family RNA polymerase sigma factor	A0A1L2JY33	Aeribacillus_phage	6.5e-22	39.2
WP_003244697.1\|1415198_1415996_+\|terminase	PBSX phage terminase small subunit	A0A0S2MVB6	Bacillus_phage	8.0e-59	50.2
WP_003232697.1\|1415992_1417294_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	9.1e-153	60.0
WP_032725514.1\|1417297_1418785_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.7e-139	55.7
WP_014479551.1\|1418804_1419632_+	hypothetical protein	A0A1B1P7E4	Bacillus_phage	1.6e-54	59.2
WP_003232690.1\|1419657_1420593_+	phage-like element PBSX protein XkdG	A0A1B1P7E3	Bacillus_phage	1.1e-104	63.8
WP_014479552.1\|1420614_1420998_+	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	1.4e-13	40.5
WP_009967053.1\|1420994_1421351_+	DUF3599 family protein	NA	NA	NA	NA
WP_003245226.1\|1421347_1421833_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	2.1e-38	47.0
WP_003232680.1\|1421845_1422286_+	phage-like element PBSX protein XkdJ	NA	NA	NA	NA
WP_003232679.1\|1422289_1422508_+	hypothetical protein	NA	NA	NA	NA
WP_014479554.1\|1422504_1423905_+	hypothetical protein	A0A0A7S087	Clostridium_phage	3.0e-77	39.3
WP_014479555.1\|1423906_1424350_+	phage-like element PBSX protein XkdM	A0A0K2CNG3	Brevibacillus_phage	1.9e-25	44.5
WP_014479556.1\|1424441_1424888_+	hypothetical protein	A0A0A7RTY8	Clostridium_phage	1.0e-10	36.8
WP_014479557.1\|1424929_1425070_+	hypothetical protein	NA	NA	NA	NA
WP_031600410.1\|1425070_1430074_+	transglycosylase SLT domain-containing protein	A0A2H4JA91	uncultured_Caudovirales_phage	6.4e-37	44.8
WP_014479559.1\|1430066_1430726_+	LysM peptidoglycan-binding domain-containing protein	A0A0A8WJR4	Clostridium_phage	1.1e-24	33.2
WP_003245730.1\|1430741_1431719_+	phage-like element PBSX protein XkdQ	H7BV96	unidentified_phage	1.0e-39	32.6
WP_003244812.1\|1431718_1431985_+	DUF2577 domain-containing protein	S6C459	Thermus_phage	1.7e-05	36.4
WP_014479560.1\|1432042_1432468_+	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	3.0e-12	38.0
WP_003232669.1\|1432460_1433507_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	1.3e-72	44.3
WP_014476551.1\|1433490_1434069_+	YmfQ family protein	A0A2H4J717	uncultured_Caudovirales_phage	3.9e-15	34.2
WP_003232665.1\|1434065_1434338_+	hypothetical protein	NA	NA	NA	NA
WP_014479561.1\|1434340_1436404_+	hypothetical protein	A0A2H4J4R1	uncultured_Caudovirales_phage	2.6e-29	34.5
WP_014479562.1\|1436415_1436745_+	hypothetical protein	A0A2H4JCI0	uncultured_Caudovirales_phage	1.3e-15	40.7
WP_014479563.1\|1436741_1436906_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	1.9e-15	67.9
WP_014479564.1\|1436952_1437792_+	phage-like element PBSX protein XepA	NA	NA	NA	NA
WP_014479565.1\|1437844_1438114_+	phage-like element PBSX protein XhlA	A0A2H4JD40	uncultured_Caudovirales_phage	1.4e-23	64.8
WP_014479566.1\|1438126_1438390_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	6.1e-24	64.4
WP_014479567.1\|1438402_1439296_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	5.2e-83	69.2

DBSCAN-SWA_6

1867434 : 1964793

101

Bacillus_phage(56.0%)

terminase,coat,transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014478984.1\|1867434_1868787_-\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.4e-87	41.8
WP_014664026.1\|1869032_1870562_+\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
WP_003231834.1\|1870563_1870995_+	RicAFT regulatory complex protein RicA	NA	NA	NA	NA
WP_003231833.1\|1871256_1871802_+\|coat	outer spore coat protein CotE	NA	NA	NA	NA
WP_046160418.1\|1871934_1874511_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	2.4e-40	27.7
WP_041516431.1\|1874526_1876410_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	7.6e-68	31.3
WP_031600520.1\|1877519_1877768_+	hypothetical protein	A0A2H4JA61	uncultured_Caudovirales_phage	4.6e-05	44.9
WP_033881685.1\|1877818_1878181_-	hypothetical protein	NA	NA	NA	NA
WP_014479826.1\|1878453_1879203_+	hypothetical protein	NA	NA	NA	NA
WP_031600526.1\|1881128_1881278_+	hypothetical protein	NA	NA	NA	NA
WP_033881687.1\|1881346_1881664_+	hypothetical protein	NA	NA	NA	NA
WP_031600528.1\|1881839_1882085_+	hypothetical protein	NA	NA	NA	NA
WP_033881688.1\|1882074_1882689_+	hypothetical protein	NA	NA	NA	NA
WP_033881690.1\|1882701_1882926_+	hypothetical protein	NA	NA	NA	NA
WP_041516434.1\|1882922_1883297_+	HNH endonuclease	Q38456	Bacillus_phage	1.3e-64	87.1
WP_017697674.1\|1883676_1884210_+\|terminase	phage terminase small subunit P27 family	Q9ZXG2	Bacillus_phage	1.0e-70	82.5
WP_031600262.1\|1884460_1885708_-\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
WP_072592534.1\|1886754_1887210_-	hypothetical protein	NA	NA	NA	NA
WP_014479830.1\|1887364_1887922_-	hypothetical protein	NA	NA	NA	NA
WP_014479831.1\|1888042_1888657_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_003231786.1\|1888795_1889152_-	hypothetical protein	NA	NA	NA	NA
WP_080480852.1\|1889230_1890055_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_069837520.1\|1890165_1891494_-\|protease	serine protease AprX	A0A1B0T6A2	Bacillus_phage	9.3e-28	33.6
WP_014476869.1\|1891718_1891952_+	hypothetical protein	NA	NA	NA	NA
WP_003245758.1\|1892231_1892939_+	poly-gamma-glutamate hydrolase family protein	F8WQ53	Bacillus_phage	3.2e-51	56.9
WP_003245175.1\|1893008_1893461_+	OsmC family protein	NA	NA	NA	NA
WP_003245163.1\|1893474_1893828_-	multidrug efflux SMR transporter subunit EbrB	NA	NA	NA	NA
WP_080480853.1\|1893841_1894159_-	multidrug efflux SMR transporter subunit EbrA	NA	NA	NA	NA
WP_029317825.1\|1894295_1894571_-	hypothetical protein	NA	NA	NA	NA
WP_003231769.1\|1894659_1895073_+	hypothetical protein	NA	NA	NA	NA
WP_069837521.1\|1895172_1896117_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_003221097.1\|1896156_1896378_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_014479841.1\|1896573_1896846_+	hypothetical protein	NA	NA	NA	NA
WP_003245262.1\|1896927_1897158_+	hypothetical protein	NA	NA	NA	NA
WP_003231758.1\|1897399_1897792_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	2.5e-29	58.3
WP_014479842.1\|1897751_1899854_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	86.8
WP_003231754.1\|1899871_1900861_+	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.9e-155	83.5
WP_003245105.1\|1900910_1901531_+	hypothetical protein	A0A127AYS1	Bacillus_phage	1.6e-46	48.4
WP_014479843.1\|1901594_1902362_-	sporulation-specific N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	1.2e-51	49.5
WP_003231746.1\|1903002_1903971_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	5.2e-52	40.5
WP_015483254.1\|1904103_1905366_+	GTPase HflX	NA	NA	NA	NA
WP_014479845.1\|1905383_1906649_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_003238341.1\|1906758_1907166_+	transcriptional repressor GlnR	NA	NA	NA	NA
WP_031600540.1\|1907224_1908559_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_095010668.1\|1908668_1908794_+	hypothetical protein	NA	NA	NA	NA
WP_015483256.1\|1908832_1909132_-	hypothetical protein	NA	NA	NA	NA
WP_017697662.1\|1909185_1909494_-	hypothetical protein	NA	NA	NA	NA
WP_017697663.1\|1909514_1911398_-	hypothetical protein	A0A1P8CWI7	Bacillus_phage	5.2e-125	61.3
WP_033881290.1\|1912489_1912780_+	hypothetical protein	NA	NA	NA	NA
WP_014479885.1\|1913018_1913510_+	hypothetical protein	NA	NA	NA	NA
WP_014479887.1\|1914840_1915092_+	hypothetical protein	NA	NA	NA	NA
WP_072592598.1\|1915275_1915710_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_031600262.1\|1916638_1917886_+\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
WP_046160431.1\|1918469_1919006_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_046160432.1\|1919084_1919987_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_029726895.1\|1920064_1920445_+	hypothetical protein	NA	NA	NA	NA
WP_014479898.1\|1920986_1921217_+	helix-turn-helix transcriptional regulator	A0A1P8CWU2	Bacillus_phage	2.1e-20	75.0
WP_014479901.1\|1922729_1922894_+	hypothetical protein	NA	NA	NA	NA
WP_014479902.1\|1923033_1923504_+	hypothetical protein	NA	NA	NA	NA
WP_046381051.1\|1924300_1925692_+	MFS transporter	NA	NA	NA	NA
WP_014479906.1\|1925722_1927324_+	glycoside hydrolase family 43 protein	NA	NA	NA	NA
WP_046381052.1\|1927461_1928616_-	ROK family protein	NA	NA	NA	NA
WP_014479908.1\|1928853_1930191_+	xylose isomerase	NA	NA	NA	NA
WP_014479909.1\|1930341_1931841_+	xylulokinase	NA	NA	NA	NA
WP_080480854.1\|1932325_1933567_+\|transposase	IS256-like element ISBsu2 family transposase	NA	NA	NA	NA
WP_014479910.1\|1933696_1934332_-	endonuclease YncB	A0A1P8CWK6	Bacillus_phage	7.7e-73	68.5
WP_033881939.1\|1934744_1936160_+	sugar porter family MFS transporter	NA	NA	NA	NA
WP_031600564.1\|1936261_1937446_-	alanine racemase	NA	NA	NA	NA
WP_014479913.1\|1937856_1938282_-	hypothetical protein	NA	NA	NA	NA
WP_014479915.1\|1939200_1939635_+	dUTP diphosphatase	A0A1P8CX51	Bacillus_phage	5.8e-72	92.3
WP_033881937.1\|1940235_1940499_-\|coat	spore coat protein CotU	NA	NA	NA	NA
WP_003231643.1\|1940905_1941070_+	hypothetical protein	NA	NA	NA	NA
WP_014479918.1\|1941344_1942184_+	thymidylate synthase	A0A1P8CX42	Bacillus_phage	5.6e-164	98.2
WP_121509411.1\|1942306_1942594_-	hypothetical protein	NA	NA	NA	NA
WP_014479919.1\|1942636_1943356_-	hypothetical protein	NA	NA	NA	NA
WP_014479920.1\|1943515_1943872_-	hypothetical protein	NA	NA	NA	NA
WP_014479921.1\|1944117_1944318_-\|coat	spore coat protein CotC	NA	NA	NA	NA
WP_003231634.1\|1944492_1944681_-	twin-arginine translocase TatAC	NA	NA	NA	NA
WP_009967329.1\|1944934_1945333_+	hypothetical protein	NA	NA	NA	NA
WP_003231627.1\|1945398_1945833_-	SRPBCC domain-containing protein	NA	NA	NA	NA
WP_003231626.1\|1946139_1946328_+	hypothetical protein	NA	NA	NA	NA
WP_014479929.1\|1948988_1949795_+	hypothetical protein	NA	NA	NA	NA
WP_014479930.1\|1949799_1950432_+	DUF4166 domain-containing protein	NA	NA	NA	NA
WP_014479931.1\|1950413_1952054_+	hypothetical protein	NA	NA	NA	NA
WP_069837523.1\|1952682_1953441_+	gamma-polyglutamate hydrolase PghL	O64134	Bacillus_phage	1.3e-53	52.4
WP_031600569.1\|1953467_1954007_-	YndM family protein	NA	NA	NA	NA
WP_014479937.1\|1954125_1954545_+	metallothiol transferase FosB	Q2LI91	Bacillus_phage	2.0e-40	66.1
WP_003238209.1\|1955094_1955712_-	repressor LexA	A0A1B2APZ1	Phage_Wrath	2.5e-15	62.3
WP_003231598.1\|1955861_1956179_+	cell division suppressor protein YneA	NA	NA	NA	NA
WP_014479938.1\|1956197_1956851_+	recombinase family protein	NA	NA	NA	NA
WP_003231595.1\|1956914_1957148_+	DUF896 domain-containing protein	NA	NA	NA	NA
WP_069837524.1\|1957316_1959320_+	transketolase	NA	NA	NA	NA
WP_003231591.1\|1959472_1959919_+	sporulation inhibitor of replication protein SirA	NA	NA	NA	NA
WP_003221221.1\|1960004_1960223_+	YneF family protein	NA	NA	NA	NA
WP_010886518.1\|1960296_1960470_-	aspartyl-phosphate phosphatase YnzD	NA	NA	NA	NA
WP_003231585.1\|1960689_1961397_+	cytochrome c-type biogenesis protein CcdA	NA	NA	NA	NA
WP_003245707.1\|1961485_1961848_+	response regulator	NA	NA	NA	NA
WP_010886519.1\|1961926_1962418_+	CcdC family protein	NA	NA	NA	NA
WP_087614160.1\|1962476_1963627_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
WP_003231580.1\|1963738_1964167_-	DUF2621 domain-containing protein	NA	NA	NA	NA
WP_072592538.1\|1964400_1964793_-\|coat	outer spore coat protein CotM	NA	NA	NA	NA

DBSCAN-SWA_7

2100175 : 2107408

Bacillus_phage(85.71%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033881859.1\|2100175_2100535_-	hypothetical protein	A0A1P8CWJ9	Bacillus_phage	2.2e-61	98.3
WP_072592542.1\|2100794_2100878_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_019712872.1\|2101166_2101700_-	GNAT family N-acetyltransferase	O64026	Bacillus_phage	4.0e-99	98.9
WP_019712871.1\|2101735_2102314_-	SMI1/KNR4 family protein	O64025	Bacillus_phage	1.4e-100	93.2
WP_069837555.1\|2102369_2102828_-	SMI1 / KNR4 family protein	A0A1P8CWJ1	Bacillus_phage	1.1e-71	84.9
WP_041336410.1\|2102917_2103376_-	type II toxin-antitoxin system antitoxin YobK	NA	NA	NA	NA
WP_069837556.1\|2103385_2105188_-	type II toxin-antitoxin system toxin ribonuclease YobL	A0A1P8CWI7	Bacillus_phage	4.9e-221	87.6
WP_029318053.1\|2105286_2105844_-	SMI1/KNR4 family protein	O64022	Bacillus_phage	7.0e-102	95.7
WP_121509415.1\|2105971_2107408_+	flavin monoamine oxidase family protein	A0A2K9L022	Tupanvirus	2.6e-07	30.6

DBSCAN-SWA_8

2324511 : 2330606

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014480158.1\|2324511_2325105_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.6e-14	35.4
WP_014477220.1\|2325094_2325850_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	5.5e-09	29.2
WP_014480159.1\|2326129_2326654_+	DUF309 domain-containing protein	NA	NA	NA	NA
WP_003223910.1\|2326667_2327042_-	GNAT family N-acetyltransferase RibT	NA	NA	NA	NA
WP_003223915.1\|2327154_2327619_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.5e-44	60.0
WP_038828558.1\|2327651_2328848_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	4.1e-115	54.9
WP_014480161.1\|2328862_2329510_-	riboflavin synthase subunit alpha	A0A2H4PQS5	Staphylococcus_phage	8.5e-43	45.9
WP_069837609.1\|2329520_2330606_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	5.1e-56	36.1

DBSCAN-SWA_9

2580821 : 2623885

uncultured_Caudovirales_phage(25.0%)

coat,transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014480339.1\|2580821_2582369_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_014479891.1\|2582365_2583124_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	5.8e-43	38.6
WP_072592549.1\|2583716_2583803_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_123772463.1\|2585215_2585521_+	hypothetical protein	NA	NA	NA	NA
WP_014480344.1\|2585913_2586393_-	hypothetical protein	NA	NA	NA	NA
WP_033881358.1\|2587009_2587276_+	hypothetical protein	NA	NA	NA	NA
WP_049832653.1\|2587414_2587567_-	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	8.4e-18	76.0
WP_014480349.1\|2589054_2589876_-	multidrug efflux transcriptional regulator BltR	NA	NA	NA	NA
WP_029727180.1\|2589992_2591195_+	multidrug efflux MFS transporter Blt	NA	NA	NA	NA
WP_015714357.1\|2591363_2591822_+	spermine/spermidine acetyltransferase	NA	NA	NA	NA
WP_031600262.1\|2591854_2593102_-\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
WP_019712547.1\|2593347_2594652_-	HlyC/CorC family transporter	NA	NA	NA	NA
WP_014477437.1\|2594941_2595085_-	YrzO family protein	NA	NA	NA	NA
WP_014480354.1\|2595102_2596068_-	DMT family transporter	NA	NA	NA	NA
WP_014480355.1\|2596193_2597060_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_069837644.1\|2597179_2598217_-	NAD(P)/FAD-dependent oxidoreductase	A0A2H4J2Q2	uncultured_Caudovirales_phage	4.1e-15	26.2
WP_014480357.1\|2598304_2599240_-	CDF family zinc transporter CzcD	NA	NA	NA	NA
WP_014478926.1\|2599429_2600554_-\|transposase	IS4-like element IS4Bsu1 family transposase	NA	NA	NA	NA
WP_046160626.1\|2601332_2602655_-	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_003245988.1\|2602819_2603152_-	branched-chain amino acid transporter AzlD	NA	NA	NA	NA
WP_069837645.1\|2603148_2603913_-	azaleucine resistance protein AzlC	NA	NA	NA	NA
WP_021480168.1\|2603925_2604399_-	azlBCD operon transcriptional regulator AzlB	NA	NA	NA	NA
WP_046381211.1\|2604732_2605008_-	barnase inhibitor	NA	NA	NA	NA
WP_069837646.1\|2605679_2606243_-	cysteine hydrolase	NA	NA	NA	NA
WP_080480882.1\|2606470_2606842_-	YrdB family protein	NA	NA	NA	NA
WP_014480368.1\|2607653_2608157_-	hypothetical protein	NA	NA	NA	NA
WP_069837647.1\|2608376_2609228_-	aminoglycoside 6-adenylyltransferase AadK	E4ZFP8	Streptococcus_phage	9.0e-93	58.2
WP_014480370.1\|2609623_2610667_+	nitronate monooxygenase	NA	NA	NA	NA
WP_014480371.1\|2611014_2611812_+	glutamate racemase	NA	NA	NA	NA
WP_032726255.1\|2612192_2612900_+	hypothetical protein	NA	NA	NA	NA
WP_072175780.1\|2613474_2613552_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_033881351.1\|2613838_2614000_-	hypothetical protein	NA	NA	NA	NA
WP_046160629.1\|2614063_2614822_-	ZinT family metal-binding protein	NA	NA	NA	NA
WP_046160630.1\|2614955_2615486_-	RNA polymerase sigma factor SigZ	A0A1V0DZZ1	Clostridioides_phage	2.1e-07	24.8
WP_029318151.1\|2615621_2616602_+	aldo/keto reductase	NA	NA	NA	NA
WP_014480377.1\|2616760_2617576_-	chitosanase	A0A223LHY0	Streptomyces_phage	3.7e-19	33.2
WP_003229850.1\|2618012_2618276_+	hypothetical protein	NA	NA	NA	NA
WP_038829669.1\|2618412_2619228_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_004398671.1\|2619634_2619991_-	SH3 domain-containing protein	NA	NA	NA	NA
WP_004399021.1\|2620043_2620403_-	SH3 domain-containing protein	NA	NA	NA	NA
WP_119123071.1\|2620674_2620776_-	hypothetical protein	NA	NA	NA	NA
WP_004398984.1\|2620918_2621305_-	VOC family protein	NA	NA	NA	NA
WP_003229845.1\|2621567_2621813_+\|coat	spore coat protein F-like protein YraG	NA	NA	NA	NA
WP_009967868.1\|2621830_2622199_+	conjugal transfer protein TraF	NA	NA	NA	NA
WP_003229843.1\|2622217_2623354_+	glutathione-dependent formaldehyde dehydrogenase	E3SJ82	Synechococcus_phage	2.2e-14	25.1
WP_014480384.1\|2623372_2623570_+	hypothetical protein	NA	NA	NA	NA
WP_003246006.1\|2623585_2623885_+\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_10

2703075 : 2756547

uncultured_Mediterranean_phage(12.5%)

tRNA,protease,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003229725.1\|2703075_2704221_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	3.4e-87	44.0
WP_003229723.1\|2704247_2705276_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_003222669.1\|2705305_2705506_-	DUF2905 domain-containing protein	NA	NA	NA	NA
WP_003229718.1\|2705498_2706503_-	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	1.1e-07	30.8
WP_003229717.1\|2706513_2707119_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_003229715.1\|2707257_2707770_-	sporulation cell-cell signaling protein BofC	NA	NA	NA	NA
WP_003246197.1\|2707817_2709125_-	MFS transporter	NA	NA	NA	NA
WP_015251559.1\|2709195_2710224_-	inositol 2-dehydrogenase	NA	NA	NA	NA
WP_024572252.1\|2710461_2711109_+	serine/threonine protein kinase	A0A2R3ZQF2	Marseillevirus	5.4e-05	26.3
WP_003229707.1\|2711154_2711277_-	hypothetical protein	NA	NA	NA	NA
WP_033881610.1\|2711361_2711808_+	hypothetical protein	NA	NA	NA	NA
WP_004398683.1\|2711814_2711955_+	hypothetical protein	NA	NA	NA	NA
WP_014480443.1\|2712118_2713573_+	alanine:cation symporter family protein	NA	NA	NA	NA
WP_033881612.1\|2713613_2714336_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_014480445.1\|2714438_2715035_-	spore germination protein SgpA	NA	NA	NA	NA
WP_014480446.1\|2715182_2716346_-\|coat	spore coat assembly protein SafA	NA	NA	NA	NA
WP_014480447.1\|2716462_2717569_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_014480448.1\|2717555_2718425_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_014480449.1\|2718378_2719974_-	L-aspartate oxidase	NA	NA	NA	NA
WP_033881608.1\|2720076_2721264_+	cysteine desulfurase NifS	A0A141ZJV0	Faustovirus	1.7e-33	27.4
WP_004398582.1\|2721223_2721766_+	transcription repressor NadR	NA	NA	NA	NA
WP_004398512.1\|2721790_2722648_-	prephenate dehydratase	NA	NA	NA	NA
WP_003222630.1\|2722664_2723108_-	transcriptional regulator ThrR	NA	NA	NA	NA
WP_003246161.1\|2723168_2724455_-	GTPase ObgE	NA	NA	NA	NA
WP_014480451.1\|2724488_2725067_-	sporulation initiation phosphotransferase Sop0B	NA	NA	NA	NA
WP_003229671.1\|2725144_2725267_+	hypothetical protein	NA	NA	NA	NA
WP_003222623.1\|2725387_2725672_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_003229669.1\|2725684_2726023_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_003229668.1\|2726025_2726334_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_014480452.1\|2726480_2727347_-	stage IV sporulation protein SpoIVFB	NA	NA	NA	NA
WP_014480453.1\|2727339_2728134_-	stage IV sporulation protein SpoIVFA	NA	NA	NA	NA
WP_014480454.1\|2728283_2729090_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_004398901.1\|2729091_2729772_-	septum site-determining protein MinC	NA	NA	NA	NA
WP_004398811.1\|2729824_2730343_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_003222609.1\|2730339_2731212_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_003229650.1\|2731242_2732256_-	rod shape-determining protein MreB	NA	NA	NA	NA
WP_014480455.1\|2732347_2733043_-	JAB domain-containing protein	NA	NA	NA	NA
WP_014480456.1\|2733079_2733649_-	septum formation protein Maf	NA	NA	NA	NA
WP_014480457.1\|2733801_2734800_-	stage II sporulation protein SpoIIB	NA	NA	NA	NA
WP_072592551.1\|2734933_2735680_-	prepilin peptidase	NA	NA	NA	NA
WP_014480460.1\|2735819_2737112_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_014480461.1\|2737171_2739814_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	3.7e-161	42.6
WP_003222590.1\|2740261_2740453_+	hypothetical protein	NA	NA	NA	NA
WP_014480462.1\|2740471_2741497_-\|coat	spore coat protein CotN	NA	NA	NA	NA
WP_014480463.1\|2741529_2743251_-\|coat	spore coat morphogenetic protein SpoVID	NA	NA	NA	NA
WP_014480464.1\|2743381_2744674_-	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_014480465.1\|2744703_2745678_-	porphobilinogen synthase	NA	NA	NA	NA
WP_014480466.1\|2745674_2746463_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_014480467.1\|2746452_2747397_-	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_003222575.1\|2747429_2748260_-	protein HemX	NA	NA	NA	NA
WP_004399038.1\|2748267_2749635_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_014477563.1\|2749864_2750362_+	hypothetical protein	NA	NA	NA	NA
WP_003229621.1\|2750383_2750971_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_014480468.1\|2750967_2753292_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.6e-182	43.7
WP_004398923.1\|2753472_2755131_-\|protease	Lon protease 2	A0A1V0SHJ7	Hokovirus	8.1e-05	33.7
WP_003229613.1\|2755284_2756547_-\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-148	64.9

DBSCAN-SWA_11

3012209 : 3063201

Staphylococcus_phage(20.0%)

transposase,coat,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014477741.1\|3012209_3012614_-\|holin	holin family protein	NA	NA	NA	NA
WP_003229083.1\|3012779_3013217_-	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	1.3e-47	61.4
WP_010886599.1\|3013309_3013486_+	YtzI protein	NA	NA	NA	NA
WP_014477743.1\|3013479_3013917_-	hypothetical protein	NA	NA	NA	NA
WP_003219361.1\|3014036_3014510_-	S-ribosylhomocysteine lyase	NA	NA	NA	NA
WP_003229076.1\|3014638_3014866_+	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	2.8e-25	70.3
WP_003229074.1\|3014862_3015426_-	carbonic anhydrase	NA	NA	NA	NA
WP_003219346.1\|3015519_3015768_-	type B 50S ribosomal protein L31	NA	NA	NA	NA
WP_003229073.1\|3015973_3017305_+	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_015384444.1\|3017347_3018388_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_003229069.1\|3018441_3018600_+	DUF1540 domain-containing protein	NA	NA	NA	NA
WP_069837708.1\|3018618_3019506_-	manganese ABC transporter permease MntD	NA	NA	NA	NA
WP_069837709.1\|3019495_3020803_-	manganese ABC transporter permease MntC	NA	NA	NA	NA
WP_017695441.1\|3020808_3021561_-	manganese ABC transporter ATP-binding protein MntB	G9BWD6	Planktothrix_phage	3.2e-17	34.9
WP_041337039.1\|3021579_3022500_-	manganese ABC transporter substrate-binding protein/adhesin MntA	NA	NA	NA	NA
WP_014480637.1\|3022779_3023895_-	o-succinylbenzoate synthase	NA	NA	NA	NA
WP_069837710.1\|3023891_3025352_-	o-succinylbenzoate--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	2.9e-75	32.9
WP_003229054.1\|3025442_3026258_-	1,4-dihydroxy-2-naphthoyl-CoA synthase	NA	NA	NA	NA
WP_015714575.1\|3026292_3027117_-	2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase	NA	NA	NA	NA
WP_069837711.1\|3027104_3028847_-	2-succinyl-5-enolpyruvyl-6-hydroxy-3- cyclohexene-1-carboxylic-acid synthase	NA	NA	NA	NA
WP_015251378.1\|3028843_3030259_-	isochorismate synthase MenF	NA	NA	NA	NA
WP_069837712.1\|3030548_3031268_+	yteA family sporulation protein	NA	NA	NA	NA
WP_069837713.1\|3031276_3032095_-	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	4.8e-51	42.2
WP_029946481.1\|3032266_3033553_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	2.3e-71	34.8
WP_069837714.1\|3033549_3034500_+	NAD-dependent epimerase/dehydratase family protein	A0A1V0SKV4	Klosneuvirus	1.9e-30	32.6
WP_014480646.1\|3034502_3035711_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_014480647.1\|3035798_3036227_-	hypothetical protein	NA	NA	NA	NA
WP_014480648.1\|3036228_3037284_-\|coat	spore coat protein CotS	NA	NA	NA	NA
WP_014480649.1\|3037298_3038432_-\|coat	spore coat protein CotSA	NA	NA	NA	NA
WP_072592554.1\|3038621_3039695_+\|coat	spore coat kinase CotI	NA	NA	NA	NA
WP_014480651.1\|3039774_3040242_+	TspO/MBR family protein	NA	NA	NA	NA
WP_014480652.1\|3040272_3042669_-	glycogen/starch/alpha-glucan phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	1.2e-12	40.2
WP_014480653.1\|3042655_3044110_-	glycogen synthase GlgA	NA	NA	NA	NA
WP_004398841.1\|3044106_3045138_-	glucose-1-phosphate adenylyltransferase subunit GlgD	NA	NA	NA	NA
WP_003229018.1\|3045161_3046304_-	glucose-1-phosphate adenylyltransferase	NA	NA	NA	NA
WP_069837715.1\|3046300_3048184_-	1,4-alpha-glucan branching enzyme	NA	NA	NA	NA
WP_003228966.1\|3055851_3056430_+	energy-coupled thiamine transporter ThiT	NA	NA	NA	NA
WP_014480655.1\|3056471_3056993_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_014480656.1\|3057010_3058540_-	flotillin lipid rafts scaffold protein FloT	A0A2I2L4B2	Orpheovirus	2.7e-07	27.9
WP_032727091.1\|3058560_3059085_-	membrane protein	NA	NA	NA	NA
WP_033881498.1\|3059252_3059741_+	DinB family protein	NA	NA	NA	NA
WP_014478984.1\|3059859_3061212_-\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.4e-87	41.8
WP_069837716.1\|3061326_3061905_-	molybdenum cofactor sulfurase	NA	NA	NA	NA
WP_003243227.1\|3061992_3063201_-\|holin	choline dehydrogenase	NA	NA	NA	NA

DBSCAN-SWA_12

3195450 : 3292160

114

Bacillus_phage(37.78%)

integrase,capsid,terminase,coat,portal,tail,transposase,plate,head,protease,holin

attL 3236142:3236163|attR 3273422:3273443

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069837738.1\|3195450_3196470_-\|coat	spore coat-associated protein CotNH	NA	NA	NA	NA
WP_003243814.1\|3196622_3197123_+	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	1.2e-41	56.0
WP_021480535.1\|3197149_3197920_-	5' nucleotidase NucF	NA	NA	NA	NA
WP_021480536.1\|3197948_3198383_-	DUF86 domain-containing protein	NA	NA	NA	NA
WP_003228682.1\|3198406_3198682_-	YutD family protein	NA	NA	NA	NA
WP_021480537.1\|3198795_3199428_+	hypothetical protein	NA	NA	NA	NA
WP_003222888.1\|3199443_3200340_-	lipoyl synthase	NA	NA	NA	NA
WP_014480753.1\|3200574_3201555_+	M23 family metallopeptidase	A0A075BS18	Microcystis_phage	3.0e-07	37.3
WP_015483652.1\|3201582_3202350_-	sporulation protein YunB	NA	NA	NA	NA
WP_014480755.1\|3202422_3202728_-	YunC family protein	NA	NA	NA	NA
WP_069837739.1\|3202792_3204181_-	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_044052462.1\|3204200_3205022_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_003243895.1\|3205039_3205888_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_015714653.1\|3205925_3206273_-	hypothetical protein	NA	NA	NA	NA
WP_069837740.1\|3206369_3207710_-	allantoinase	NA	NA	NA	NA
WP_069837741.1\|3207884_3209480_+	purine catabolism transcriptional regulator PucR	NA	NA	NA	NA
WP_069837742.1\|3209624_3210974_+	uric acid permease PucJ	Q9KX94	Enterobacteria_phage	1.2e-25	28.1
WP_121509431.1\|3210979_3212260_+	uric acid permease PucK	Q9KX94	Enterobacteria_phage	7.6e-27	30.0
WP_021480543.1\|3212280_3213765_+	urate oxidase	NA	NA	NA	NA
WP_031315332.1\|3213764_3214109_+	hydroxyisourate hydrolase	NA	NA	NA	NA
WP_009968115.1\|3214530_3214662_+	YhzE/YjcZ family sporulation protein YuzJ	NA	NA	NA	NA
WP_014480766.1\|3214867_3215389_-	xanthine dehydrogenase subunit E	NA	NA	NA	NA
WP_014480767.1\|3215379_3217617_-	xanthine dehydrogenase subunit D	NA	NA	NA	NA
WP_069837744.1\|3217617_3218451_-	xanthine dehydrogenase subunit C	NA	NA	NA	NA
WP_049139629.1\|3218447_3219065_-	xanthine dehydrogenase accessory protein PucB	NA	NA	NA	NA
WP_049139630.1\|3219061_3220054_-	XdhC family protein	NA	NA	NA	NA
WP_014480772.1\|3220280_3221531_-	(S)-ureidoglycine--glyoxylate transaminase	NA	NA	NA	NA
WP_069837745.1\|3221547_3222786_-	allantoate deiminase	NA	NA	NA	NA
WP_032726822.1\|3223231_3224098_+	ribonuclease	NA	NA	NA	NA
WP_014480776.1\|3224276_3225380_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	Q6GZ03	Mycoplasma_phage	5.0e-19	29.7
WP_014480777.1\|3225561_3226290_+	transcriptional regulator FrlR	NA	NA	NA	NA
WP_003228626.1\|3226314_3227169_-	fructoselysine 6-kinase	NA	NA	NA	NA
WP_014480780.1\|3228081_3228960_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_003243455.1\|3229017_3230286_-	carbohydrate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_069837746.1\|3230366_3231353_-	SIS domain-containing protein	A0A2L2DN46	Acanthamoeba_polyphaga_mimivirus	1.9e-09	23.6
WP_003228617.1\|3231567_3231942_-	nucleotide excision repair endonuclease	NA	NA	NA	NA
WP_069837747.1\|3232044_3233163_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_003228613.1\|3233321_3233468_+	acid-soluble spore protein SspG	NA	NA	NA	NA
WP_003243521.1\|3233467_3233743_+	hypothetical protein	NA	NA	NA	NA
WP_087614170.1\|3233800_3234951_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
WP_014480784.1\|3235096_3235480_-	methylglyoxalase	NA	NA	NA	NA
WP_033882108.1\|3235589_3235868_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
3236142:3236163	attL	NA	NA	NA	NA
WP_069837932.1\|3236606_3236795_+	hypothetical protein	A0A2H4J4T3	uncultured_Caudovirales_phage	3.2e-11	50.0
WP_069837748.1\|3236954_3238727_+	ribonuclease YeeF family protein	A0A1P8CWI7	Bacillus_phage	1.6e-120	54.7
WP_069837749.1\|3238739_3239201_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_069837750.1\|3239251_3240193_-	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	3.0e-97	77.1
WP_014480878.1\|3240234_3240657_-\|holin	holin family protein	D6R405	Bacillus_phage	3.0e-57	85.7
WP_014480879.1\|3240710_3240881_-	XkdX family protein	NA	NA	NA	NA
WP_031600923.1\|3240877_3241177_-	hypothetical protein	M4ZR44	Bacillus_phage	1.5e-39	79.2
WP_069837751.1\|3241192_3242416_-\|plate	phage baseplate upper protein	M4ZRP1	Bacillus_phage	9.1e-179	80.3
WP_033881098.1\|3244040_3245915_-	autolysin	D6R400	Bacillus_phage	5.5e-50	27.8
WP_014479880.1\|3245928_3246762_-\|tail	phage tail family protein	M4ZS20	Bacillus_phage	3.5e-33	34.1
WP_069837752.1\|3246774_3250515_-	transglycosylase SLT domain-containing protein	A0A0S2SXL7	Bacillus_phage	9.1e-105	60.4
WP_014479878.1\|3250577_3250760_-	hypothetical protein	NA	NA	NA	NA
WP_014479877.1\|3250771_3251134_-	hypothetical protein	NA	NA	NA	NA
WP_014479876.1\|3251193_3251778_-	hypothetical protein	U5U3Z7	Lactobacillus_phage	9.1e-28	36.5
WP_014479875.1\|3251783_3252191_-	hypothetical protein	NA	NA	NA	NA
WP_031600548.1\|3252187_3252580_-	hypothetical protein	A0A0M5M1E5	Enterococcus_phage	3.0e-11	37.9
WP_014479873.1\|3252579_3252906_-\|head	phage head closure protein	NA	NA	NA	NA
WP_014479872.1\|3252895_3253189_-\|head,tail	phage gp6-like head-tail connector protein	A0A2H4JB77	uncultured_Caudovirales_phage	2.6e-07	33.0
WP_014479871.1\|3253243_3253627_-	collagen-like protein	D6R3Z0	Bacillus_phage	1.4e-05	56.8
WP_043856934.1\|3253654_3254857_-\|capsid	phage major capsid protein	A0A2H4J824	uncultured_Caudovirales_phage	8.3e-76	49.8
WP_043856935.1\|3254905_3255502_-\|head,protease	HK97 family phage prohead protease	A0A1J0MFL1	Staphylococcus_phage	3.6e-48	53.3
WP_043856936.1\|3255494_3256721_-\|portal	phage portal protein	A0A2H4J331	uncultured_Caudovirales_phage	5.3e-70	38.8
WP_043856937.1\|3256725_3256932_-	hypothetical protein	NA	NA	NA	NA
WP_043857127.1\|3256948_3258655_-\|terminase	terminase large subunit	A0A2H4JC16	uncultured_Caudovirales_phage	1.9e-121	42.8
WP_043856938.1\|3258647_3259142_-\|terminase	phage terminase small subunit P27 family	A0A1Q1PVW3	Staphylococcus_phage	9.1e-21	36.1
WP_043856939.1\|3259375_3259588_-	hypothetical protein	NA	NA	NA	NA
WP_069837754.1\|3260076_3260691_-	hypothetical protein	NA	NA	NA	NA
WP_069837755.1\|3260827_3261388_-	hypothetical protein	NA	NA	NA	NA
WP_003220264.1\|3261645_3262188_-\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	5.8e-61	63.9
WP_069837933.1\|3262184_3262637_-	ArpU family transcriptional regulator	S6AVV9	Thermus_phage	1.7e-37	55.9
WP_155118967.1\|3263076_3263250_-	hypothetical protein	Q38078	Bacillus_phage	3.7e-22	91.2
WP_069837757.1\|3263246_3263633_-	hypothetical protein	A0A1P8CWX0	Bacillus_phage	3.8e-14	36.2
WP_080480871.1\|3263629_3264109_-	hypothetical protein	F8WQ59	Bacillus_phage	1.0e-21	53.8
WP_069837758.1\|3264108_3264801_-	dUTPase	R9TQ23	Paenibacillus_phage	6.7e-38	43.7
WP_048217676.1\|3264963_3265212_-	hypothetical protein	A0A2H4JA61	uncultured_Caudovirales_phage	6.0e-05	44.9
WP_069837759.1\|3265208_3265616_-	hypothetical protein	W8CYU3	Bacillus_phage	2.9e-25	45.0
WP_048217677.1\|3265612_3265897_-	hypothetical protein	NA	NA	NA	NA
WP_048217678.1\|3265940_3266138_-	hypothetical protein	NA	NA	NA	NA
WP_003237439.1\|3266385_3266526_-	BH0509 family protein	NA	NA	NA	NA
WP_048217679.1\|3266633_3267182_-	hypothetical protein	A0A0K2CYJ0	Paenibacillus_phage	4.6e-05	39.3
WP_153952969.1\|3267333_3267495_-	hypothetical protein	NA	NA	NA	NA
WP_048217680.1\|3267481_3268336_-	AAA family ATPase	Q4ZAS1	Staphylococcus_virus	2.2e-22	29.4
WP_069837760.1\|3268286_3269126_-	DNA replication protein DnaD	A0A0U3TZZ4	Bacillus_phage	1.4e-66	51.4
WP_069837761.1\|3269118_3269349_-	hypothetical protein	NA	NA	NA	NA
WP_080480872.1\|3269642_3269927_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_069837763.1\|3270030_3270426_+	helix-turn-helix transcriptional regulator	I3VYZ1	Thermoanaerobacterium_phage	6.6e-06	39.1
WP_069837764.1\|3270657_3270852_-	hypothetical protein	NA	NA	NA	NA
WP_069837765.1\|3270848_3271973_-	helix-turn-helix transcriptional regulator	A0A1B1P786	Bacillus_phage	2.8e-09	24.0
WP_069837766.1\|3272305_3273343_+\|integrase	site-specific integrase	A0A223LI82	Staphylococcus_phage	1.8e-87	47.1
WP_003228608.1\|3273417_3274815_-	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
3273422:3273443	attR	NA	NA	NA	NA
WP_003222809.1\|3274835_3275279_-	iron-sulfur cluster assembly scaffold protein SufU	A0A2P1CJL8	Mycobacterium_phage	1.9e-14	38.7
WP_003228604.1\|3275268_3276489_-	cysteine desulfurase SufS	Q2XUY6	environmental_halophage	3.4e-117	47.8
WP_014480787.1\|3276488_3277802_-	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_014477918.1\|3277819_3278605_-	Fe-S cluster assembly ATPase SufC	W8CYL7	Bacillus_phage	6.5e-05	23.6
WP_003228600.1\|3278798_3278936_-	hypothetical protein	NA	NA	NA	NA
WP_014477920.1\|3279129_3279507_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_069837767.1\|3279591_3280416_-	methionine ABC transporter substrate-binding lipoprotein MetQ	NA	NA	NA	NA
WP_003228593.1\|3280429_3281098_-	methionine ABC transporter permease MetP	NA	NA	NA	NA
WP_003242531.1\|3281090_3282116_-	methionine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.4e-31	36.5
WP_014480791.1\|3282442_3282787_-	hypothetical protein	NA	NA	NA	NA
WP_014480792.1\|3282893_3283214_-	thioredoxin family protein	NA	NA	NA	NA
WP_014480793.1\|3283215_3283656_-	toprim domain-containing protein	NA	NA	NA	NA
WP_014480794.1\|3283655_3283892_-	YusG family protein	NA	NA	NA	NA
WP_003222781.1\|3283947_3284331_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_003222779.1\|3284397_3284754_-	arsenate reductase family protein	M1PLC0	Streptococcus_phage	1.8e-23	54.6
WP_069837768.1\|3284864_3286649_-	acyl-CoA dehydrogenase FadE	NA	NA	NA	NA
WP_014480796.1\|3286666_3287842_-	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_041337967.1\|3287852_3290222_-	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
WP_003240817.1\|3290396_3290543_+	YuzL family protein	NA	NA	NA	NA
WP_041333072.1\|3290567_3291476_-	proline dehydrogenase	A0A2H4PQT6	Staphylococcus_phage	3.9e-62	42.2
WP_003228567.1\|3291569_3291815_+	hypothetical protein	NA	NA	NA	NA
WP_003222766.1\|3291827_3292160_+\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_13

3373927 : 3441493

Bacillus_phage(65.22%)

integrase,capsid,terminase,portal,tail,transposase,plate,head,protease,holin

attL 3384995:3385017|attR 3424658:3424680

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014478984.1\|3373927_3375280_-\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.4e-87	41.8
WP_033882081.1\|3375404_3377816_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.3e-120	37.8
WP_003228406.1\|3377899_3378109_-	copper chaperone CopZ	NA	NA	NA	NA
WP_003228404.1\|3378184_3378490_-	copper-sensing transcriptional repressor CsoR	NA	NA	NA	NA
WP_014480865.1\|3378617_3379694_+	scyllo-inositol 2-dehydrogenase	NA	NA	NA	NA
WP_069837778.1\|3380525_3382421_-	FUSC family protein	NA	NA	NA	NA
WP_069837779.1\|3382583_3382985_-	YvaD family protein	NA	NA	NA	NA
WP_069837780.1\|3382981_3383341_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_003243160.1\|3383337_3383910_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003228388.1\|3384020_3384815_-	SDR family oxidoreductase	NA	NA	NA	NA
3384995:3385017	attL	NA	NA	NA	NA
WP_033882082.1\|3385324_3385513_+	hypothetical protein	A0A2H4J4T3	uncultured_Caudovirales_phage	1.4e-11	53.3
WP_014480874.1\|3385674_3387258_+	hypothetical protein	A0A1P8CWI7	Bacillus_phage	4.2e-75	59.7
WP_014480875.1\|3387272_3387662_+	hypothetical protein	NA	NA	NA	NA
WP_105778748.1\|3388004_3388607_+	hypothetical protein	NA	NA	NA	NA
WP_014480877.1\|3388646_3389588_-	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	3.0e-97	77.1
WP_014480878.1\|3389629_3390052_-\|holin	holin family protein	D6R405	Bacillus_phage	3.0e-57	85.7
WP_014480879.1\|3390105_3390276_-	XkdX family protein	NA	NA	NA	NA
WP_031600923.1\|3390272_3390572_-	hypothetical protein	M4ZR44	Bacillus_phage	1.5e-39	79.2
WP_069837751.1\|3390587_3391811_-\|plate	phage baseplate upper protein	M4ZRP1	Bacillus_phage	9.1e-179	80.3
WP_080480874.1\|3391847_3393422_-	hypothetical protein	M4ZSB3	Bacillus_phage	5.3e-264	88.5
WP_031600926.1\|3393458_3395165_-	hypothetical protein	D6R400	Bacillus_phage	9.4e-267	81.8
WP_031600927.1\|3395176_3396016_-\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	8.5e-136	83.2
WP_033882059.1\|3396015_3399894_-\|tail	phage tail tape measure protein	D6R3Z8	Bacillus_phage	0.0e+00	81.0
WP_017696308.1\|3399906_3400086_-	hypothetical protein	D6R3Z7	Bacillus_phage	1.6e-12	68.5
WP_003220222.1\|3400088_3400427_-	hypothetical protein	Q9ZXE8	Bacillus_phage	3.0e-39	70.5
WP_017696306.1\|3400481_3401093_-\|tail	major tail protein	Q9ZXE9	Bacillus_phage	7.9e-99	89.7
WP_031600930.1\|3401093_3401474_-	DUF3168 domain-containing protein	Q9ZXF0	Bacillus_phage	2.6e-39	66.1
WP_033882058.1\|3401470_3401854_-	HK97 gp10 family phage protein	Q9ZXF1	Bacillus_phage	2.9e-59	86.6
WP_033882056.1\|3401846_3402218_-\|head	phage head closure protein	Q9ZXF2	Bacillus_phage	3.5e-41	68.3
WP_031600933.1\|3402150_3402498_-\|head,tail	phage gp6-like head-tail connector protein	Q9ZXF3	Bacillus_phage	2.0e-51	87.0
WP_031600934.1\|3402513_3403005_-	collagen-like protein	D6R3Z0	Bacillus_phage	1.3e-27	69.1
WP_031600935.1\|3403033_3403348_-	hypothetical protein	Q9ZXF5	Bacillus_phage	6.8e-30	68.8
WP_033882054.1\|3403363_3404566_-\|capsid	phage major capsid protein	Q9ZXF6	Bacillus_phage	3.3e-157	71.5
WP_003220242.1\|3404602_3405229_-\|head,protease	HK97 family phage prohead protease	Q9ZXF7	Bacillus_phage	1.8e-106	92.8
WP_033882052.1\|3405218_3406466_-\|portal	phage portal protein	D6R3Y6	Bacillus_phage	1.3e-217	86.5
WP_033882051.1\|3406471_3406687_-	hypothetical protein	Q9ZXF9	Bacillus_phage	1.3e-24	80.6
WP_069837781.1\|3406699_3408409_-\|terminase	terminase large subunit	D6R3Y4	Bacillus_phage	0.0e+00	92.1
WP_017697674.1\|3408408_3408942_-\|terminase	phage terminase small subunit P27 family	Q9ZXG2	Bacillus_phage	1.0e-70	82.5
WP_046160532.1\|3409321_3409696_-	HNH endonuclease	Q38456	Bacillus_phage	7.5e-60	82.3
WP_033881251.1\|3409745_3410492_-	hypothetical protein	NA	NA	NA	NA
WP_069837782.1\|3411022_3411652_-	hypothetical protein	NA	NA	NA	NA
WP_123772464.1\|3411802_3412168_-	hypothetical protein	NA	NA	NA	NA
WP_003220264.1\|3412838_3413381_-\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	5.8e-61	63.9
WP_069837933.1\|3413377_3413830_-	ArpU family transcriptional regulator	S6AVV9	Thermus_phage	1.7e-37	55.9
WP_014480881.1\|3414112_3414313_-	hypothetical protein	NA	NA	NA	NA
WP_014480882.1\|3414309_3414729_-	hypothetical protein	A0A2I6UHP7	Bacillus_phage	1.6e-42	61.2
WP_014480883.1\|3414725_3415058_-	hypothetical protein	F8WQ59	Bacillus_phage	8.3e-18	53.3
WP_069837783.1\|3415057_3415714_-	dUTPase	R9TQ23	Paenibacillus_phage	5.8e-39	46.0
WP_014480885.1\|3415831_3416089_-	hypothetical protein	A0A2H4JA61	uncultured_Caudovirales_phage	6.6e-07	41.7
WP_014480886.1\|3416085_3416493_-	hypothetical protein	W8CYU3	Bacillus_phage	1.3e-25	45.8
WP_014480887.1\|3416489_3416807_-	hypothetical protein	NA	NA	NA	NA
WP_014480888.1\|3416803_3417166_-	hypothetical protein	NA	NA	NA	NA
WP_003220282.1\|3417208_3417406_-	hypothetical protein	NA	NA	NA	NA
WP_003237439.1\|3417652_3417793_-	BH0509 family protein	NA	NA	NA	NA
WP_014480892.1\|3417900_3418449_-	hypothetical protein	NA	NA	NA	NA
WP_014480894.1\|3418763_3419591_-	ATP-binding protein	A0A0U3U1U1	Bacillus_phage	3.7e-35	35.9
WP_014480895.1\|3419574_3420456_-	phage replisome organiser	V9QKF6	Oenococcus_phage	6.8e-27	33.1
WP_033881245.1\|3420448_3420667_-	hypothetical protein	NA	NA	NA	NA
WP_033881244.1\|3420691_3420883_-	helix-turn-helix domain-containing protein	A0A1B2APY7	Phage_Wrath	1.0e-12	59.0
WP_014480896.1\|3420934_3421138_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_014480897.1\|3421372_3421771_+	helix-turn-helix transcriptional regulator	S5M5X8	Brevibacillus_phage	4.3e-05	33.7
WP_003220025.1\|3425199_3425670_-	SsrA-binding protein	W5RAM5	Staphylococcus_phage	3.2e-47	63.4
3424658:3424680	attR	NA	NA	NA	NA
WP_069837784.1\|3425814_3428154_-	ribonuclease R	Q0GXV6	Lactococcus_phage	1.3e-88	43.4
WP_003242610.1\|3428172_3428913_-	carboxylesterase	NA	NA	NA	NA
WP_003220028.1\|3429044_3429275_-	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_014480904.1\|3429423_3430197_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003220031.1\|3430230_3430464_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003220034.1\|3430615_3431023_+	transcriptional repressor RghR	S6C481	Thermus_phage	1.9e-16	64.8
WP_014480905.1\|3431052_3431472_+	helix-turn-helix transcriptional regulator	S6C481	Thermus_phage	5.4e-14	62.7
WP_003242888.1\|3431563_3431890_+	catDE operon transcriptional regulator CatR	NA	NA	NA	NA
WP_014480906.1\|3432017_3433718_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.0e-24	29.8
WP_069837785.1\|3433758_3434439_-\|holin	choline ABC transporter permease OpuBD	NA	NA	NA	NA
WP_041338970.1\|3434455_3435376_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_069837786.1\|3435387_3436041_-\|holin	choline ABC transporter permease OpuBB	NA	NA	NA	NA
WP_069837787.1\|3436057_3437203_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	4.6e-15	32.7
WP_024571735.1\|3437486_3438020_+	GbsR/MarR family transcriptional regulator	NA	NA	NA	NA
WP_046160851.1\|3438051_3438726_-\|holin	glycine betaine/carnitine/choline/choline sulfate ABC transporter permease OpuCD	NA	NA	NA	NA
WP_080480888.1\|3438743_3439655_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_046160853.1\|3439674_3440328_-\|holin	glycine betaine/carnitine/choline/choline sulfate ABC transporter permease OpuCB	NA	NA	NA	NA
WP_069837788.1\|3440350_3441493_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	F2Y1V5	Organic_Lake_phycodnavirus	2.8e-12	29.6

DBSCAN-SWA_14

3782359 : 3803098

Shigella_phage(25.0%)

bacteriocin,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087614167.1\|3782359_3783549_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.6e-31	36.6
WP_003227612.1\|3783650_3785258_-	CTP synthase (glutamine hydrolyzing)	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.0e-153	52.1
WP_014481200.1\|3785499_3786006_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_069837822.1\|3786188_3787328_-	acyl-CoA dehydrogenase AcdA	NA	NA	NA	NA
WP_069837823.1\|3787324_3789442_-	4Fe-4S dicluster domain-containing protein	NA	NA	NA	NA
WP_017696271.1\|3789596_3790793_+	cardiolipin synthase	NA	NA	NA	NA
WP_069837824.1\|3790805_3791768_+	UV DNA damage repair endonuclease UvsE	A0A127AW32	Bacillus_phage	1.7e-39	34.2
WP_003227597.1\|3791848_3792121_+	hypothetical protein	NA	NA	NA	NA
WP_003227570.1\|3793750_3795421_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_014481216.1\|3795417_3795846_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_003222002.1\|3796160_3796292_+\|bacteriocin	subtilosin A family bacteriocin	NA	NA	NA	NA
WP_010886632.1\|3796248_3796401_+\|bacteriocin	bacteriocin-like protein SboX	NA	NA	NA	NA
WP_069837825.1\|3796425_3797772_+	subtilosin maturase AlbA	NA	NA	NA	NA
WP_003222006.1\|3797784_3797946_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbB	NA	NA	NA	NA
WP_069837826.1\|3797942_3798662_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-18	27.6
WP_069837827.1\|3798654_3799965_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbD	NA	NA	NA	NA
WP_080480890.1\|3799954_3801115_+	insulinase family protein	NA	NA	NA	NA
WP_069837829.1\|3801119_3802400_+	insulinase family protein	NA	NA	NA	NA
WP_069837830.1\|3802396_3803098_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbG	NA	NA	NA	NA

DBSCAN-SWA_15

3813110 : 3854379

Enterobacteria_phage(20.0%)

tRNA,protease,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003243167.1\|3813110_3813770_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_003222038.1\|3813878_3814067_+	2-hydroxymuconate tautomerase	NA	NA	NA	NA
WP_003227535.1\|3814109_3814529_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_014481228.1\|3814648_3816565_-\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	1.9e-143	43.4
WP_069837834.1\|3817409_3818810_-	MFS transporter	NA	NA	NA	NA
WP_003243988.1\|3818809_3819280_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003227524.1\|3819391_3819892_-	YwgA family protein	NA	NA	NA	NA
WP_003243873.1\|3819927_3821229_-	HD domain-containing protein	E3T4P8	Cafeteria_roenbergensis_virus	4.2e-25	28.9
WP_003222050.1\|3821390_3821615_-	DUF1450 domain-containing protein	NA	NA	NA	NA
WP_003227516.1\|3821829_3822606_+	prespore-specific transcription regulator RsfA	A0A1D6X8E5	Bacillus_phage	7.6e-06	50.0
WP_033881831.1\|3822749_3823640_-	DMT family transporter	NA	NA	NA	NA
WP_014481232.1\|3823808_3824654_-	octanoyl-[GcvH]:protein N-octanoyltransferase	NA	NA	NA	NA
WP_014481233.1\|3824702_3825602_-	cysJI operon transcriptional regulator CysL	A0A2H4J8I9	uncultured_Caudovirales_phage	3.6e-07	42.5
WP_003235941.1\|3825747_3826719_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_003227507.1\|3826988_3827753_+	heme-dependent peroxidase	NA	NA	NA	NA
WP_014481234.1\|3827885_3828665_+	NADPH-dependent reductase BacG	NA	NA	NA	NA
WP_031601099.1\|3828680_3829895_-	transaminase BacF	NA	NA	NA	NA
WP_014481236.1\|3829895_3831080_-	bacilysin exporter BacE	NA	NA	NA	NA
WP_003242921.1\|3831076_3832495_-	alanine--anticapsin ligase	NA	NA	NA	NA
WP_003243359.1\|3832513_3833275_-	dihydroanticapsin 7-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	2.8e-21	30.9
WP_003244300.1\|3833277_3833985_-	3-((4R)-4-hydroxycyclohexa-1, 5-dien-1-yl)-2-oxopropanoate isomerase	NA	NA	NA	NA
WP_009968341.1\|3833974_3834589_-	prephenate decarboxylase	NA	NA	NA	NA
WP_014481237.1\|3834740_3835979_-	MFS transporter	NA	NA	NA	NA
WP_015250969.1\|3836188_3837601_-	amino acid permease	NA	NA	NA	NA
WP_014481239.1\|3837600_3839301_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_014478322.1\|3839374_3840922_-	L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_003227482.1\|3841148_3842423_-	glutamate dehydrogenase	NA	NA	NA	NA
WP_003227472.1\|3842600_3843065_-	biofilm-surface layer protein BslB	NA	NA	NA	NA
WP_069837835.1\|3843389_3843845_-\|coat	spore coat protein	NA	NA	NA	NA
WP_069837836.1\|3843837_3844689_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.7e-38	39.3
WP_003244201.1\|3844702_3845650_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	4.4e-72	43.8
WP_017696230.1\|3845649_3846390_-	NTP transferase domain-containing protein	I7I009	Enterobacteria_phage	7.7e-48	42.0
WP_017696229.1\|3846414_3847434_-\|coat	spore coat protein	NA	NA	NA	NA
WP_017696228.1\|3847436_3848159_-\|coat	spore coat protein	NA	NA	NA	NA
WP_041054693.1\|3848151_3849273_-\|coat	spore coat protein	NA	NA	NA	NA
WP_069837837.1\|3849272_3850142_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_069837838.1\|3850142_3851312_-	DegT/DnrJ/EryC1/StrS aminotransferase family protein	A0A1D8KU11	Synechococcus_phage	6.5e-17	27.2
WP_069837839.1\|3851332_3852754_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_015250957.1\|3852758_3853529_-\|coat	spore coat dTDP-glycosyltransferase SpsA	A0A0F7L2F7	uncultured_marine_virus	3.4e-06	28.6
WP_069837841.1\|3853848_3854379_+\|coat	spore coat protein GerQ	NA	NA	NA	NA

DBSCAN-SWA_16

3893112 : 3953348

Streptococcus_phage(30.77%)

lysis,transposase,tRNA,protease,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014481281.1\|3893112_3893499_+\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA
WP_003227371.1\|3893480_3894158_+\|lysis	CidB/LrgB family autolysis modulator	NA	NA	NA	NA
WP_014481282.1\|3894262_3895465_+	MFS transporter	NA	NA	NA	NA
WP_014481283.1\|3895498_3895696_+	YwbE family protein	NA	NA	NA	NA
WP_069837851.1\|3895730_3896918_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	4.1e-75	42.4
WP_014481285.1\|3897038_3897419_+	glyoxalase GlxA	NA	NA	NA	NA
WP_014481286.1\|3897457_3898135_-	DUF2711 domain-containing protein	NA	NA	NA	NA
WP_069837852.1\|3898226_3899549_-	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
WP_069837853.1\|3902139_3903519_+	SacY negative regulator SacX	NA	NA	NA	NA
WP_003227349.1\|3903572_3904415_+	PRD domain-containing protein	NA	NA	NA	NA
WP_014478984.1\|3904555_3905908_-\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.4e-87	41.8
WP_069837854.1\|3906046_3906907_-	glycosyltransferase family 8 protein	A0A2P0VP84	Tetraselmis_virus	2.9e-06	27.2
WP_014481294.1\|3907017_3907731_-	TIGR02206 family membrane protein	NA	NA	NA	NA
WP_003227345.1\|3907881_3908397_+	tyrZ transcriptional regulator YwaE	NA	NA	NA	NA
WP_014481295.1\|3908647_3909889_+\|tRNA	tyrosine--tRNA ligase	NA	NA	NA	NA
WP_014481296.1\|3910044_3911412_+	aminopeptidase YwaD	NA	NA	NA	NA
WP_003244564.1\|3911441_3912074_-	GTP pyrophosphokinase YwaC	NA	NA	NA	NA
WP_087614167.1\|3912283_3913472_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.6e-31	36.6
WP_017697250.1\|3913528_3914464_-	1,4-dihydroxy-2-naphthoate polyprenyltransferase	NA	NA	NA	NA
WP_014481297.1\|3914626_3914761_-	hypothetical protein	NA	NA	NA	NA
WP_003227330.1\|3914910_3915060_+	teichoic acid D-Ala incorporation-associated protein DltX	NA	NA	NA	NA
WP_069837855.1\|3915077_3916589_+	D-alanine--poly(phosphoribitol) ligase subunit DltA	A0A2K9KZV5	Tupanvirus	1.6e-47	29.6
WP_003227327.1\|3916585_3917773_+	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	5.2e-22	27.9
WP_003227325.1\|3917789_3918026_+	D-alanine--poly(phosphoribitol) ligase subunit DltC	NA	NA	NA	NA
WP_003227323.1\|3918025_3919204_+	D-alanyl-lipoteichoic acid biosynthesis protein DltD	NA	NA	NA	NA
WP_003244231.1\|3920190_3921282_+	branched-chain amino acid aminotransferase	NA	NA	NA	NA
WP_014481301.1\|3921315_3922644_-	6-phospho-beta-glucosidase	NA	NA	NA	NA
WP_003227313.1\|3922640_3922973_-	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_014481302.1\|3922991_3924350_-	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
WP_003218755.1\|3924365_3924674_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_033881877.1\|3924802_3926728_-	transcriptional regulator LicR	NA	NA	NA	NA
WP_033881879.1\|3926890_3927049_-	hypothetical protein	NA	NA	NA	NA
WP_003227303.1\|3927077_3927668_-	DNA-3-methyladenine glycosylase	NA	NA	NA	NA
WP_003243042.1\|3927796_3929440_+	catalase	A0A2K9L572	Tupanvirus	1.4e-97	45.2
WP_014481307.1\|3929543_3930746_+	MFS transporter	NA	NA	NA	NA
WP_069837856.1\|3930742_3931519_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_069837857.1\|3931515_3932403_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	5.3e-27	33.0
WP_014481310.1\|3932409_3932598_-	negative regulatory protein YxlE	NA	NA	NA	NA
WP_014481311.1\|3932594_3932801_-	hypothetical protein	NA	NA	NA	NA
WP_014481312.1\|3932797_3933118_-	YxlC family protein	NA	NA	NA	NA
WP_014481313.1\|3933110_3933647_-	RNA polymerase sigma factor SigY	NA	NA	NA	NA
WP_014481314.1\|3933858_3935232_+	cytosine permease	NA	NA	NA	NA
WP_038429854.1\|3935246_3936077_-	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
WP_014481316.1\|3936162_3937890_-	thiol reductant ABC exporter subunit CydC	W8CYL7	Bacillus_phage	1.1e-23	24.6
WP_014481317.1\|3937886_3939590_-	thiol reductant ABC exporter subunit CydD	W8CYL7	Bacillus_phage	5.9e-19	22.7
WP_003244559.1\|3939589_3940606_-	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_014481318.1\|3940589_3941996_-	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_031601119.1\|3942550_3943903_+	citrate/malate transporter CimH	NA	NA	NA	NA
WP_072592569.1\|3944024_3945713_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_014481322.1\|3945770_3945971_+	hypothetical protein	NA	NA	NA	NA
WP_014481323.1\|3945984_3946824_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_003242648.1\|3946930_3948028_-	maltodextrin ABC transporter ATP-binding protein MsmX	G9BWD6	Planktothrix_phage	2.4e-21	31.2
WP_003227261.1\|3948148_3949042_-	PucR family transcriptional regulator	NA	NA	NA	NA
WP_069837858.1\|3949225_3950683_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_003242615.1\|3950724_3951561_-	YitT family protein	M1Q1P6	Streptococcus_phage	1.0e-40	33.6
WP_014478984.1\|3951995_3953348_-\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.4e-87	41.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP015222

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection