CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP014534	Enterococcus faecium strain E745 plasmid pl5, complete sequence	0 crisprs	RT	0	4
NZ_CP014532	Enterococcus faecium strain E745 plasmid pl3, complete sequence	0 crisprs	NA	0	0
NZ_CP014535	Enterococcus faecium strain E745 plasmid pl6, complete sequence	0 crisprs	RT	0	6
NZ_CP014531	Enterococcus faecium strain E745 plasmid pl2, complete sequence	0 crisprs	NA	0	3
NZ_CP014529	Enterococcus faecium strain E745, complete genome	1 crisprs	DEDDh,csa3,cas14j,cas3,DinG,RT,cas2	0	13
NZ_CP014533	Enterococcus faecium strain E745 plasmid pl4, complete sequence	0 crisprs	NA	0	0
NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	1 crisprs	cas14j,RT	2	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 741

Aeromonas_phage(100.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002332580.1\|123_741_-	recombinase family protein	A0A219YA40	Aeromonas_phage	4.5e-17	36.1

DBSCAN-SWA_2

4748 : 16119

Streptococcus_phage(42.86%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002354485.1\|4748_5435_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_000402347.1\|5704_6313_-	D-Ala-D-Ala dipeptidase VanX-A	NA	NA	NA	NA
WP_001079845.1\|6318_7350_-	D-alanine--(R)-lactate ligase VanA	NA	NA	NA	NA
WP_001059542.1\|7342_8311_-	D-lactate dehydrogenase VanH-A	M1HUW8	Acanthocystis_turfacea_Chlorella_virus	3.5e-40	33.1
WP_002305818.1\|8525_9680_-	VanA-type vancomycin resistance histidine kinase VanS	W8CYF6	Bacillus_phage	1.5e-13	23.3
WP_001280781.1\|9657_10353_-	VanA-type vancomycin resistance DNA-binding response regulator VanR	W8CYM9	Bacillus_phage	4.9e-36	37.7
WP_002354485.1\|10467_11154_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_069972710.1\|11185_11482_-	type III secretion system protein PrgN	NA	NA	NA	NA
WP_000947691.1\|11616_13110_-	replication protein RepR	NA	NA	NA	NA
WP_000429439.1\|13721_14675_+	ParA family protein	F0PIG8	Enterococcus_phage	7.7e-16	26.1
WP_001196543.1\|14646_14922_+	hypothetical protein	NA	NA	NA	NA
WP_002354485.1\|15432_16119_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6

DBSCAN-SWA_3

20417 : 27184

Streptococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002354485.1\|20417_21104_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_002354485.1\|23162_23849_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_002321606.1\|25375_25981_+	recombinase family protein	A0A219YA40	Aeromonas_phage	1.2e-19	33.2
WP_000824191.1\|26025_26193_-	hypothetical protein	NA	NA	NA	NA
WP_000366408.1\|26226_26526_-	hypothetical protein	NA	NA	NA	NA
WP_001224538.1\|26566_27184_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	5.1e-13	33.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP014529

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP014529_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014529_1

2331105-2331214

Orphan

Consensus_repeat	Method
CTTTGCTCAACCAGTATTATTCATCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP014529_1

>merge|NZ_CP014529|1|2331105-2331214|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCACCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCGCTTTGCTCAACCAGTATTGTTCATCA

>NZ_CP014529|1|1|2331105-2331214|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCA	CCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCG
CTTTGCTCAACCAGTATTGTTCATCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014529.1\|WP_002294578.1\|2337639_2337792_-\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|234783
NZ_CP014529.1\|WP_002294581.1\|2335835_2336723_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|283645
NZ_CP014529.1\|WP_002291634.1\|2330528_2331032_-\|50S-ribosomal-protein-L10	unknown	unknown	gnl\|CDD\|234632
NZ_CP014529.1\|WP_002294577.1\|2337953_2338598_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341358
NZ_CP014529.1\|WP_002287787.1\|2324322_2325024_-\|glucosamine-6-phosphate-deaminase	unknown	unknown	gnl\|CDD\|238693
NZ_CP014529.1\|WP_002294579.1\|2337445_2337616_-\|preprotein-translocase-subunit-SecE	unknown	unknown	gnl\|CDD\|376355
NZ_CP014529.1\|WP_002294580.1\|2336799_2337345_-\|transcription-termination/antitermination-protein-NusG	unknown	unknown	gnl\|CDD\|180161
NZ_CP014529.1\|WP_002287792.1\|2320853_2321819_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|275027
NZ_CP014529.1\|WP_002287788.1\|2323355_2324069_-\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP014529.1\|WP_002294587.1\|2331441_2332131_-\|50S-ribosomal-protein-L1	unknown	unknown	gnl\|CDD\|180071
NZ_CP014529.1\|WP_002290558.1\|2325257_2326790_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP014529.1\|WP_002296327.1\|2329312_2330002_-\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
NZ_CP014529.1\|WP_002287793.1\|2318644_2320804_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	unknown	unknown	gnl\|CDD\|180921
NZ_CP014529.1\|WP_002291638.1\|2332234_2332657_-\|50S-ribosomal-protein-L11	unknown	unknown	gnl\|CDD\|234661
NZ_CP014529.1\|WP_002294588.1\|2330107_2330476_-\|50S-ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|234671
NZ_CP014529.1\|WP_002295743.1\|2327179_2328088_-\|IS982-like-element-ISEfm1-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP014529.1\|WP_002294585.1\|2332999_2333668_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	unknown	unknown	gnl\|CDD\|224674
NZ_CP014529.1\|WP_002294584.1\|2333680_2334553_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801
NZ_CP014529.1\|WP_002287791.1\|2321907_2323047_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP014529.1\|WP_002294583.1\|2334643_2335663_-\|L-lactate-oxidase	unknown	unknown	gnl\|CDD\|240088

Protein	Function_ID	Function_description	E-value
NZ_CP014529.1\|WP_002294578.1\|2337639_2337792_-\|50S-ribosomal-protein-L33	gnl\|CDD\|234783	PRK00504, rpmG, 50S ribosomal protein L33; Validated.	3.12722e-17
NZ_CP014529.1\|WP_002294581.1\|2335835_2336723_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|283645	pfam06028, DUF915, Alpha/beta hydrolase of unknown function (DUF915). This family consists of several bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.	4.81944e-80
NZ_CP014529.1\|WP_002291634.1\|2330528_2331032_-\|50S-ribosomal-protein-L10	gnl\|CDD\|234632	PRK00099, rplJ, 50S ribosomal protein L10; Reviewed.	3.03735e-67
NZ_CP014529.1\|WP_002294577.1\|2337953_2338598_+\|CBS-domain-containing-protein	gnl\|CDD\|341358	cd02205, CBS_pair_SF, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains superfamily. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	5.69774e-14
NZ_CP014529.1\|WP_002287787.1\|2324322_2325024_-\|glucosamine-6-phosphate-deaminase	gnl\|CDD\|238693	cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.	8.8122e-119
NZ_CP014529.1\|WP_002294579.1\|2337445_2337616_-\|preprotein-translocase-subunit-SecE	gnl\|CDD\|376355	pfam00584, SecE, SecE/Sec61-gamma subunits of protein translocation complex. SecE is part of the SecYEG complex in bacteria which translocates proteins from the cytoplasm. In eukaryotes the complex, made from Sec61-gamma and Sec61-alpha translocates protein from the cytoplasm to the ER. Archaea have a similar complex.	1.48e-13
NZ_CP014529.1\|WP_002294580.1\|2336799_2337345_-\|transcription-termination/antitermination-protein-NusG	gnl\|CDD\|180161	PRK05609, nusG, transcription antitermination protein NusG; Validated.	1.97252e-86
NZ_CP014529.1\|WP_002287792.1\|2320853_2321819_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	gnl\|CDD\|275027	TIGR04171, ribonucleotide-diphosphate_reductase_subunit_beta, ribonucleoside-diphosphate reductase, class 1b, beta subunit. Members of this family are NrdF, the beta subunit of class 1b ribonucleotide reductase. This form uses a dimanganese moiety associated with a tyrosine radical to reduce the cellular requirement for iron. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
NZ_CP014529.1\|WP_002287788.1\|2323355_2324069_-\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	6.15701e-49
NZ_CP014529.1\|WP_002294587.1\|2331441_2332131_-\|50S-ribosomal-protein-L1	gnl\|CDD\|180071	PRK05424, rplA, 50S ribosomal protein L1; Validated.	1.66496e-146
NZ_CP014529.1\|WP_002290558.1\|2325257_2326790_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	5.56109e-170
NZ_CP014529.1\|WP_002296327.1\|2329312_2330002_-\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	2.9371e-19
NZ_CP014529.1\|WP_002287793.1\|2318644_2320804_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	gnl\|CDD\|180921	PRK07306, PRK07306, ribonucleotide-diphosphate reductase subunit alpha; Validated.	0
NZ_CP014529.1\|WP_002291638.1\|2332234_2332657_-\|50S-ribosomal-protein-L11	gnl\|CDD\|234661	PRK00140, rplK, 50S ribosomal protein L11; Validated.	9.059e-96
NZ_CP014529.1\|WP_002294588.1\|2330107_2330476_-\|50S-ribosomal-protein-L7/L12	gnl\|CDD\|234671	PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed.	5.30333e-45
NZ_CP014529.1\|WP_002295743.1\|2327179_2328088_-\|IS982-like-element-ISEfm1-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.39418e-18
NZ_CP014529.1\|WP_002294585.1\|2332999_2333668_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	gnl\|CDD\|224674	COG1760, SdaA, L-serine deaminase [Amino acid transport and metabolism].	1.41351e-73
NZ_CP014529.1\|WP_002294584.1\|2333680_2334553_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	2.63238e-103
NZ_CP014529.1\|WP_002287791.1\|2321907_2323047_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.06838e-61
NZ_CP014529.1\|WP_002294583.1\|2334643_2335663_-\|L-lactate-oxidase	gnl\|CDD\|240088	cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain. LOX is a member of the family of FMN-containing alpha-hydroxyacid oxidases and catalyzes the oxidation of l-lactate using molecular oxygen to generate pyruvate and H2O2. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).	0

>NZ_CP014529.1|WP_002291634.1|2330528_2331032_-|50S-ribosomal-protein-L10
MSEAIIAKKAAIVDEVSEKFTAAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAKKAGLEGMDEVFTGPTAVAFSNEDVVAPAKIMDEFAKEAKALEIKGGIIEGKVSSLEEITALAKLPNREGLLSMLLSVLQAPVRNVAYAVKAVADKEDGDAA
>NZ_CP014529.1|WP_002294588.1|2330107_2330476_-|50S-ribosomal-protein-L7/L12
MALNIENIVAELKEATILELNDLVKAIEEEFGVSAAAPVAVAAAGGAAAAEEQTEFTVELTAAGDQKVKVIKAVREATGLGLKEAKAVVDGAPAPVKEGVSKEEAEELKAKLEEVGASVTVK
>NZ_CP014529.1|WP_002296327.1|2329312_2330002_-|TVP38/TMEM64-family-protein
MKKKIIRLMLISLGIILILVVGYRLYLEYQTDIQLFLNPRASKAELLAHIRSHGTFASILLIVLTAVMCAVPGIPTSVVGVIAGLSFGPLTGAIINILGNALGNITAIFLMHRLKFLDKKTETNHWVQAIRQMKHPKIGVMLGYMIPVIPSSMVNFAADAMKLPLQQIILSIVIGVIPSSVLYACGGEALFHGYNKTAVTLVASVTVLVGLVVFIYKDRKKKQGKQKHK
>NZ_CP014529.1|WP_002295743.1|2327179_2328088_-|IS982-like-element-ISEfm1-family-transposase
MRSSKYTEHYTDTFITFKEIMRTVSNIYHNCVPDKIKNRRNTDQLKQRDTVIIACVIWGIINGYTSQRATYRAVCSVLFPNGDFPSRSRFTRLSSNLAYTIKIIRYFFIKKLTKGELVGIIDSFPSPLCKPVRNRQAKLLNQIAKVGYNSTKKSYFYGLKIHMIVTKTGFPITYSITNPGVHDVKVLETLSEEANLPNILGDKGYISHKIHEKLALKGITISVPPRKNMDKSEKLDHSLLGKQRKTVETVFSSLEKLGCQNFNSRSVKGLESRFESILLAYSVLLSRAQRRFEGTLRYSLGY
>NZ_CP014529.1|WP_002290558.1|2325257_2326790_+|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MSILTLNNITQQFGDKILYEGVDLQLNAGEHLGLIGQNGAGKSTLIKIITGEILPDDGQIHWQKNIHKGYLDQYVEVDETLTIEEFLKTAYAKEYEKEEKIAFLYQTYSETFDDSLLEKAGKLQTELDQGVFYQIDTLVAEMSSGLGIDVLGLDSLLKNLSGGQRSKVILAKLLLENPDVLILDEPTNHLDDQHIQWLTQFLQDFDGAYIVISHDQEFLDQITTHIADIEFGKITKYTGHLKQALKQKEQNRESYLRQYHAQQKQIEKTEAYIRKYKAGSRSTMAKSRQKQLDKIERLTPPASASKAVFDFPFSPIVTTLAVETTDLVIGYDRPLLAPINLTIRFGENIAIRGFNGIGKSTLLKTLIGEIEKISGDFHFPDNTKINYFSQDLYWENPLETPLQYLSSQFPKATIKELRRQLAKAGLVNQLASEPLTTLSGGEQTKVKLAQLTMNQGNLLILDEPTNHIDQETKESLQDGIQKFPGTVIIVSHEQEFYQDLVQRVIEIEPK
>NZ_CP014529.1|WP_002287787.1|2324322_2325024_-|glucosamine-6-phosphate-deaminase
MEIIRVKNAEEGGKKAFEIIKEGMNKGAKVLGLATGSTPVTLYKEMTSSDLDFSEMTSVNLDEYVGLGGSDEQSYRHFMDVQLFDKKPFKETFVPDGKAEDLEAACKKYDQIIDAHPIDIQILGIGQNGHIGFNEPGASFDGTTSVVDLTESTINANKRFFDKAEDVPTKAVSMGIGSIMKSKEIVLMAFGESKADAIKGMIEGPVTNHLPASVLQNHDNVVVIIDEEAASKL
>NZ_CP014529.1|WP_002287788.1|2323355_2324069_-|MgtC/SapB-family-protein
MNDMVLTIPEIILRLGIAMLFGGAIGFERQYKNRPAGMRTHILVCMGACIIALIQVEIASGALRDALEYPQLAGTIRSDEARLIAQVVSGVGFLGAGTIIVTKQSVTGLTTAASLWAIAGLGIAIGMGYYSIAIISFIGIAIALTVVKRVIHVPTTKKLEIQFIHRKETKDFLTDYFEEKNIVIEDVNFDVKFVDDYRVYKNIYTIDLPKGLTYADVIEELSVHKNITKLHLVSIAQ
>NZ_CP014529.1|WP_002287791.1|2321907_2323047_-|AI-2E-family-transporter
MQSRFKQSKLFFWTVELVLTIIGVYFILQMPNIFSPILKMLSAIFLPLLVAGFIYYMFDPIVVFLEKHRIPRVFGFLLTFLVVIILVVLTVMNVVPQLMEQTIQLTQSLPMYADETSKWLNELAQREEFKNFNLEEQLASANLSLSNLFNIILVSLSASVSKIISFMMQFFILLFTVPFILLFMFKDGHKFIDALSHFFPKAIRKELRQTVKELNETLSAYISSTILDALIIGVMSFLAMRIFDQPYSLLLAVICGITNIIPYVGPFIGAVPAIIVGLFISPFQALYMALSILVIQQLDGNLIKPLLFGKSMNIHPLTIILVLIGAGSVAGILGMLICIPVYAVIKTIILNIRKIYLLRRMEHVSEKLDSPKVLEETSE
>NZ_CP014529.1|WP_002287792.1|2320853_2321819_+|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta
MSETYYEAINWNEIEDIIDKSTWEKLTEQFWLDTRIPLSNDLDDWRTLSQLEKDTVGHVFGGLTLLDTVQSESGMDQLRKDVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFDWTNTNPYLQKKAERINEIYKHGTPLEKKIASVFLETFLFYSGFYTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEAEQETLKDWMYNLLYELYENEERYTEELYDPIGWTEEVKTFLRYNANKALMNLGMDPLFPDTANDVNPIVMNGISTGTSNHDFFSQVGNGYLLGHVEAMKDDDYLIGLE
>NZ_CP014529.1|WP_002287793.1|2318644_2320804_+|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha
MSLKNLQDVSYFKLNNEINRPVNGQIPLNKDKEALVAFFEENVKPNTMTFPSIMEKINYLIDQEYIEAEFIQLYSPSFIEKLYQFLDEQHFSFKSFMAAYKFYSQYALKTNDGSAYLETYEDRVAFNALYFANGDEELALALADEMIHQRYQPATPSFLNAGRKRRGELVSCFLTQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSAKKENADEKIRVKTLSLGVIVPDKFYELTRKNEDMYLFSPYSVEKEYGVPFSYVNITAEYDHLVANPNIRKQKIKARDLENEISKLQQESGYPYVINIDTANRENPIDGKIIMSNLCSEILQVQTPSVINGKQEYEVLGTDISCNLGSTNIVNLMQSPNFGQSVRTMTRALTFITDASDIDVVPPIQNGNKLNHTIGLGAMGLHTYLAKEQMEYGSEDSLDFTNIYFMLLNYWTLVESNNIARERKQVFHNFEKSAYADGTYFEKYVTGEFQPKSEKVKALFEGIFIPTAEDWNALKQAVMKDGLYHQNRLAVAPNGSISYINDTSASIHPITRMIEERQEKKIGKIYYPAPYLSNETIPYYTSAYDMDMRKVIDVYATAQQHVDQGMSLTLFMRSEIPEGIYEWKTTTKQTTRDLNILRHYAFHKGIKSIYYVRTFTDDAEEIGSNQCESCVI
>NZ_CP014529.1|WP_002294587.1|2331441_2332131_-|50S-ribosomal-protein-L1
MAKKSKKMQDALKKVDSSKVYPVAEAVALAKETNIAKFDATVEVAYRLNVDPKKADQQIRGAVVLPNGTGKTQTVLVFAKGDKAKEAEAAGADFVGDDDMVQKIQNGWFDFDVVVATPDMMATVGRLGRVLGPKGLMPNPKTGTVTMDVTKAVNEVKAGKVTYRVDKAGNIHVPIGKVSFDDEKLVENFAAIHDVLLKAKPSAAKGQYMKNVTITTTFGPGIHVDQASF
>NZ_CP014529.1|WP_002291638.1|2332234_2332657_-|50S-ribosomal-protein-L11
MAKKVEKIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGLIIPVVISVYEDRSFTFVTKTPPAAVLLKKAAKIEKGSGEPNKNKVAKVSSDQVREIAELKMEDLNAANVEAAMRMVEGTARSMGITVE
>NZ_CP014529.1|WP_002294585.1|2332999_2333668_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta
MKDLRYRSVFDIIGPVMIGPSSSHTAGAARIGKIIRSIFGEQPDSVDIYLYESFAKTYRGHGTDIALVGGLLGMEPDDERLADSLKLAYEAGMEVLFVPKSEKAEHPNSVKMLLKKGTRKLSVTGISIGGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTSILSETNTNIGTMTVTRESKGENAIMIIEVDDPQVEETVKRLKQLPNIDSVNYFD
>NZ_CP014529.1|WP_002294584.1|2333680_2334553_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MFLSIEELVDQAKAYPSVAELMIAVEMEMSGRSRSHIIEIMEKNLSVMEQSINEGKEGVTSVTGITGGDAKKLDDYLNEADFLSGETILKAVRNAVAVNEVNAKMGLICATPTAGSAGVVPGVLMAVRDRLDLTHEQQLEFLFTAGAFGLVIANNASISGAEGGCQAEVGSASAMAAAALVCAKNGTPHQAAQAVAITLKNMMGLICDPVAGLVEVPCVKRNALGSSQAFISADMALAGIESVIPPDEVVAAMYQVGRQMPSIFKETAEGGLAVTPTAKRLAEEILNKRA
>NZ_CP014529.1|WP_002294583.1|2334643_2335663_-|L-lactate-oxidase
MEAGAFGYIRGGSEDEWTMKENTTSFNTKKIMPRILRGIDSADLHTSVFGIELDTPIIQAPSAAQGLAHEKGEADTAKGVAAAGSIFSISTYANTTIKDAADAAPGAPQFFQLYMSKDDRFNEFILNKAVEAGAKAIILTADSTLGGYREEDVINQFQFPLPMPNLAAYSEQSASGNGEGKGIAEIYAAAKQGLTPDDIKTIKEITHLPVIVKGIQSPEDAVIAISAGADGIWVSNHGGRQLDGGPASFEVLPKIAEVVNKRVPVIFDSGVRRGEHVFKALASGADLVAIGRPVIYGLNLGGAEGVTSVFEHLNKELSITMQLAGTKTIDEVKNTKLMD
>NZ_CP014529.1|WP_002294581.1|2335835_2336723_-|alpha/beta-fold-hydrolase
MTEPIKNLCKRATAAALVLISLFALSGCQTTKINTTEVSDKEKTAESSKVIEKTTIPTLFFHGYSGTENSFKGMLRRLEKNQQAVKELVLTVGTDGQIQATGDLSGKADNPMVQVLFEDNKNNEWNQAEWIKTCLLYLKENYGIDKVNIVGHSMGGVSALRYLGTYGQDTSLPQVQTLTAIGAPFNDFVDDSAQSLTDELAKGPAVVSNRYQDYQQMIGNIPITTRFFLIAGQLDETDLSDGTVPLNSALAVYALLKQRGNEIEEKVVTGENASHSMLHENQEVDQLVSRFIWKE
>NZ_CP014529.1|WP_002294580.1|2336799_2337345_-|transcription-termination/antitermination-protein-NusG
MESFEKNWYVLHTYSGYENKVKANIESRAQSMKMADFIFRVVVPEEKETEVKNGKEKEIVHKTFPGYVLVEMIMTDASWYVVRNTPGVTGFVGSHGAGSKPAPLLPEEVNHILRSIGMSLRQNDLEVEVGEVVKIIEGAFAGLEGQVTEVDGEKEKLKVNIDMFGRETSTELDFDQVDKID
>NZ_CP014529.1|WP_002294579.1|2337445_2337616_-|preprotein-translocase-subunit-SecE
MKFLKSVKDEIKQVTWPSRKQLRKDTLVVIETSIIFGLMFYVMDTAIQSLFGWILK
>NZ_CP014529.1|WP_002294578.1|2337639_2337792_-|50S-ribosomal-protein-L33
MAKKKAALACSVCGSRNYTKSVSEGKSGERLEINKFCKYCNQYTLHKETK
>NZ_CP014529.1|WP_002294577.1|2337953_2338598_+|CBS-domain-containing-protein
MLLKTLVYKKKDLTTVTETSTLEEALKILETSGYRCVPILDSSGNIFRGNIYKMHIYRHKANGGDMTLPVTHLLKNATKFIYLDTSFFKVFFTIKELPYIAVLDSENHFYGILTHSTLLNMLSQSWSVEQGSYVLTIASTGKQGDLAAIAKIISKHSSIASCITLDIEKDEYIRRTLITLPANTEAKVCETIVNHLEKKNYKVVEIENLQNQEA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

78985 : 120902

Staphylococcus_phage(22.22%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002298563.1\|78985_79732_+\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_002298562.1\|80690_81497_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_002324277.1\|81619_81988_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_010730439.1\|82084_83257_+\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	5.0e-134	99.6
WP_000997695.1\|83675_84854_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002317041.1\|85085_85424_-	arsenic metallochaperone ArsD family protein	NA	NA	NA	NA
WP_002301170.1\|85420_85960_-	hypothetical protein	NA	NA	NA	NA
WP_010730438.1\|86071_86731_+	AAA family ATPase	NA	NA	NA	NA
WP_002324522.1\|86799_87708_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002298555.1\|87830_90500_-	YfhO family protein	NA	NA	NA	NA
WP_002290463.1\|90737_90926_-	50S ribosomal protein L28	NA	NA	NA	NA
WP_002294298.1\|91195_91558_+	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_002298554.1\|91609_93292_+	DAK2 domain-containing protein	NA	NA	NA	NA
WP_002294296.1\|93408_95445_+	ATP-dependent DNA helicase RecG	A0A2H4JBQ0	uncultured_Caudovirales_phage	3.1e-06	23.1
WP_002289721.1\|95493_96495_+	phosphate acyltransferase PlsX	NA	NA	NA	NA
WP_002294295.1\|96616_96859_+	acyl carrier protein	NA	NA	NA	NA
WP_002297293.1\|97237_98425_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	4.6e-26	28.7
WP_002287889.1\|98746_99751_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.1e-18	32.2
WP_002297777.1\|99751_100696_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.9e-20	35.1
WP_002287892.1\|100695_101658_+	ABC transporter permease	NA	NA	NA	NA
WP_002287893.1\|101684_102599_+	ABC transporter permease	NA	NA	NA	NA
WP_002297779.1\|102624_104406_+	oligopeptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002287896.1\|104753_105440_+	ribonuclease III	K7YH73	Megavirus	9.1e-27	32.3
WP_002317044.1\|105459_109041_+	chromosome segregation protein SMC	NA	NA	NA	NA
WP_002317045.1\|109049_109859_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002317046.1\|109870_110869_+	signal recognition particle-docking protein FtsY	NA	NA	NA	NA
WP_002307330.1\|111054_113322_+	bifunctional glutamate--cysteine ligase GshA/glutathione synthetase GshB	NA	NA	NA	NA
WP_002287902.1\|113409_113862_-	YueI family protein	NA	NA	NA	NA
WP_002297787.1\|114011_114962_+	iron chelate uptake ABC transporter family permease subunit	A0A2H4IY97	uncultured_Caudovirales_phage	5.6e-67	40.5
WP_002317047.1\|114954_115914_+	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_002297790.1\|115910_116666_+	ATP-binding cassette domain-containing protein	A0A2R8FG22	Brazilian_cedratvirus	2.2e-13	28.1
WP_002317048.1\|116688_117642_+	siderophore ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002333851.1\|118307_119261_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002325943.1\|119339_119528_-	hypothetical protein	NA	NA	NA	NA
WP_002317769.1\|119729_120902_+\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0

DBSCAN-SWA_2

201221 : 260126

uncultured_Mediterranean_phage(25.0%)

tRNA,transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002317082.1\|201221_202397_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	1.3e-17	32.9
WP_002296565.1\|202589_203621_+\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_002294185.1\|207046_207745_-	DUF975 family protein	NA	NA	NA	NA
WP_002294183.1\|207961_209107_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	2.5e-82	40.9
WP_002300794.1\|209203_209584_+	preprotein translocase subunit YajC	NA	NA	NA	NA
WP_000202380.1\|209923_211243_-\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	4.8e-210	82.7
WP_002294180.1\|211571_214169_+	bifunctional acetaldehyde-CoA/alcohol dehydrogenase	NA	NA	NA	NA
WP_002325869.1\|214522_215476_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002333852.1\|215399_215588_-	hypothetical protein	NA	NA	NA	NA
WP_002317085.1\|215740_217201_+	rhamnulokinase	NA	NA	NA	NA
WP_002317086.1\|217197_218454_+	L-rhamnose isomerase	NA	NA	NA	NA
WP_002288248.1\|218467_219313_+	rhamnulose-1-phosphate aldolase	NA	NA	NA	NA
WP_002317087.1\|219314_219626_+	L-rhamnose mutarotase	NA	NA	NA	NA
WP_002317088.1\|219707_220859_+	lactaldehyde reductase	NA	NA	NA	NA
WP_002294170.1\|220985_221744_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_002288242.1\|221843_222488_+	bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_002298306.1\|222494_223502_+	sugar kinase	NA	NA	NA	NA
WP_002298305.1\|223517_224360_+	5-dehydro-4-deoxy-D-glucuronate isomerase	NA	NA	NA	NA
WP_002317093.1\|225430_226495_-	type 2 isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
WP_002288233.1\|226491_227577_-	phosphomevalonate kinase	NA	NA	NA	NA
WP_002317094.1\|227589_228567_-	diphosphomevalonate decarboxylase	NA	NA	NA	NA
WP_002288231.1\|228559_229504_-	mevalonate kinase	NA	NA	NA	NA
WP_002317095.1\|229825_230479_+	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	5.0e-59	52.3
WP_002294163.1\|230563_231469_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_002294161.1\|231470_232103_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_002293357.1\|232422_232947_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	1.4e-14	33.3
WP_002289309.1\|233018_233219_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_002289310.1\|233271_233631_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_002317096.1\|233882_235220_+	hypothetical protein	NA	NA	NA	NA
WP_002324306.1\|235267_237397_+	hydantoinase/oxoprolinase	NA	NA	NA	NA
WP_002317098.1\|237371_238061_+	hypothetical protein	NA	NA	NA	NA
WP_002289316.1\|238371_239058_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002377012.1\|239193_239388_-	hypothetical protein	NA	NA	NA	NA
WP_002289317.1\|239437_239878_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_002317100.1\|239881_240727_-	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
WP_002294157.1\|240875_242294_+	dipeptidase PepV	NA	NA	NA	NA
WP_002324311.1\|242350_242641_-	hypothetical protein	NA	NA	NA	NA
WP_002317103.1\|243156_244113_-	glycosyltransferase	NA	NA	NA	NA
WP_002317104.1\|244284_244638_-	peptidase	NA	NA	NA	NA
WP_002317105.1\|244836_245916_+	glutamyl aminopeptidase	NA	NA	NA	NA
WP_002317106.1\|246207_246528_+	thioredoxin family protein	NA	NA	NA	NA
WP_002317107.1\|246557_247025_+	universal stress protein	NA	NA	NA	NA
WP_002317108.1\|247334_247940_+	DUF4479 domain-containing protein	NA	NA	NA	NA
WP_002324312.1\|247997_249281_-	PDZ domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	6.7e-23	29.3
WP_002317110.1\|249733_250213_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_113787899.1\|250587_251750_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.6e-79	50.9
WP_002317111.1\|251960_253091_+	hypothetical protein	NA	NA	NA	NA
WP_010778368.1\|253258_254167_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002317112.1\|254253_255108_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_002317113.1\|255204_257454_+	alpha-galactosidase	NA	NA	NA	NA
WP_002317114.1\|257456_258629_+	MFS transporter	NA	NA	NA	NA
WP_002317441.1\|258806_260126_+\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	6.9e-209	82.5

DBSCAN-SWA_3

669345 : 677817

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002294039.1\|669345_669990_+	dTMP kinase	M1PSC7	Streptococcus_phage	4.2e-58	52.6
WP_002292340.1\|670004_670334_+	hypothetical protein	NA	NA	NA	NA
WP_002288071.1\|670347_671286_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.3e-35	34.4
WP_002288073.1\|671321_672146_+	stage 0 sporulation family protein	NA	NA	NA	NA
WP_002288076.1\|672138_672486_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	5.1e-18	41.1
WP_002288078.1\|672554_673427_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.1e-88	60.4
WP_002294035.1\|673535_674657_+	DNA polymerase IV	NA	NA	NA	NA
WP_002288081.1\|674710_675313_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	1.7e-53	58.6
WP_002288083.1\|675627_677817_-	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.8e-286	66.6

DBSCAN-SWA_4

730827 : 791109

Enterococcus_phage(29.41%)

tRNA,protease,capsid,integrase,holin,tail,portal,terminase,head,transposase

attL 746251:746267|attR 796534:796550

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286621.1\|730827_733626_+\|tRNA	isoleucine--tRNA ligase	A0A2H4UVG0	Bodo_saltans_virus	1.6e-74	26.4
WP_002286618.1\|733674_735201_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	8.9e-75	35.3
WP_002286616.1\|735215_735863_-	metal-dependent transcriptional regulator	NA	NA	NA	NA
WP_002286678.1\|736046_736376_-	DUF4828 domain-containing protein	NA	NA	NA	NA
WP_002286614.1\|736552_737281_+	DNA/RNA nuclease SfsA	NA	NA	NA	NA
WP_002317177.1\|737296_738310_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_002286608.1\|738309_739587_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.8e-35	28.8
WP_002286607.1\|739649_742352_+	sigma-54-dependent transcriptional regulator	NA	NA	NA	NA
WP_002286606.1\|742503_742821_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002286604.1\|742850_743171_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_002286601.1\|743278_744739_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002286598.1\|744806_745028_+	hypothetical protein	NA	NA	NA	NA
WP_002286596.1\|745058_745241_+	DUF3188 domain-containing protein	NA	NA	NA	NA
WP_002286592.1\|745240_745654_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_002286589.1\|745776_746958_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
746251:746267	attL	NA	NA	NA	NA
WP_002286587.1\|747488_748628_-\|integrase	site-specific integrase	Q9AZR0	Lactococcus_phage	2.6e-95	47.1
WP_002296617.1\|748926_749562_-	hypothetical protein	NA	NA	NA	NA
WP_002296616.1\|749674_750310_-	hypothetical protein	NA	NA	NA	NA
WP_002303013.1\|750343_750805_-	DUF4429 domain-containing protein	A0A0F6N4L7	Staphylococcus_phage	4.5e-06	34.8
WP_002296613.1\|750934_751366_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_002296612.1\|751383_751704_-	helix-turn-helix transcriptional regulator	A0A1S5SDR1	Streptococcus_phage	2.0e-13	40.2
WP_002290310.1\|752002_752779_+	phage antirepressor protein	A0A1Q1PVU2	Staphylococcus_phage	1.1e-73	53.8
WP_002296611.1\|752793_752997_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002286573.1\|753012_753351_+	DUF771 domain-containing protein	NA	NA	NA	NA
WP_002296610.1\|753337_753517_+	hypothetical protein	NA	NA	NA	NA
WP_002286568.1\|753559_754030_-	hypothetical protein	NA	NA	NA	NA
WP_002286562.1\|754116_754815_+	phage regulatory protein	D2IYT0	Enterococcus_phage	1.7e-25	34.6
WP_002286559.1\|754992_755334_+	hypothetical protein	NA	NA	NA	NA
WP_002286557.1\|755326_755998_+	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	4.2e-29	47.4
WP_069972674.1\|756003_756690_+	hypothetical protein	C9E2N1	Enterococcus_phage	2.0e-87	68.6
WP_002286552.1\|756692_757442_+	helix-turn-helix domain-containing protein	A0A1L2BY83	Clostridium_phage	1.7e-31	54.0
WP_002286696.1\|757453_757723_+	hypothetical protein	NA	NA	NA	NA
WP_002286695.1\|757884_758187_+	hypothetical protein	NA	NA	NA	NA
WP_002296606.1\|758183_758345_+	antitoxin	NA	NA	NA	NA
WP_002286694.1\|758341_758647_+	hypothetical protein	NA	NA	NA	NA
WP_002286550.1\|758646_759003_+	DUF1140 family protein	A0A2H4JAZ4	uncultured_Caudovirales_phage	3.1e-10	37.4
WP_002296604.1\|758962_759208_+	hypothetical protein	NA	NA	NA	NA
WP_002286547.1\|759204_759624_+	hypothetical protein	D2IZL0	Enterococcus_phage	4.1e-30	54.3
WP_002286545.1\|759620_760178_+	DUF1642 domain-containing protein	A0A0C5KKV2	Enterococcus_phage	2.8e-10	36.2
WP_002286693.1\|760174_760471_+	hypothetical protein	NA	NA	NA	NA
WP_002286542.1\|760547_760961_+	autolysin	C9E2P5	Enterococcus_phage	1.5e-56	81.0
WP_002300143.1\|761418_761694_-	hypothetical protein	A0A2H4JEH2	uncultured_Caudovirales_phage	9.9e-17	45.7
WP_002311723.1\|762147_762354_+	hypothetical protein	NA	NA	NA	NA
WP_002296600.1\|762549_762717_+	thymidylate synthase	NA	NA	NA	NA
WP_002286540.1\|762742_763087_+	HNH endonuclease	A0A1B1P757	Bacillus_phage	3.8e-26	57.1
WP_002296599.1\|763091_763373_+	hypothetical protein	NA	NA	NA	NA
WP_002286538.1\|763475_763790_+\|terminase	terminase	A0A1S7FYW6	Listeria_phage	3.3e-08	37.9
WP_002286533.1\|763767_765462_+\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	3.0e-148	49.6
WP_002286530.1\|765481_766660_+\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	5.4e-80	40.4
WP_002286527.1\|766622_767309_+\|protease	Clp protease ClpP	A0A2I6PDD0	Staphylococcus_phage	1.0e-30	39.7
WP_002286525.1\|767308_768469_+\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	1.8e-99	50.1
WP_002286524.1\|768478_769354_+	hypothetical protein	D2IYX3	Enterococcus_phage	5.6e-130	74.2
WP_002286523.1\|769350_769662_+	hypothetical protein	A0A1B1P751	Bacillus_phage	6.3e-12	42.1
WP_002286522.1\|769651_770005_+\|head	phage head closure protein	NA	NA	NA	NA
WP_069972675.1\|769994_770396_+	hypothetical protein	A0A1B1P759	Bacillus_phage	1.1e-13	33.3
WP_050444277.1\|770445_770793_+	hypothetical protein	R4IBU7	Listeria_phage	1.3e-05	30.6
WP_002286512.1\|770804_771413_+	hypothetical protein	Q8W5Z9	Listeria_phage	3.0e-34	41.1
WP_002286510.1\|771432_771795_+	hypothetical protein	NA	NA	NA	NA
WP_002305377.1\|771797_771980_+	hypothetical protein	NA	NA	NA	NA
WP_002286502.1\|771996_775428_+\|tail	phage tail tape measure protein	A0A1D3SNL5	Enterococcus_phage	3.1e-67	44.4
WP_002297218.1\|775513_776809_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_069972676.1\|777000_777738_+\|tail	phage tail protein	NA	NA	NA	NA
WP_002296595.1\|777747_780039_+	hypothetical protein	A0A1D3SNL1	Enterococcus_phage	1.6e-88	30.0
WP_002286495.1\|780062_782189_+	hypothetical protein	A0A060AI60	Enterococcus_phage	1.4e-62	40.1
WP_002286491.1\|782351_782798_+	hypothetical protein	NA	NA	NA	NA
WP_002290625.1\|782799_782937_+	XkdX family protein	NA	NA	NA	NA
WP_002349644.1\|782974_783268_+	hypothetical protein	NA	NA	NA	NA
WP_002286683.1\|783264_783489_+\|holin	holin	NA	NA	NA	NA
WP_002286484.1\|783485_784511_+	N-acetylmuramoyl-L-alanine amidase	A0A139ZVY1	Enterococcus_phage	2.1e-64	61.3
WP_087046766.1\|785450_786612_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
WP_002286474.1\|787535_787943_+	hypothetical protein	NA	NA	NA	NA
WP_002296902.1\|787956_788358_+	hypothetical protein	NA	NA	NA	NA
WP_002286473.1\|788359_788731_+	hypothetical protein	NA	NA	NA	NA
WP_002330703.1\|788766_789066_-	hypothetical protein	NA	NA	NA	NA
WP_002293622.1\|789080_789302_-	hypothetical protein	NA	NA	NA	NA
WP_002296840.1\|789921_791109_+\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
796534:796550	attR	NA	NA	NA	NA

DBSCAN-SWA_5

957787 : 1015763

Staphylococcus_phage(20.0%)

tRNA,capsid,integrase,portal,terminase,transposase

attL 1002686:1002712|attR 1017494:1017520

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287955.1\|957787_958999_+\|tRNA	tRNA 4-thiouridine(8) synthase ThiI	NA	NA	NA	NA
WP_002287954.1\|959571_960219_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_002287953.1\|960611_963257_+\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	4.0e-163	42.9
WP_002294071.1\|963566_964880_+	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_002287951.1\|964869_965523_+	HAD family phosphatase	NA	NA	NA	NA
WP_002294069.1\|965577_966270_+	JAB domain-containing protein	NA	NA	NA	NA
WP_002294067.1\|966419_966620_+	cold-shock protein	Q9AZD3	Lactococcus_phage	3.7e-21	71.2
WP_002287948.1\|966873_968553_-	ribonuclease J	NA	NA	NA	NA
WP_002287947.1\|968554_968767_-	DNA-dependent RNA polymerase auxiliary subunit epsilon family protein	NA	NA	NA	NA
WP_002296290.1\|969159_970890_+	multidrug efflux ABC transporter subunit EfrA	W8CYL7	Bacillus_phage	2.1e-43	27.6
WP_002289400.1\|970886_972647_+	multidrug efflux ABC transporter subunit EfrB	W8CYL7	Bacillus_phage	2.5e-52	28.6
WP_002296291.1\|972741_972939_+	hypothetical protein	NA	NA	NA	NA
WP_002289401.1\|973091_973577_+	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_002289402.1\|973680_974274_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	8.9e-55	55.6
WP_002289403.1\|974453_974981_+	hypothetical protein	NA	NA	NA	NA
WP_002289404.1\|975071_975809_+	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	2.3e-12	40.0
WP_002289405.1\|975812_976730_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_002289406.1\|976731_977961_+	GTPase HflX	NA	NA	NA	NA
WP_000222572.1\|977994_978948_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002287759.1\|979598_981212_-	CoA-disulfide reductase	NA	NA	NA	NA
WP_002296511.1\|981352_982261_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002287757.1\|982443_983568_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_002287755.1\|983794_984712_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_002287754.1\|984704_985538_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002287753.1\|985620_986739_+	glycosyl hydrolase family 88	NA	NA	NA	NA
WP_002321415.1\|986732_988631_+	DUF2264 domain-containing protein	NA	NA	NA	NA
WP_002321414.1\|988624_989848_+	glucuronyl hydrolase	NA	NA	NA	NA
WP_002311250.1\|989933_991868_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	1.1e-58	31.9
WP_002287746.1\|992093_992750_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_002287745.1\|992823_993177_-	thioredoxin family protein	NA	NA	NA	NA
WP_002287744.1\|993368_994298_+	permease	NA	NA	NA	NA
WP_002287743.1\|994308_995145_+	TIGR03943 family protein	NA	NA	NA	NA
WP_002287742.1\|995392_996169_+	response regulator transcription factor	NA	NA	NA	NA
WP_002287741.1\|996344_997088_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.6e-29	30.9
WP_002296509.1\|997080_998661_+	ABC transporter	NA	NA	NA	NA
WP_002289868.1\|998911_999391_-	threonine/serine exporter	NA	NA	NA	NA
WP_002289867.1\|999406_1000159_-	threonine/serine exporter family protein	NA	NA	NA	NA
WP_002296505.1\|1000706_1001432_+	DNA/RNA non-specific endonuclease	NA	NA	NA	NA
WP_002290885.1\|1001686_1001953_+	IreB family regulatory phosphoprotein	NA	NA	NA	NA
WP_002296503.1\|1001949_1002381_+	Holliday junction resolvase RuvX	NA	NA	NA	NA
WP_002290887.1\|1002405_1002711_+	DUF1292 domain-containing protein	NA	NA	NA	NA
1002686:1002712	attL	NA	NA	NA	NA
WP_002296502.1\|1002791_1003937_-\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	2.0e-50	33.3
WP_002296501.1\|1003997_1004645_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002296500.1\|1004838_1005132_+	hypothetical protein	NA	NA	NA	NA
WP_002296499.1\|1005175_1005487_+	hypothetical protein	NA	NA	NA	NA
WP_002296495.1\|1006407_1006770_+	hypothetical protein	NA	NA	NA	NA
WP_002296494.1\|1006806_1007655_+	DNA replication protein	A0A222ZGI2	Arthrobacter_phage	5.2e-08	28.3
WP_002296493.1\|1007644_1009120_+	helicase	Q4ZD27	Staphylococcus_phage	7.3e-66	34.9
WP_002296492.1\|1009385_1009793_+	DUF3206 domain-containing protein	NA	NA	NA	NA
WP_002296491.1\|1009795_1010011_+	hypothetical protein	NA	NA	NA	NA
WP_002304527.1\|1010014_1010395_+	endonuclease	A0A2I7S865	Vibrio_phage	1.7e-11	47.9
WP_002296489.1\|1010528_1010684_+	DUF2292 domain-containing protein	NA	NA	NA	NA
WP_002296488.1\|1010752_1011226_+\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_002296487.1\|1011222_1012917_+\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	9.1e-129	43.8
WP_002317249.1\|1012882_1013068_+	hypothetical protein	NA	NA	NA	NA
WP_002296486.1\|1013071_1014247_+\|portal	phage portal protein	A0A2H4J5A4	uncultured_Caudovirales_phage	3.2e-64	35.6
WP_002296485.1\|1014239_1015763_+\|capsid	phage major capsid protein	A0A1W6JPR8	Staphylococcus_phage	1.4e-48	37.4
1017494:1017520	attR	NA	NA	NA	NA

DBSCAN-SWA_6

1189417 : 1304113

101

Streptococcus_phage(41.3%)

tRNA,integrase,transposase

attL 1189825:1189840|attR 1249835:1249850

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002317769.1\|1189417_1190590_-\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
1189825:1189840	attL	NA	NA	NA	NA
WP_002302184.1\|1190954_1192046_+	NAD-dependent epimerase/dehydratase family protein	E3T4Y8	Cafeteria_roenbergensis_virus	1.2e-28	29.3
WP_002302186.1\|1192113_1193592_-	nucleotide sugar dehydrogenase	M1IB49	Acanthocystis_turfacea_Chlorella_virus	3.4e-103	49.3
WP_002302187.1\|1193858_1194608_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002302188.1\|1194750_1195701_+	1-phosphofructokinase	NA	NA	NA	NA
WP_002302189.1\|1195682_1197146_+	PTS fructose transporter subunit IIC	NA	NA	NA	NA
WP_002302190.1\|1197142_1197601_+	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_002302191.1\|1197597_1198572_+	tagatose-bisphosphate aldolase	NA	NA	NA	NA
WP_002302193.1\|1198750_1199701_-	membrane protein insertase YidC	NA	NA	NA	NA
WP_002289551.1\|1200260_1200536_-	acylphosphatase	NA	NA	NA	NA
WP_002294889.1\|1200643_1201408_+	RNA methyltransferase	A0A2D1A6G0	Rhodococcus_phage	1.7e-05	26.1
WP_002296302.1\|1201530_1202034_+	HD domain-containing protein	NA	NA	NA	NA
WP_002296301.1\|1202442_1203084_+	elongation factor G-binding protein	NA	NA	NA	NA
WP_002296300.1\|1203253_1204522_+	voltage-gated chloride channel family protein	A0A1X9I5Z9	Streptococcus_phage	4.4e-43	32.3
WP_002296299.1\|1204548_1205748_-	YdcF family protein	NA	NA	NA	NA
WP_002296298.1\|1205868_1207176_-	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_002294874.1\|1207646_1208765_+	hypothetical protein	NA	NA	NA	NA
WP_002296295.1\|1209267_1209588_+	hypothetical protein	NA	NA	NA	NA
WP_002288762.1\|1210040_1210241_+	cold-shock protein	Q9AZD3	Lactococcus_phage	2.5e-22	74.2
WP_002288763.1\|1210387_1213177_+	DNA polymerase III subunit epsilon	A0A1X9I5C8	Streptococcus_phage	1.4e-89	30.9
WP_002321579.1\|1213223_1213751_+	peptidase	NA	NA	NA	NA
WP_002296294.1\|1213771_1214962_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_002288767.1\|1215001_1216300_+\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	1.2e-59	30.3
WP_002288769.1\|1217475_1218150_+	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_002319756.1\|1218146_1218488_+	hypothetical protein	NA	NA	NA	NA
WP_002288776.1\|1218517_1218877_+	YccF domain-containing protein	NA	NA	NA	NA
WP_002296577.1\|1219401_1221486_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	4.9e-116	35.7
WP_002288779.1\|1221776_1223243_+	amino acid permease	NA	NA	NA	NA
WP_002297185.1\|1223713_1225009_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002289037.1\|1225256_1225796_+	transcriptional regulator	A0A097BYE2	Leuconostoc_phage	3.8e-20	34.5
WP_002289038.1\|1225869_1226310_+	CopY/TcrY family copper transport repressor	NA	NA	NA	NA
WP_002289040.1\|1226322_1226532_+	copper chaperone CopZ	NA	NA	NA	NA
WP_002289041.1\|1226531_1228718_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.5e-120	38.6
WP_002296533.1\|1228737_1230909_+	copper/silver-translocating P-type ATPase CopB	A0A218MNH6	uncultured_virus	5.0e-71	32.3
WP_002289045.1\|1233181_1234123_-	DUF58 domain-containing protein	NA	NA	NA	NA
WP_002304700.1\|1234267_1235116_-	MoxR family ATPase	NA	NA	NA	NA
WP_002294839.1\|1235469_1236282_+	hypothetical protein	NA	NA	NA	NA
WP_002304701.1\|1236435_1236759_+	hypothetical protein	NA	NA	NA	NA
WP_002294835.1\|1236832_1237402_+	prevent-host-death protein	NA	NA	NA	NA
WP_002296536.1\|1237577_1237844_-\|integrase	tyrosine-type recombinase/integrase	A0A0P0I3D2	Lactobacillus_phage	1.4e-07	56.5
WP_002294831.1\|1237838_1238531_+	N-acetylmuramoyl-L-alanine amidase	Q9MCC6	Lactobacillus_phage	2.3e-30	43.4
WP_086953915.1\|1238570_1239910_-\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-78	52.7
WP_000997695.1\|1240019_1241198_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_086953915.1\|1241367_1242706_+\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-78	52.7
WP_008266934.1\|1242985_1243399_+	DUF4231 domain-containing protein	NA	NA	NA	NA
WP_002295273.1\|1243630_1243888_-	hypothetical protein	NA	NA	NA	NA
WP_002287107.1\|1244173_1245424_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002287105.1\|1245833_1246808_+	choloylglycine hydrolase family protein	M1HVK5	Paramecium_bursaria_Chlorella_virus	5.4e-25	31.8
WP_002347285.1\|1246963_1248259_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	5.0e-10	21.4
WP_074394542.1\|1248868_1249060_-	hypothetical protein	NA	NA	NA	NA
WP_002296840.1\|1249081_1250269_+\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
1249835:1249850	attR	NA	NA	NA	NA
WP_002326708.1\|1250529_1250847_+	SdpI family protein	NA	NA	NA	NA
WP_002289810.1\|1250937_1251303_-	hypothetical protein	NA	NA	NA	NA
WP_002289809.1\|1251510_1251993_+	hypothetical protein	NA	NA	NA	NA
WP_002289807.1\|1252189_1253080_+	phosphate ABC transporter substrate-binding protein PstS family protein	NA	NA	NA	NA
WP_002296623.1\|1253482_1254778_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_002320964.1\|1254883_1256152_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.9e-54	36.1
WP_002297196.1\|1256423_1258895_+	cation-translocating P-type ATPase	M1HBF8	Paramecium_bursaria_Chlorella_virus	7.0e-45	28.8
WP_002297195.1\|1258997_1260734_-	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	1.2e-27	34.1
WP_002293705.1\|1260730_1261435_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.4e-38	36.2
WP_002293708.1\|1262027_1262366_+	putative DNA-binding protein	NA	NA	NA	NA
WP_002293709.1\|1262386_1263805_+	signal recognition particle protein	NA	NA	NA	NA
WP_069972679.1\|1263916_1264495_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_002297192.1\|1264498_1265020_+	dihydrofolate reductase	NA	NA	NA	NA
WP_002293714.1\|1265098_1265653_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	2.3e-12	29.3
WP_002290274.1\|1265905_1266181_+	30S ribosomal protein S16	NA	NA	NA	NA
WP_002290277.1\|1266192_1266444_+	KH domain-containing protein	NA	NA	NA	NA
WP_002297190.1\|1266568_1267360_+	hypothetical protein	NA	NA	NA	NA
WP_002293716.1\|1267529_1268051_+	ribosome maturation factor RimM	NA	NA	NA	NA
WP_002293717.1\|1268040_1268802_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_002286913.1\|1268937_1269285_+	50S ribosomal protein L19	NA	NA	NA	NA
WP_002286921.1\|1269657_1270320_+	hypothetical protein	NA	NA	NA	NA
WP_002286924.1\|1270398_1273626_+	fibrinogen-binding MSCRAMM adhesin Fss3	NA	NA	NA	NA
WP_002286925.1\|1273739_1274054_+	YdcP family protein	A0A1S5SF38	Streptococcus_phage	1.7e-25	53.4
WP_002286926.1\|1274066_1274441_+	YdcP family protein	A0A1S5SF96	Streptococcus_phage	1.1e-34	62.9
WP_002305701.1\|1274441_1274795_+	DNA-damage-inducible protein J	NA	NA	NA	NA
WP_024265280.1\|1274865_1276011_+	DUF87 domain-containing protein	A0A1S5SFB5	Streptococcus_phage	4.3e-130	63.0
WP_002297361.1\|1276725_1278585_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.8e-30	26.0
WP_024265279.1\|1278678_1278930_+	hypothetical protein	A0A1S5SFB5	Streptococcus_phage	7.6e-24	73.0
WP_002286932.1\|1278989_1280132_+	DNA cytosine methyltransferase	A0A1S5SEK0	Streptococcus_phage	1.7e-126	62.1
WP_002286933.1\|1280156_1280411_+	hypothetical protein	NA	NA	NA	NA
WP_002286934.1\|1280666_1281851_+	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	1.9e-141	60.8
WP_002305703.1\|1281847_1281985_+	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_002286940.1\|1282730_1284641_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.1e-37	29.8
WP_033657400.1\|1284744_1284969_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	8.8e-24	83.8
WP_002288934.1\|1284981_1285482_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	7.0e-53	59.6
WP_002288935.1\|1285578_1287426_+	PHP domain-containing protein	NA	NA	NA	NA
WP_002297208.1\|1287428_1288325_+	AAA family ATPase	A0A1B1IUG5	uncultured_Mediterranean_phage	1.1e-16	29.7
WP_002288938.1\|1288374_1288764_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	1.4e-40	65.9
WP_002321772.1\|1288750_1291096_+	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	76.0
WP_002296840.1\|1291188_1292376_+\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002289059.1\|1292676_1294806_+	FUSC family protein	A0A1S5SF30	Streptococcus_phage	3.1e-182	60.3
WP_002289057.1\|1294802_1295810_+	lipoprotein	A0A1S5SEZ8	Streptococcus_phage	4.8e-117	63.9
WP_002289055.1\|1295826_1296738_+	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	1.1e-59	42.2
WP_002289053.1\|1296865_1297594_-	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	5.1e-36	37.1
WP_002321361.1\|1297590_1299000_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_002289051.1\|1299327_1300449_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_077828749.1\|1300868_1301105_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002343922.1\|1301057_1302011_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002305710.1\|1302349_1302859_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_087040414.1\|1302951_1304113_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	53.5

DBSCAN-SWA_7

1318024 : 1369541

Streptococcus_phage(36.36%)

tRNA,integrase,transposase

attL 1311636:1311651|attR 1326559:1326574

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1311636:1311651	attL	NA	NA	NA	NA
WP_002299190.1\|1318024_1319572_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_002311683.1\|1319723_1320152_+	hypothetical protein	NA	NA	NA	NA
WP_002288964.1\|1320138_1320381_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002288966.1\|1320680_1320896_-	hypothetical protein	NA	NA	NA	NA
WP_002300928.1\|1321002_1321317_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002288969.1\|1321420_1322599_+\|integrase	site-specific integrase	S6C485	Thermus_phage	1.4e-30	31.1
WP_002288970.1\|1323001_1323295_+	DUF2087 domain-containing protein	NA	NA	NA	NA
WP_002305732.1\|1324137_1326465_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_002288982.1\|1329577_1330750_+	class C sortase	NA	NA	NA	NA
1326559:1326574	attR	NA	NA	NA	NA
WP_002288983.1\|1330911_1331406_-	hypothetical protein	NA	NA	NA	NA
WP_002321037.1\|1331402_1331597_-	hypothetical protein	NA	NA	NA	NA
WP_002288984.1\|1331991_1332414_+	HTH domain-containing protein	NA	NA	NA	NA
WP_002288985.1\|1332579_1333773_-	MFS transporter	NA	NA	NA	NA
WP_002288986.1\|1333996_1334374_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_002321036.1\|1334361_1334700_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_002288989.1\|1334833_1335277_+	LysR family transcriptional regulator substrate-binding protein	NA	NA	NA	NA
WP_002297218.1\|1335384_1336680_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002303949.1\|1337060_1337876_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002321035.1\|1337885_1338101_+	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|1338184_1339363_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002289620.1\|1340098_1341763_+	acetolactate synthase AlsS	NA	NA	NA	NA
WP_002289619.1\|1341775_1342486_+	acetolactate decarboxylase	NA	NA	NA	NA
WP_002289618.1\|1342615_1343113_+	GAF domain-containing protein	NA	NA	NA	NA
WP_002289617.1\|1343297_1343558_+	hypothetical protein	NA	NA	NA	NA
WP_002321266.1\|1343919_1344159_-	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|1344495_1345674_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002323892.1\|1345790_1346105_+	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|1347212_1348391_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002302293.1\|1348594_1348897_-	hypothetical protein	NA	NA	NA	NA
WP_002288592.1\|1349653_1350427_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002288595.1\|1350570_1350921_+	SdpI family protein	NA	NA	NA	NA
WP_002288590.1\|1350901_1351618_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.0e-33	35.7
WP_002288588.1\|1351617_1353066_+	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	1.7e-19	29.3
WP_002288586.1\|1353136_1353646_-	hypothetical protein	NA	NA	NA	NA
WP_002296838.1\|1353635_1354361_-	hypothetical protein	NA	NA	NA	NA
WP_002288584.1\|1354583_1356704_-	LTA synthase family protein	W6LM83	Streptococcus_phage	2.8e-220	58.1
WP_002288581.1\|1356933_1358112_+	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	3.9e-102	48.9
WP_002288579.1\|1358127_1358886_+	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	1.9e-25	36.4
WP_002288577.1\|1358908_1359394_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_002288576.1\|1359464_1360718_-	NAD(P)/FAD-dependent oxidoreductase	A0A2H4PQX1	Staphylococcus_phage	7.7e-24	55.3
WP_002288575.1\|1360834_1362184_+	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_002288574.1\|1362295_1363642_+	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_002297218.1\|1363993_1365289_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002288573.1\|1365471_1365858_-	YxeA family protein	NA	NA	NA	NA
WP_002312603.1\|1366081_1367545_-\|transposase	IS1182-like element ISEfa7 family transposase	A0A1X9I5T2	Streptococcus_phage	5.3e-125	48.2
WP_002311774.1\|1368581_1369541_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	7.5e-11	27.2

DBSCAN-SWA_8

1373605 : 1419512

Enterococcus_phage(23.53%)

protease,capsid,integrase,holin,tail,portal,terminase,head,transposase

attL 1363752:1363769|attR 1415411:1415428

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1363752:1363769	attL	NA	NA	NA	NA
WP_002325884.1\|1373605_1374559_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002296337.1\|1374830_1375175_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_002296336.1\|1375175_1375595_+	cupin domain-containing protein	NA	NA	NA	NA
WP_002296335.1\|1375686_1376037_-	hypothetical protein	NA	NA	NA	NA
WP_002296334.1\|1376002_1377334_-	DUF1576 domain-containing protein	NA	NA	NA	NA
WP_002296332.1\|1377589_1378156_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_069972681.1\|1378439_1379645_-\|integrase	tyrosine-type recombinase/integrase	A0A1S5S7K9	Streptococcus_phage	7.3e-64	37.4
WP_060789858.1\|1379782_1380223_-	hypothetical protein	NA	NA	NA	NA
WP_069972682.1\|1380361_1381015_-	hypothetical protein	NA	NA	NA	NA
WP_002350678.1\|1381064_1381493_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_002315392.1\|1381497_1381872_-	helix-turn-helix transcriptional regulator	O03970	Lactobacillus_phage	3.2e-18	38.7
WP_010722429.1\|1382174_1382357_+	helix-turn-helix transcriptional regulator	Q5YAA3	Bacillus_phage	1.1e-11	55.0
WP_002317757.1\|1382372_1382693_+	DUF771 domain-containing protein	NA	NA	NA	NA
WP_069972683.1\|1383636_1384335_+	antirepressor	D2IYT0	Enterococcus_phage	5.1e-25	33.8
WP_038809834.1\|1384512_1384854_+	hypothetical protein	NA	NA	NA	NA
WP_010738857.1\|1384846_1385518_+	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	5.5e-29	47.8
WP_069972684.1\|1385523_1386210_+	hypothetical protein	C9E2N1	Enterococcus_phage	1.4e-88	69.1
WP_002286552.1\|1386212_1386962_+	helix-turn-helix domain-containing protein	A0A1L2BY83	Clostridium_phage	1.7e-31	54.0
WP_002338904.1\|1386973_1387243_+	hypothetical protein	NA	NA	NA	NA
WP_002311435.1\|1387404_1387710_+	hypothetical protein	NA	NA	NA	NA
WP_002326231.1\|1387703_1387994_+	hypothetical protein	D2IZR3	Enterococcus_phage	1.1e-13	43.4
WP_069972685.1\|1387993_1388350_+	DUF1140 family protein	A0A2H4JAZ4	uncultured_Caudovirales_phage	4.0e-10	37.4
WP_002296604.1\|1388309_1388555_+	hypothetical protein	NA	NA	NA	NA
WP_002286547.1\|1388551_1388971_+	hypothetical protein	D2IZL0	Enterococcus_phage	4.1e-30	54.3
WP_069972686.1\|1388967_1389534_+	DUF1642 domain-containing protein	D2IZL3	Enterococcus_phage	2.8e-18	32.8
WP_069972687.1\|1389633_1390323_-	hypothetical protein	Q7Y4L3	Streptococcus_phage	2.7e-31	40.1
WP_069972688.1\|1390579_1391056_+	DUF1492 domain-containing protein	A0A2H4JFW6	uncultured_Caudovirales_phage	2.2e-27	51.6
WP_069972689.1\|1391374_1391671_+	hypothetical protein	NA	NA	NA	NA
WP_069972690.1\|1391731_1392118_+	hypothetical protein	NA	NA	NA	NA
WP_069972691.1\|1392098_1392485_+	hypothetical protein	A0A1B1P7N8	Bacillus_phage	5.6e-10	35.8
WP_002304435.1\|1392481_1392862_+	HNH endonuclease	A0A1B1P7N1	Bacillus_phage	4.7e-41	64.0
WP_069972692.1\|1392973_1393426_+\|terminase	terminase small subunit	A0A2H4JFK0	uncultured_Caudovirales_phage	3.6e-48	69.2
WP_002353266.1\|1393422_1395150_+\|terminase	terminase large subunit	A0A2H4JDG5	uncultured_Caudovirales_phage	7.1e-262	73.0
WP_096948708.1\|1395171_1396401_+\|portal	phage portal protein	A0A2H4J9C7	uncultured_Caudovirales_phage	4.6e-146	65.5
WP_002353264.1\|1396366_1396942_+\|head,protease	HK97 family phage prohead protease	A0A1B2APW1	Phage_Wrath	3.3e-70	72.2
WP_069972693.1\|1396954_1398316_+\|capsid	phage major capsid protein	A0A1B2APY9	Phage_Wrath	4.9e-125	69.6
WP_002301326.1\|1398317_1398596_+\|head,tail	phage gp6-like head-tail connector protein	A0A1C8E967	Bacillus_phage	3.5e-22	62.7
WP_002303041.1\|1398576_1398903_+\|head	phage head closure protein	A0A0N7IRA3	Lactobacillus_phage	2.9e-23	53.4
WP_002353261.1\|1398892_1399231_+	hypothetical protein	A0A1B1P7P2	Bacillus_phage	6.6e-23	46.8
WP_002353260.1\|1399220_1399586_+	HK97 gp10 family phage protein	A0A2H4JDG0	uncultured_Caudovirales_phage	7.7e-17	41.1
WP_002353259.1\|1399592_1400219_+\|tail	tail protein	A0A2H4JGN2	uncultured_Caudovirales_phage	1.7e-27	34.0
WP_047649774.1\|1400218_1400683_+	hypothetical protein	A0A2H4J956	uncultured_Caudovirales_phage	5.7e-17	41.0
WP_069972694.1\|1400877_1403187_+\|tail	phage tail tape measure protein	Q8W5Z7	Listeria_phage	1.2e-83	49.0
WP_002349218.1\|1403198_1403903_+\|tail	phage tail protein	NA	NA	NA	NA
WP_069972695.1\|1403899_1406605_+	peptidoglycan DD-metalloendopeptidase family protein	Q9AZX5	Lactococcus_phage	5.0e-169	40.4
WP_025476995.1\|1406579_1408337_+	DUF2479 domain-containing protein	Q9AZ56	Lactococcus_phage	3.2e-36	46.1
WP_002349645.1\|1408353_1409136_+	hypothetical protein	NA	NA	NA	NA
WP_002317324.1\|1409135_1411202_+	DUF2479 domain-containing protein	A0A096XSZ6	Enterococcus_phage	1.4e-86	47.0
WP_069972696.1\|1411202_1411649_+	hypothetical protein	NA	NA	NA	NA
WP_002331002.1\|1411650_1411788_+	XkdX family protein	NA	NA	NA	NA
WP_069972697.1\|1411824_1412118_+	hypothetical protein	NA	NA	NA	NA
WP_002302122.1\|1412140_1412338_+\|holin	holin	A0A0S2MYF6	Enterococcus_phage	7.8e-24	85.9
WP_069972698.1\|1412348_1413368_+	N-acetylmuramoyl-L-alanine amidase	A0A1G5SA77	Enterococcus_phage	7.1e-60	68.6
WP_096157805.1\|1413407_1414747_-\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-78	52.7
WP_000997695.1\|1416260_1417439_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
1415411:1415428	attR	NA	NA	NA	NA
WP_002322125.1\|1418048_1419512_+\|transposase	IS1182-like element ISEfa7 family transposase	A0A1X9I5T2	Streptococcus_phage	2.0e-124	48.0

DBSCAN-SWA_9

1589623 : 1620617

Streptococcus_phage(22.22%)

tRNA,integrase,protease,transposase

attL 1589451:1589468|attR 1624142:1624159

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1589451:1589468	attL	NA	NA	NA	NA
WP_002297185.1\|1589623_1590919_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002288335.1\|1591098_1591800_+\|tRNA	tRNA (adenine-N(1))-methyltransferase	NA	NA	NA	NA
WP_002288338.1\|1591796_1592918_+	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_002288340.1\|1592932_1594165_+	peptidase T	NA	NA	NA	NA
WP_002288343.1\|1594296_1595205_+	YegS/Rv2252/BmrU family lipid kinase	NA	NA	NA	NA
WP_002288344.1\|1595239_1595512_+	DUF1294 domain-containing protein	NA	NA	NA	NA
WP_002288347.1\|1595522_1596569_+	flippase-like domain-containing protein	NA	NA	NA	NA
WP_002288348.1\|1596819_1599429_+	ATP-dependent chaperone ClpB	A0A2I7SAX5	Vibrio_phage	1.6e-132	35.0
WP_002288350.1\|1599579_1600251_-	hypothetical protein	NA	NA	NA	NA
WP_002288352.1\|1600243_1600738_-	nucleoside deoxyribosyltransferase	A0A1W6JK28	Lactococcus_phage	7.2e-42	56.5
WP_002288353.1\|1600757_1601978_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002288355.1\|1602124_1603960_+	elongation factor 4	E4ZFJ7	Streptococcus_phage	3.4e-20	24.4
WP_002288357.1\|1604053_1605181_-\|integrase	site-specific integrase	A0A2I7SCV1	Paenibacillus_phage	1.8e-109	55.5
WP_000222572.1\|1605237_1606191_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_000997695.1\|1606346_1607525_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002321532.1\|1607770_1608061_-	hypothetical protein	NA	NA	NA	NA
WP_002322258.1\|1608178_1608439_-	hypothetical protein	NA	NA	NA	NA
WP_002289415.1\|1608575_1608989_-	Hsp20/alpha crystallin family protein	A0A1B2LRT2	Wolbachia_phage	2.1e-07	31.5
WP_002303864.1\|1609444_1609930_-	hypothetical protein	NA	NA	NA	NA
WP_002289418.1\|1610068_1610284_-	DUF378 domain-containing protein	NA	NA	NA	NA
WP_002289420.1\|1610507_1611308_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.6e-09	26.2
WP_002289421.1\|1611326_1613195_+	HTH domain-containing protein	NA	NA	NA	NA
WP_002289422.1\|1613187_1613679_+	DeoR family transcriptional regulator	NA	NA	NA	NA
WP_002289423.1\|1613666_1614221_+	PTS sorbitol transporter subunit IIC	NA	NA	NA	NA
WP_002296760.1\|1614238_1615234_+	PTS glucitol/sorbitol transporter subunit IIB	NA	NA	NA	NA
WP_002287107.1\|1615375_1616626_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002296624.1\|1617034_1617433_+	PTS glucitol/sorbitol transporter subunit IIA	NA	NA	NA	NA
WP_002311093.1\|1617416_1618112_+	fructose-6-phosphate aldolase	E3SKN5	Synechococcus_phage	1.0e-22	31.5
WP_002296627.1\|1618705_1619593_-	rotamase	NA	NA	NA	NA
WP_002296628.1\|1619777_1620617_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
1624142:1624159	attR	NA	NA	NA	NA

DBSCAN-SWA_10

1923829 : 1932890

Synechococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288010.1\|1923829_1924408_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-26	37.4
WP_002321731.1\|1924404_1925448_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	2.7e-62	43.7
WP_002288013.1\|1925479_1926919_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.3e-53	33.1
WP_002288015.1\|1926903_1929126_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.9e-150	41.3
WP_002288017.1\|1929126_1929798_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_002295474.1\|1929799_1930054_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_002288021.1\|1930053_1930782_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	4.6e-45	41.4
WP_002297115.1\|1931037_1931415_+	hypothetical protein	NA	NA	NA	NA
WP_002288023.1\|1931594_1932890_-	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	4.5e-19	33.1

DBSCAN-SWA_11

2206640 : 2258497

Escherichia_phage(21.43%)

holin,integrase,transposase

attL 2208106:2208121|attR 2255429:2255444

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296127.1\|2206640_2208188_-\|transposase	IS66 family transposase	NA	NA	NA	NA
2208106:2208121	attL	NA	NA	NA	NA
WP_002287659.1\|2208289_2208643_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_002285758.1\|2208632_2208827_-	hypothetical protein	NA	NA	NA	NA
WP_002289149.1\|2209082_2209376_-	iron-sulfur cluster biosynthesis protein	NA	NA	NA	NA
WP_002289151.1\|2209403_2210069_-	TrkA family potassium uptake protein	NA	NA	NA	NA
WP_002295404.1\|2210208_2210841_-	response regulator transcription factor	NA	NA	NA	NA
WP_002312578.1\|2210847_2211915_-	sensor histidine kinase	NA	NA	NA	NA
WP_002295408.1\|2211911_2212643_-	cell wall-active antibiotics response protein	NA	NA	NA	NA
WP_002295409.1\|2212810_2213290_-	transcription elongation factor GreA	NA	NA	NA	NA
WP_002295410.1\|2213425_2214601_-	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_002297066.1\|2214765_2215926_+	serine hydrolase	A0A2R4AS58	Mycobacterium_phage	3.2e-08	25.2
WP_002312603.1\|2215958_2217422_-\|transposase	IS1182-like element ISEfa7 family transposase	A0A1X9I5T2	Streptococcus_phage	5.3e-125	48.2
WP_002297065.1\|2217522_2218470_-	NAD-dependent epimerase/dehydratase family protein	A0A1V0SKV4	Klosneuvirus	2.3e-52	38.2
WP_002297064.1\|2218502_2219918_-	O-antigen ligase family protein	NA	NA	NA	NA
WP_002321507.1\|2219914_2221030_-	glycosyltransferase	NA	NA	NA	NA
WP_002321508.1\|2221086_2222574_-	hypothetical protein	NA	NA	NA	NA
WP_002297061.1\|2222644_2223619_-	glycosyltransferase	A0A0F7L2F7	uncultured_marine_virus	2.5e-06	35.2
WP_002297060.1\|2223663_2224629_-	glycosyltransferase	A0A0F7L2F7	uncultured_marine_virus	2.5e-06	34.6
WP_002321509.1\|2224621_2225689_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_002297058.1\|2225696_2226398_-	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_002312566.1\|2226394_2227249_-	LicD family protein	NA	NA	NA	NA
WP_002321510.1\|2227281_2228085_-	glycosyltransferase	F2Y1U7	Organic_Lake_phycodnavirus	5.1e-13	31.5
WP_002295430.1\|2228143_2229535_-	sugar transferase	NA	NA	NA	NA
WP_002297271.1\|2229869_2230829_+\|transposase	IS30-like element IS6770 family transposase	NA	NA	NA	NA
WP_002296538.1\|2230896_2233035_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002296539.1\|2233073_2234660_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_002296541.1\|2234649_2235870_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.3e-11	26.4
WP_002289081.1\|2235881_2236688_-	ABC transporter permease	NA	NA	NA	NA
WP_002296542.1\|2236897_2238178_-	EpaQ family protein	NA	NA	NA	NA
WP_002296543.1\|2238221_2240255_-	hypothetical protein	NA	NA	NA	NA
WP_002294531.1\|2240289_2241141_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.3e-38	39.0
WP_002296544.1\|2241238_2242267_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	2.2e-69	43.2
WP_002286442.1\|2242288_2242861_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	8.3e-42	49.2
WP_002286449.1\|2242874_2243741_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	3.7e-102	62.5
WP_002321540.1\|2243840_2244575_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002286453.1\|2244552_2245380_-	glycosyltransferase	NA	NA	NA	NA
WP_002286455.1\|2245379_2246180_-	glycosyltransferase	NA	NA	NA	NA
WP_002286457.1\|2246172_2247312_-	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
WP_002286461.1\|2247387_2248311_-	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_002294533.1\|2248342_2249107_-	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_002286465.1\|2249264_2249705_+	flavodoxin	NA	NA	NA	NA
WP_002286467.1\|2249882_2250452_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002286469.1\|2250705_2251938_+	aminopeptidase	NA	NA	NA	NA
WP_002286470.1\|2252242_2252443_+\|integrase	tyrosine-type recombinase/integrase	Q9AZR0	Lactococcus_phage	4.6e-08	75.7
WP_002286473.1\|2253030_2253402_-	hypothetical protein	NA	NA	NA	NA
WP_002296902.1\|2253403_2253805_-	hypothetical protein	NA	NA	NA	NA
WP_002286474.1\|2253818_2254226_-	hypothetical protein	NA	NA	NA	NA
WP_087046766.1\|2255148_2256311_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
2255429:2255444	attR	NA	NA	NA	NA
WP_002286484.1\|2257250_2258276_-	N-acetylmuramoyl-L-alanine amidase	A0A139ZVY1	Enterococcus_phage	2.1e-64	61.3
WP_002286683.1\|2258272_2258497_-\|holin	holin	NA	NA	NA	NA

DBSCAN-SWA_12

2264007 : 2299082

Enterococcus_phage(29.41%)

protease,integrase,tail,portal,terminase,head

attL 2259403:2259419|attR 2299243:2299259

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2259403:2259419	attL	NA	NA	NA	NA
WP_002317183.1\|2264007_2266839_-	peptidoglycan DD-metalloendopeptidase family protein	A0A1P8BMB8	Lactococcus_phage	0.0e+00	59.7
WP_002311466.1\|2266835_2267603_-\|tail	phage tail protein	D7RWD9	Brochothrix_phage	1.2e-59	45.5
WP_002311465.1\|2267635_2270755_-\|tail	phage tail tape measure protein	Q9G097	Lactococcus_phage	1.8e-167	79.2
WP_002318903.1\|2270771_2271059_-	hypothetical protein	D7RWD7	Brochothrix_phage	2.4e-13	44.3
WP_002293018.1\|2271112_2271481_-	hypothetical protein	Q77RZ7	Lactococcus_phage	8.6e-24	54.8
WP_002311463.1\|2271526_2272039_-\|tail	phage major tail protein, TP901-1 family	D7RWD5	Brochothrix_phage	7.4e-58	66.3
WP_002311462.1\|2272049_2272442_-	hypothetical protein	Q77K20	Lactococcus_phage	2.2e-49	76.2
WP_002311461.1\|2272438_2272810_-	HK97 gp10 family phage protein	Q77K21	Lactococcus_phage	6.8e-29	51.2
WP_002311460.1\|2272806_2273133_-	hypothetical protein	A0A1P8BMJ2	Lactococcus_phage	8.1e-18	50.5
WP_002311459.1\|2273129_2273468_-\|head,tail	phage head-tail connector protein	A0A097BY74	Leuconostoc_phage	3.8e-10	40.4
WP_002311458.1\|2273507_2273714_-	hypothetical protein	NA	NA	NA	NA
WP_002311457.1\|2273724_2274732_-	hypothetical protein	C9E2J5	Enterococcus_phage	5.4e-161	86.2
WP_002311456.1\|2274756_2275110_-	hypothetical protein	C9E2J4	Enterococcus_phage	6.7e-42	73.5
WP_002311455.1\|2275121_2275763_-	DUF4355 domain-containing protein	C9E2J3	Enterococcus_phage	2.4e-37	48.1
WP_002311453.1\|2275877_2276060_-	hypothetical protein	NA	NA	NA	NA
WP_002311451.1\|2276397_2277351_-	hypothetical protein	Q9AZ64	Lactococcus_phage	2.7e-114	65.8
WP_002311450.1\|2277355_2277619_-	hypothetical protein	A0A1S5SBT9	Streptococcus_phage	3.2e-17	54.0
WP_002318892.1\|2277631_2277862_-	hypothetical protein	NA	NA	NA	NA
WP_002311447.1\|2277815_2279450_-\|portal	phage portal protein	C9E2I8	Enterococcus_phage	1.3e-185	61.4
WP_002311446.1\|2279460_2280759_-\|terminase	PBSX family phage terminase large subunit	D7RWC5	Brochothrix_phage	2.2e-207	81.5
WP_002311445.1\|2280751_2281207_-\|terminase	terminase small subunit	D7RWC4	Brochothrix_phage	2.7e-19	41.4
WP_002311444.1\|2281232_2281457_-	hypothetical protein	NA	NA	NA	NA
WP_002330493.1\|2281955_2282135_+	YegP family protein	NA	NA	NA	NA
WP_024265261.1\|2282127_2282541_-	hypothetical protein	NA	NA	NA	NA
WP_002300143.1\|2282831_2283107_+	hypothetical protein	A0A2H4JEH2	uncultured_Caudovirales_phage	9.9e-17	45.7
WP_002286542.1\|2283564_2283978_-	autolysin	C9E2P5	Enterococcus_phage	1.5e-56	81.0
WP_002286693.1\|2284054_2284351_-	hypothetical protein	NA	NA	NA	NA
WP_002286545.1\|2284347_2284905_-	DUF1642 domain-containing protein	A0A0C5KKV2	Enterococcus_phage	2.8e-10	36.2
WP_002312822.1\|2284901_2285297_-	hypothetical protein	Q938M1	Temperate_phage	6.6e-14	41.6
WP_002311438.1\|2285463_2285775_-	hypothetical protein	D2IZY1	Enterococcus_phage	9.1e-27	58.6
WP_002311437.1\|2285774_2286065_-	hypothetical protein	D2IZR3	Enterococcus_phage	1.8e-13	43.4
WP_002322110.1\|2286058_2286370_-	hypothetical protein	NA	NA	NA	NA
WP_002290675.1\|2286366_2286528_-	hypothetical protein	NA	NA	NA	NA
WP_002311433.1\|2286524_2286827_-	hypothetical protein	NA	NA	NA	NA
WP_002311431.1\|2286988_2287258_-	hypothetical protein	NA	NA	NA	NA
WP_002311430.1\|2287269_2288121_-	replication protein	A0A1S5SFJ6	Streptococcus_phage	2.7e-49	66.4
WP_002317389.1\|2288229_2288745_-	HNH endonuclease	E5DV63	Deep-sea_thermophilic_phage	2.9e-17	37.5
WP_002330486.1\|2288752_2289445_-	hypothetical protein	A0A0S2MYA3	Enterococcus_phage	9.7e-61	52.3
WP_002286557.1\|2289450_2290122_-	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	4.2e-29	47.4
WP_002311424.1\|2290114_2290456_-	hypothetical protein	NA	NA	NA	NA
WP_002311421.1\|2290777_2290966_-	hypothetical protein	D2IZW5	Enterococcus_phage	1.7e-07	58.6
WP_002311419.1\|2290986_2291271_-	hypothetical protein	NA	NA	NA	NA
WP_002311418.1\|2291318_2291618_-	hypothetical protein	NA	NA	NA	NA
WP_002296611.1\|2291632_2291836_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002311416.1\|2291850_2292597_-	hypothetical protein	A0A0B5A507	Paenibacillus_phage	1.6e-48	41.8
WP_002322655.1\|2292672_2292924_+	hypothetical protein	NA	NA	NA	NA
WP_002311412.1\|2293110_2293299_+	hypothetical protein	NA	NA	NA	NA
WP_002317392.1\|2293746_2294067_+	helix-turn-helix transcriptional regulator	A0A1S5SAD3	Streptococcus_phage	2.6e-21	57.3
WP_002290613.1\|2294084_2294507_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_002311408.1\|2294593_2294899_+	hypothetical protein	NA	NA	NA	NA
WP_002311406.1\|2294997_2296146_+\|integrase	site-specific integrase	A0A1B1IMP1	Lactococcus_phage	3.9e-91	48.4
WP_002288864.1\|2296234_2297860_-	chaperonin GroEL	A0A219YK78	uncultured_virus	2.2e-156	56.8
WP_002288862.1\|2297910_2298195_-	co-chaperone GroES	A0A221S4M3	uncultured_virus	2.0e-12	40.2
WP_002288860.1\|2298419_2299082_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
2299243:2299259	attR	NA	NA	NA	NA

DBSCAN-SWA_13

2629988 : 2649596

Streptococcus_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297366.1\|2629988_2630303_+	YdcP family protein	A0A1S5SF38	Streptococcus_phage	1.0e-25	53.4
WP_002297365.1\|2630315_2630690_+	YdcP family protein	A0A1S5SF96	Streptococcus_phage	2.4e-34	66.1
WP_002311649.1\|2630690_2631035_+	hypothetical protein	NA	NA	NA	NA
WP_002343904.1\|2631117_2632263_+	DUF87 domain-containing protein	A0A1S5SFB5	Streptococcus_phage	6.0e-132	62.8
WP_002297361.1\|2632977_2634837_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.8e-30	26.0
WP_002297360.1\|2634930_2635170_+	hypothetical protein	A0A1S5SFB5	Streptococcus_phage	2.1e-23	80.3
WP_002297358.1\|2635247_2635922_+	AAA family ATPase	NA	NA	NA	NA
WP_002321810.1\|2636154_2636589_+	DNA (cytosine-5-)-methyltransferase	A0A1S5SDW2	Streptococcus_phage	6.5e-63	77.1
WP_002297356.1\|2636589_2637297_+	DNA methylase	A0A1S5SEK0	Streptococcus_phage	5.8e-53	50.4
WP_002297354.1\|2637286_2637577_+	hypothetical protein	NA	NA	NA	NA
WP_002297353.1\|2637835_2639020_+	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.9e-142	61.6
WP_002317225.1\|2639016_2639154_+	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_002286940.1\|2639899_2641810_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.1e-37	29.8
WP_033658092.1\|2641913_2642138_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	1.2e-23	83.8
WP_002297350.1\|2642150_2642654_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	9.2e-53	59.9
WP_002297349.1\|2642713_2643103_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	3.9e-43	68.3
WP_002297348.1\|2643089_2645537_+	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	76.0
WP_002297347.1\|2645541_2647665_+	hypothetical protein	A0A1S5SF30	Streptococcus_phage	1.2e-181	59.7
WP_002297346.1\|2647661_2648666_+	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	5.6e-118	63.5
WP_002297345.1\|2648684_2649596_+	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	2.2e-65	44.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP014534

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 9887

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069972717.1\|1586_3290_+	hypothetical protein	NA	NA	NA	NA
WP_069972718.1\|3350_4811_+	hypothetical protein	NA	NA	NA	NA
WP_069972719.1\|4821_7026_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	2.1e-117	51.2
WP_002330563.1\|7264_7858_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002322787.1\|7873_8773_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_002296241.1\|8775_9261_+	single-stranded DNA-binding protein	W6LM61	Streptococcus_phage	3.4e-44	59.9
WP_002296240.1\|9626_9887_+	hypothetical protein	A0A0S2MYI8	Enterococcus_phage	3.4e-11	51.4

DBSCAN-SWA_2

13468 : 17872

Clostridium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002318230.1\|13468_14083_-	recombinase family protein	M9Q1K0	Clostridium_phage	2.6e-17	31.9
WP_002319870.1\|14532_15858_+	Y-family DNA polymerase	M1Q231	Streptococcus_phage	1.2e-99	43.6
WP_002323028.1\|15850_16201_+	hypothetical protein	NA	NA	NA	NA
WP_002326890.1\|16416_16710_+	hypothetical protein	NA	NA	NA	NA
WP_002323027.1\|17029_17872_+	ParA family protein	F0PIG8	Enterococcus_phage	8.0e-25	31.5

DBSCAN-SWA_3

22235 : 22577

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002314399.1\|22235_22577_+	DUF5406 domain-containing protein	F0PIH7	Enterococcus_phage	4.0e-36	63.4

DBSCAN-SWA_4

38327 : 40244

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002351219.1\|38327_40244_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	8.4e-30	27.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP014530

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP014530_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014530_1

200607-200734

TypeV

Consensus_repeat	Method
TCAGAGGGTATGAAAATCATACC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP014530_1

>merge|NZ_CP014530|1|200607-200734|CRISPRCasFinder
TCAGAGGGTATGAAAATCATACCCACCCTCGACGAAAAATCAGACGCTGAATCCCTTGGGGCTCAAGAGGGTATGAAAATCATACCGTGCCAAAACGTTGATAAATCAGAGGGTATGAAAATCATACC

>NZ_CP014530|1|1|200607-200734|CRISPRCasFinder
TCAGAGGGTATGAAAATCATACC	CACCCTCGACGAAAAATCAGACGCTGAATCCCTTGGGGCT
CAAGAGGGTATGAAAATCATACC	GTGCCAAAACGTTGATAAA
TCAGAGGGTATGAAAATCATACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014530.1\|WP_002322486.1\|202042_202375_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014530.1\|WP_002290397.1\|191738_191993_-\|AbrB-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274230
NZ_CP014530.1\|WP_002293481.1\|203850_204045_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014530.1\|WP_002317435.1\|204171_204861_+\|sortase	unknown	unknown	gnl\|CDD\|320680
NZ_CP014530.1\|WP_029744575.1\|192754_192937_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014530.1\|WP_002317436.1\|203501_203741_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014530.1\|WP_002317431.1\|209592_210348_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014530.1\|WP_002326809.1\|195948_197244_+\|ISL3-like-element-ISEfa5-family-transposase	unknown	unknown	gnl\|CDD\|376574
NZ_CP014530.1\|WP_002326809.1\|194508_195804_+\|ISL3-like-element-ISEfa5-family-transposase	unknown	unknown	gnl\|CDD\|376574
NZ_CP014530.1\|WP_002302867.1\|210360_210621_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014530.1\|WP_002292680.1\|188305_189163_-\|ParA-family-protein	unknown	unknown	gnl\|CDD\|379293
NZ_CP014530.1\|WP_002305221.1\|208824_209577_+\|class-C-sortase	unknown	unknown	gnl\|CDD\|320676
NZ_CP014530.1\|WP_002292678.1\|189725_190055_-\|AbrB-family-transcriptional-regulator	unknown	unknown	unknown
NZ_CP014530.1\|WP_002290394.1\|191420_191738_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|368240
NZ_CP014530.1\|WP_002317433.1\|206106_206781_+\|class-A-sortase	unknown	unknown	gnl\|CDD\|320680
NZ_CP014530.1\|WP_002326809.1\|197388_198684_+\|ISL3-like-element-ISEfa5-family-transposase	unknown	unknown	gnl\|CDD\|376574
NZ_CP014530.1\|WP_002317437.1\|203152_203335_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379975
NZ_CP014530.1\|WP_002343821.1\|190227_190908_-\|IS6-like-element-IS1216-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_CP014530.1\|WP_002292679.1\|189448_189736_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|374105
NZ_CP014530.1\|WP_002317432.1\|206833_208810_+\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|374637

Protein	Function_ID	Function_description	E-value
NZ_CP014530.1\|WP_002290397.1\|191738_191993_-\|AbrB-family-transcriptional-regulator	gnl\|CDD\|274230	TIGR02609, hypothetical_protein_XAC1195, putative addiction module antidote. Members of this protein family are putative addiction module antidote proteins that appear recurringly in two-gene operons with members of the Doc (death-on-curing) family TIGR01550. Members of this family contain a SpoVT/AbrB-like domain (pfam04014). Note that the gene pairs with a member of this family tend to be found on bacterial chromosomes, not on plasmids. [Mobile and extrachromosomal element functions, Other].	1.45571e-07
NZ_CP014530.1\|WP_002317435.1\|204171_204861_+\|sortase	gnl\|CDD\|320680	cd06165, Sortase_A, Sortase domain found in class A sortases. Class A sortases are membrane-bound cysteine transpeptidases distributed in Gram-positive bacteria (mainly present in Firmicutes). They perform a housekeeping role in the cell as members of this group are capable of anchoring a large number of functionally distinct surface proteins containing a cell wall sorting signal to an amino group located on the bacterial cell wall. They do so by catalyzing a transpeptidation reaction in which the surface protein substrate is cleaved at a conserved cell wall-sorting signal (Class A sortases recognize a canonical LPXTG motif, X can be any amino acid), and covalently linked to peptidoglycan for display on the bacterial surface. The prototypical sortase A protein from Staphylococcus aureus (named Sa-SrtA) cleaves the amide bond between threonine and glycine residues of the canonical LPXTG motif in a wide range of protein substrates with diverse functions that can promote bacterial adhesion, nutrient acquisition, host cell invasion, and immune evasion. Next, it catalyzes a transpeptidation reaction by which the proteins are covalently linked to the peptidoglycan precursor lipid II. SrtA is therefore affects the ability of a pathogen to establish successful infection. SrtA contains an N-terminal hydrophobic segment, a linker region and an extra-cellular C-terminal catalytic domain. The hydrophobic segment functions as both a signal peptide for secretion and a stop-transfer signal for membrane anchoring. The catalytic domain contains the catalytic TLXTC signature sequence where X is usually a valine, isoleucine or a threonine. The gene encoding SrtA is generally not located in the same gene cluster as its substrates while the gene encoding SrtB is usually clustered in the same locus as its substrate.	9.57718e-21
NZ_CP014530.1\|WP_002326809.1\|195948_197244_+\|ISL3-like-element-ISEfa5-family-transposase	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	1.52423e-63
NZ_CP014530.1\|WP_002326809.1\|197388_198684_+\|ISL3-like-element-ISEfa5-family-transposase	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	1.52423e-63
NZ_CP014530.1\|WP_002305221.1\|208824_209577_+\|class-C-sortase	gnl\|CDD\|320676	cd05827, Sortase_C, Sortase domain found in class C sortases. Class C sortases are membrane-bound cysteine transpeptidases broadly distributed in Gram-positive bacteria (mainly present in Firmicutes and Actinobacteria). They function as pilin polymerases responsible for the assembly of pili, which are multi-subunit hair-like fibres that extend from the cell surface to promote microbial adhesion and biofilm formation. First, one or more class C sortases form the long thin shaft of the pilus through linking together pilin subunits via isopeptide bonds. The base of the pilus is then anchored to the cell wall by a housekeeping sortase or, in some cases, the class C sortase itself. Depending upon the organism both the number and type of sortase enzymes involved varies, and in some cases, accessory factors appear to be needed. In three-component spaA pilus from Corynebacterium diphtheriae, the prototypical class C sortase (named Cd-SrtA) catalyzes polymerization of the SpaA-type pilus, consisting of the shaft pilin SpaA, tip pilin SpaC and minor pilin SpaB. The pilus shaft is then attached to the cell wall by a housekeeping class E sortase, Cd-SrtF. In the absence of Cd-SrtF, Cd-SrtA attaches the pilus to the cell wall, albeit at a reduced rate. Cd-SrtA can recognize two distinct sorting signals (LPLTG in SpaA and SpaC, and LAFTG in SpaB) and it can employ lysine residues that originate from different proteins (either Lys190 within the pilin motif of SpaA or Lys139 in SpaB). However, Cd-SrtA cannot be able to polymerize the major pilin subunit SpaH, even though it contains LPLTG motif. In two-component pili of prototypical Bacillus cereus, the class C sortase (named Bc-SrtD) cleaves related sorting signals within a major pilin protein BcpA (LPVTG) and a minor tip pilin BcpB (IPNTG), and catalyzes a transpeptidation that joins the threonine residues in each signal to the side-chain of Lys162 in BcpA (located within a pilin motif). Unlike the SpaA pilus in C. diphtheriae, in B. cereus Bc-SrtD is unable to covalently attach the pilus to the cell wall without the help of the housekeeping sortase.	1.70826e-57
NZ_CP014530.1\|WP_002292680.1\|188305_189163_-\|ParA-family-protein	gnl\|CDD\|379293	pfam13614, AAA_31, AAA domain. This family includes a wide variety of AAA domains including some that have lost essential nucleotide binding residues in the P-loop.	8.87089e-34
NZ_CP014530.1\|WP_002290394.1\|191420_191738_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|368240	pfam05016, ParE_toxin, ParE toxin of type II toxin-antitoxin system, parDE. ParE is the toxin family of a type II toxin-antitoxin family. It is toxic towards DNA gyrase, but is neutralized by the antitoxin ParD. The family also encompasses RelE/ParE described in.	2.94793e-05
NZ_CP014530.1\|WP_002317433.1\|206106_206781_+\|class-A-sortase	gnl\|CDD\|320680	cd06165, Sortase_A, Sortase domain found in class A sortases. Class A sortases are membrane-bound cysteine transpeptidases distributed in Gram-positive bacteria (mainly present in Firmicutes). They perform a housekeeping role in the cell as members of this group are capable of anchoring a large number of functionally distinct surface proteins containing a cell wall sorting signal to an amino group located on the bacterial cell wall. They do so by catalyzing a transpeptidation reaction in which the surface protein substrate is cleaved at a conserved cell wall-sorting signal (Class A sortases recognize a canonical LPXTG motif, X can be any amino acid), and covalently linked to peptidoglycan for display on the bacterial surface. The prototypical sortase A protein from Staphylococcus aureus (named Sa-SrtA) cleaves the amide bond between threonine and glycine residues of the canonical LPXTG motif in a wide range of protein substrates with diverse functions that can promote bacterial adhesion, nutrient acquisition, host cell invasion, and immune evasion. Next, it catalyzes a transpeptidation reaction by which the proteins are covalently linked to the peptidoglycan precursor lipid II. SrtA is therefore affects the ability of a pathogen to establish successful infection. SrtA contains an N-terminal hydrophobic segment, a linker region and an extra-cellular C-terminal catalytic domain. The hydrophobic segment functions as both a signal peptide for secretion and a stop-transfer signal for membrane anchoring. The catalytic domain contains the catalytic TLXTC signature sequence where X is usually a valine, isoleucine or a threonine. The gene encoding SrtA is generally not located in the same gene cluster as its substrates while the gene encoding SrtB is usually clustered in the same locus as its substrate.	2.77329e-45
NZ_CP014530.1\|WP_002326809.1\|194508_195804_+\|ISL3-like-element-ISEfa5-family-transposase	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	1.52423e-63
NZ_CP014530.1\|WP_002317437.1\|203152_203335_+\|hypothetical-protein	gnl\|CDD\|379975	pfam17400, DUF5406, Family of unknown function (DUF5406). This is a family of unknown function found in Bacteria.	2.90909e-20
NZ_CP014530.1\|WP_002343821.1\|190227_190908_-\|IS6-like-element-IS1216-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.47057e-90
NZ_CP014530.1\|WP_002292679.1\|189448_189736_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|374105	pfam15781, ParE-like_toxin, ParE-like toxin of type II bacterial toxin-antitoxin system.	1.10193e-31
NZ_CP014530.1\|WP_002317432.1\|206833_208810_+\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|374637	pfam16569, GramPos_pilinBB, Gram-positive pilin backbone subunit 2, Cna-B-like domain. GramPos_pilinBB is one of the major backbone units of Gram-positive pili, such as those from S.pneumoniae. There are three major pilin subunits that form the polymeric backbone of the pilin from S. pneumoniae, constructed of three transthyretin-like, CnaB, domains along with a crucial N-terminal domain, D1. The three Cna-B like domains are stabilized by internal Lys-Asn isopeptdie bonds, Gram-positive pili are formed from a single chain of covalently linked subunit proteins (pilins), usually comprising an adhesin at the distal tip, a major pilin that forms the polymer shaft and a minor pilin that mediates cell wall anchoring at the base.	2.60134e-30

>NZ_CP014530.1|WP_002326809.1|197388_198684_+|ISL3-like-element-ISEfa5-family-transposase
MNDSIKKMLRLIEKDLMITEVSYETFQKKKTLIVDAVFSPAPHTCRNCGSTVVDGNGKVIVVKNGKKETIVRFEQYNHMPLVMRLKKQRYTCKNCRTHWTAQSYFVQPRHSIANHVRYKIASLLTEKVSLSFIAKNCQVSLTTVIRTLKEFKSYLPKQSKRILPRVLMVDEFRSHASIEDKMSFICADGETGQLIDVLPTRKLPRLTSYFLGCTNPEEVKFLVTDMNAAYFQLTKRILPNAKVVIDRFHIIKHMNQAFNELRIREMNELRKVGQKSQAEKLKKNWRFLLKNRANINHYEYKTWKSFRAPKYPFLTEAMMIDRLLGFSTSLKEAYPYFHELVEAFRDKDPDLFFSLLAELPETLDDGFREKLQNLLTYEEGITNAMIYPYTNGKIEAKNTHIKTMKRVSYGFKSFENMRIRIFLINQLIKVR
>NZ_CP014530.1|WP_002326809.1|195948_197244_+|ISL3-like-element-ISEfa5-family-transposase
MNDSIKKMLRLIEKDLMITEVSYETFQKKKTLIVDAVFSPAPHTCRNCGSTVVDGNGKVIVVKNGKKETIVRFEQYNHMPLVMRLKKQRYTCKNCRTHWTAQSYFVQPRHSIANHVRYKIASLLTEKVSLSFIAKNCQVSLTTVIRTLKEFKSYLPKQSKRILPRVLMVDEFRSHASIEDKMSFICADGETGQLIDVLPTRKLPRLTSYFLGCTNPEEVKFLVTDMNAAYFQLTKRILPNAKVVIDRFHIIKHMNQAFNELRIREMNELRKVGQKSQAEKLKKNWRFLLKNRANINHYEYKTWKSFRAPKYPFLTEAMMIDRLLGFSTSLKEAYPYFHELVEAFRDKDPDLFFSLLAELPETLDDGFREKLQNLLTYEEGITNAMIYPYTNGKIEAKNTHIKTMKRVSYGFKSFENMRIRIFLINQLIKVR
>NZ_CP014530.1|WP_002326809.1|194508_195804_+|ISL3-like-element-ISEfa5-family-transposase
MNDSIKKMLRLIEKDLMITEVSYETFQKKKTLIVDAVFSPAPHTCRNCGSTVVDGNGKVIVVKNGKKETIVRFEQYNHMPLVMRLKKQRYTCKNCRTHWTAQSYFVQPRHSIANHVRYKIASLLTEKVSLSFIAKNCQVSLTTVIRTLKEFKSYLPKQSKRILPRVLMVDEFRSHASIEDKMSFICADGETGQLIDVLPTRKLPRLTSYFLGCTNPEEVKFLVTDMNAAYFQLTKRILPNAKVVIDRFHIIKHMNQAFNELRIREMNELRKVGQKSQAEKLKKNWRFLLKNRANINHYEYKTWKSFRAPKYPFLTEAMMIDRLLGFSTSLKEAYPYFHELVEAFRDKDPDLFFSLLAELPETLDDGFREKLQNLLTYEEGITNAMIYPYTNGKIEAKNTHIKTMKRVSYGFKSFENMRIRIFLINQLIKVR
>NZ_CP014530.1|WP_029744575.1|192754_192937_-|hypothetical-protein
MQADGFFLRFYIIELTGRLTVFFGNFAIKPFAEVTAHYICKWLDCKNKIKKVFHYISSSP
>NZ_CP014530.1|WP_002290397.1|191738_191993_-|AbrB-family-transcriptional-regulator
MGKELKVRKIGNSVGVILPSSLGLKSGDTIQAKQEGNLFILDTTQIAKEHDRKLIEESFQDFEKGLTVSEIEMVKAFGKYGWSE
>NZ_CP014530.1|WP_002290394.1|191420_191738_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MKEYTLVYSKSFQTSLETIIEEWENELALSPASIKRFVGAIQKALELTKNFPTMHEEVSEIYGMDIPTYRIVIGKSYALFYRIDHEKKEILVGRIFQSKQMKLGF
>NZ_CP014530.1|WP_002343821.1|190227_190908_-|IS6-like-element-IS1216-family-transposase
MNHFKGKQFQQDVIIVAVGYYLRYNISYREVQENLYDRGINVSHTTIYRWVQEYGKLLYQIWKKKNKKSFYSWKMDETYIKIKGKWHYLYRAIDADGLTLDIWLRKKRDTQAAYAFLKRLVKQFDEPKVVVTDKAPSITSAFKKLKEYGFYQGTEHRTIKYLNNLIEQDHRPVKRRNKFYRSLRTASTTIKGMEAIRGLYKKTRKEGTLFGFSVCTEIKVLLGIPA
>NZ_CP014530.1|WP_002292678.1|189725_190055_-|AbrB-family-transcriptional-regulator
MITKTRKQGNSIMLTVPKDFNVPNGVEVEAKLVENGILYEFVEPQKEFYDFSEDILSDIIAEGYDKDEILVEFKNRKNKMHSSFRDIAEDTLTNSKVMTKEELATEIGL
>NZ_CP014530.1|WP_002292679.1|189448_189736_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MAYEIVPSKHVIKYLKKLKEKTLKEKFLNLIYDEIAIDPYKGEQKTGDLSGIWSSGFKYAGTTYRVAYEIIENKVIPVLLCGTHENFYEQLKKLI
>NZ_CP014530.1|WP_002292680.1|188305_189163_-|ParA-family-protein
MVAKKYVIGNFKGGVGKSTCAQMLGFESAVNEGKRTLIIDLDMQGNTSDVMNLTHMNFTNEEGGGEGEPIVYENTVTDVLINNLPPKEAVYKVINNLYILPADMSFEMYDDWIKDQYNDSLSQFKYMKEKLEPLFDEFDVIYLDVPPSISVYSKSAMYIADWAIVVLQTQVKSMRNAMQYLEYMDFFVKEFDTNLYVAGVIPFMLESGDAVDQEMYKQAQEIYGEHLIKNVVLKNARLKRYDGSGITMEKTKKGLLKQWDRKSHELFISILKELEEHENWYAEVE
>NZ_CP014530.1|WP_002322486.1|202042_202375_+|hypothetical-protein
MSYTGILSLKDICHYGKRCTATEKITKKLSTGQSKTVVQCKKYIIQKDKVSEEMIYYIGKQKQIILKDPIPLKELYPTIKHVYDQNGVLIGRRKNGVLRCTAKGMGRLIS
>NZ_CP014530.1|WP_002317437.1|203152_203335_+|hypothetical-protein
MTDNPIGFGLLPEDDEGDEWFKMTLTNDKGDELSVEDTWSYLSDYIVSVEIIDFVADKEE
>NZ_CP014530.1|WP_002317436.1|203501_203741_+|hypothetical-protein
MARPVLDAMDMDTLTKGRYVQLLARSYSPKDVFKALSKGTDMEKERLRKEFDYWRIYNGIKDLKPARPVVKRKKKITQE
>NZ_CP014530.1|WP_002293481.1|203850_204045_+|hypothetical-protein
MEEKLLKTMKQKHLKRLSVMQYISDMQITGKEKACLLGSMKNFEQLRRTYVKIRSNCQLLLEVS
>NZ_CP014530.1|WP_002317435.1|204171_204861_+|sortase
MNKNNKTLFNPYVGVIIVFLLFSYFAYQGHQKDKIAEKVDGVTKTIHIQEQDKTYQDNLTSLTDISKRQLITNQKQALEKDLKGEIAGKLVFSSTGFILPVFQGANSDTLSLGVASTYYPDAEMGNGNYILAGYNVDTPSVLLSDMIDLSEGEEIDLIDAHYKYQYEVSKRGKIYDYSQVVQSKENNSFLSLPKAGKKPLLTLLDFEANNMKKCDVIQCELVNVEKINK
>NZ_CP014530.1|WP_002317433.1|206106_206781_+|class-A-sortase
MDEKMVIFFLGVALIVFCSVFGYVSYQKHEGEVFKQNIEKKIPVDQINAHAKSYKEDATNVNNDMSLGQMLSIQKEAIEMGVNKQVFAQIQIPALGLALPIFKGTNQYTLSLGAATYFYEDGEMGKGNYVLAGHNMEMPGVLFSDIQKLSLGEVMDLVSNDGVYRYKVTRKFIVPEYFKLIDGVPEENSFLSLPKKGEKPLLTLFTCVYTSQGKERYVVQGELQ
>NZ_CP014530.1|WP_002317432.1|206833_208810_+|isopeptide-forming-domain-containing-fimbrial-protein
MAINRYVKKAGMLVGMLGIIASCFQGYQAYAEDVTQKTPPEKVNITVHKLMYDQGTQLNVDIDGIKNDGYTHDQYPTGVTKYNKADYGDVEFTLGNITDQVLPTEDSDLTNAKVDEIVKDVEDKGSNSEYVKNATNKITSAVDENGEITFADQPAYVNSKGNVYVVYESKSAAGLVTQKAKPMVVIAPMTDNTGSGFLKDIHLYPKNIVSKLSFELTKFGDDGTAQSKQTPLKGAKFELYKGEPGKGTKLGDLVSDDQGKLTATDLTLGKYYFVEVPSEVVVGSDKEPTADQYLLGADARNDAHNKLTFEITNDGVTSDLKASYVNYKAPVIDKTVTNGTGQEHSFQIGDAVNYQGTIHIPTDIAGGAGGITVNGVKSETSPYSVFKWGDIAGQGLSYVAAKANIKVTNKDGSVVLKENTDYKIQNSENGFVIDFIVNNGQVSDTVASLHGQDLQMTYNMYVNDSAAVANPLTNSVDFVYNNNPFNQEEHHEKTKADVVTYGAKFLKVDSGLFGIGIKATPLEGAEFAAKNAEGKYYGGLVDTDKNGVKEAVWVDDVANAAILKSDKEGHFEITGLTEGEYSLEETKAPENYQKLTKEISFKVDKDSYKEENRITIKNNQKASVPMTGSNGFQTYVLISCLLLGAGALSAVVYFKKKA
>NZ_CP014530.1|WP_002305221.1|208824_209577_+|class-C-sortase
MIIRKPKKKRIMGKWIIAFWLLSAVGVLLLMPAEASVAKYQQNQQIAAIDRTGTAAETDSSLDVAKIELGDPVGILTILSISLKLPIYDGTSDKILENGVGITEGTGDITGGNGKNPLIAGHSGLYKDNLFDDLPSVKKGEKFYIKVDGEQHAYQIDRIEEVQKDELQRNFVTYLESNPNEDRVTLMTCTPKGINTHRFLVYGKRVTFTKSELKDEENKKQKLSWKWLLGSTVFLSVMIIGSLFVYKKKK
>NZ_CP014530.1|WP_002317431.1|209592_210348_+|hypothetical-protein
MRNRKWLFVCAAALFSFTAYTQLTFADRQESTDSTEQTIQTSDSSTIQSSDETVDSSTVDSSEEPKIAEDDQIVKQTIHVQKIISSEQLDNQGHEKQEGVNGAKFSVYDVSDILQKMDVKDLTTDQIESQLKNRVKKLSSDQLKLVSNEETKTIDQQTGVFEFSVEVQANQKQAYYIVNESSPENISNSEDILLLTPVSDKNGEFLKDVWIYPKSEASQPKEEVKKIVSTGVKKNFFENCWDFVTHLFSRD
>NZ_CP014530.1|WP_002302867.1|210360_210621_+|hypothetical-protein
MKLIKLLLFNFSCLTAVFLYCGLLFSKLSILPSYQLYLMRILNIPAASMPLDIMEKLIRNPLFTTINLIVIVGISLVIYKKEGMKG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221215-221254	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	452-491	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244126-244165	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27883-27922	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96547-96586	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	454-493	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	95091-95130	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358204-358243	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119936-119975	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111370-111409	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126934-126973	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153620-153659	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129211-129250	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71269-71308	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249117-249156	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107198-107237	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91401-91440	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102425-102464	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1397-1436	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60361-60400	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97676-97715	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52636-52675	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102650-102689	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200630-200669	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56542-56581	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65332-65371	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67328-67367	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14571-14610	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178898-178937	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33081-33120	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105709-105748	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39886-39925	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	35165-35204	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225612-225651	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92045-92084	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17088-17127	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86167-86206	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61653-61692	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5084-5123	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177278-177317	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244126-244165	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192112-192151	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	453-492	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168262-168301	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221173-221191	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP040906	Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence	51712-51730	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109405-109423	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358162-358180	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119894-119912	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153578-153596	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129169-129187	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249075-249093	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91359-91377	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102383-102401	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60319-60337	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97634-97652	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52594-52612	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102608-102626	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56500-56518	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65290-65308	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14529-14547	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33039-33057	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39844-39862	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92003-92021	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17046-17064	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47586-47604	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192070-192088	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168220-168238	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	515-533	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244189-244207	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27946-27964	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96610-96628	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	517-535	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111433-111451	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126997-127015	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71332-71350	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107261-107279	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1460-1478	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP045013	Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200693-200711	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67391-67409	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP040873	Enterococcus faecium strain DB-1 plasmid punnamed1	40046-40064	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP040876	Enterococcus faecium strain DB-1 plasmid punnamed2	2896-2914	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178961-178979	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105772-105790	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225675-225693	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86230-86248	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61716-61734	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5147-5165	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177341-177359	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244189-244207	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.2\|200693\|19\|NZ_CP014530\|CRISPRCasFinder	200693-200711	19	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	516-534	0	1.0
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109447-109486	1	0.975
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	453-492	1	0.975
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	453-492	1	0.975
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47628-47667	1	0.975
NZ_CP014530_1	1.1\|200630\|40\|NZ_CP014530\|CRISPRCasFinder	200630-200669	40	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	3358-3397	5	0.875

1. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

2. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

3. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

4. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

5. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

6. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

7. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

8. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

9. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

10. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

11. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

12. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

13. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

14. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

15. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

16. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

17. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

18. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

19. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

20. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

21. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

22. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

23. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

24. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

25. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

26. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

27. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

28. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

29. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

30. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

31. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

32. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

33. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

34. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

35. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

36. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

37. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

38. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

39. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

40. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

41. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

42. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

43. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

44. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

45. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

46. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

47. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

48. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

49. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

50. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

51. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

52. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

53. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

54. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

55. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

56. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

57. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

58. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

59. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

60. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

61. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

62. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

63. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

64. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

65. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

66. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

67. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

68. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

69. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

70. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

71. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

72. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

73. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

74. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

75. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

76. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

77. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

78. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

79. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

80. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

81. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

82. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

83. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

84. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

85. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

86. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

87. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

88. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

89. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

90. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

91. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

92. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

93. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

94. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

95. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

96. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

97. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

98. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

99. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

100. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

101. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

102. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

103. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

104. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

105. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

106. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

107. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

108. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

109. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

110. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

111. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

112. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

113. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

114. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

115. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP040906 (Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

116. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

117. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

118. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

119. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

120. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

121. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

122. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

123. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

124. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

125. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

126. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

127. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

128. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

129. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

130. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

131. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

132. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

133. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

134. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

135. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

136. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

137. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

138. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

139. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

140. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

141. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

142. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

143. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

144. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

145. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

146. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

147. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

148. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

149. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

150. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

151. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

152. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

153. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

154. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

155. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

156. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

157. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

158. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

159. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

160. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

161. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

162. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

163. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

164. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

165. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

166. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

167. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

168. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

169. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

170. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

171. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

172. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

173. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

174. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

175. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

176. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

177. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

178. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

179. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

180. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

181. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

182. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

183. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

184. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

185. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

186. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

187. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

188. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

189. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

190. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

191. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

192. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

193. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

194. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP045013 (Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

195. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

196. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

197. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

198. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

199. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

200. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP040873 (Enterococcus faecium strain DB-1 plasmid punnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

201. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP040876 (Enterococcus faecium strain DB-1 plasmid punnamed2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

202. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

203. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

204. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

205. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

206. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

207. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

208. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

209. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

210. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

211. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

212. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

213. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

214. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

215. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

216. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

217. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

218. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

219. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

220. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

221. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

222. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

223. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

224. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

225. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

226. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

227. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

228. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

229. spacer 1.2|200693|19|NZ_CP014530|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

230. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

231. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

232. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

233. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
catcctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
**.*************************************

234. spacer 1.1|200630|40|NZ_CP014530|CRISPRCasFinder matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 5, identity: 0.875

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatccttggggctc	Protospacer
*******************************.* *** ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

9695 : 63601

Streptococcus_phage(27.78%)

bacteriocin,holin,transposase,integrase

attL 9557:9616|attR 53809:55599

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
9557:9616	attL	NA	NA	NA	NA
WP_002287107.1\|9695_10946_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002317424.1\|11355_13728_+	hypothetical protein	B5SP25	Lactococcus_phage	1.8e-13	32.5
WP_002313123.1\|13788_15258_+	DUF3991 domain-containing protein	NA	NA	NA	NA
WP_002303486.1\|15268_17278_+	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	1.6e-111	52.6
WP_002299811.1\|17623_18220_+	transcriptional regulator	NA	NA	NA	NA
WP_002301800.1\|18232_19132_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_002301801.1\|19134_19266_+	single-stranded DNA-binding protein	A8ATZ7	Listeria_phage	1.3e-11	83.3
WP_002305808.1\|19287_19620_+	single-stranded DNA-binding protein	W6LM61	Streptococcus_phage	6.1e-21	53.2
WP_002295625.1\|19641_19899_+	hypothetical protein	NA	NA	NA	NA
WP_002295624.1\|20057_20180_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_002305809.1\|20369_20594_+	hypothetical protein	NA	NA	NA	NA
WP_002305810.1\|21036_21243_+	hypothetical protein	NA	NA	NA	NA
WP_002300797.1\|21242_21494_+	hypothetical protein	NA	NA	NA	NA
WP_002300801.1\|21674_21947_+	hypothetical protein	NA	NA	NA	NA
WP_002300804.1\|22391_22571_+	hypothetical protein	NA	NA	NA	NA
WP_002311569.1\|22629_22986_+	hypothetical protein	NA	NA	NA	NA
WP_000222572.1\|23954_24908_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.7e-34	35.8
WP_002300807.1\|25028_25292_+\|bacteriocin	circular bacteriocin, circularin A/uberolysin family	NA	NA	NA	NA
WP_000997695.1\|25663_26842_+\|transposase	IS256-like element ISEf1 family transposase	A0A220NQR7	Corynebacterium_phage	3.0e-30	25.6
WP_002300833.1\|27230_29177_+	PRD domain-containing protein	NA	NA	NA	NA
WP_002300835.1\|29179_29635_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002300836.1\|29648_30977_+	PTS galactitol transporter subunit IIC	NA	NA	NA	NA
WP_002300838.1\|31010_31295_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002300840.1\|31296_31812_+	YjbQ family protein	NA	NA	NA	NA
WP_002300841.1\|31827_32490_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_002300842.1\|32496_33069_+	SIS domain-containing protein	NA	NA	NA	NA
WP_002300843.1\|33255_34776_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.1e-48	31.6
WP_002305884.1\|35018_35204_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_002300846.1\|35187_35370_-	hypothetical protein	NA	NA	NA	NA
WP_002301839.1\|36323_36923_+\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	1.3e-29	36.1
WP_002322465.1\|36986_37586_+	hypothetical protein	NA	NA	NA	NA
WP_002292418.1\|38601_39474_-	ROK family protein	NA	NA	NA	NA
WP_000195429.1\|39666_40839_+\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
WP_002293868.1\|41069_43016_-	PTS beta-glucoside transporter subunit IIBCA	NA	NA	NA	NA
WP_002302078.1\|43200_44640_+	sucrose-6-phosphate hydrolase	S6ATV4	Bacillus_phage	1.4e-16	25.1
WP_002302077.1\|44641_45604_+	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.3e-20	25.8
WP_086953894.1\|45773_47200_-\|transposase	IS3-like element ISEfa10 family transposase	A0A1B1P773	Bacillus_phage	2.3e-48	40.2
WP_002301718.1\|47442_47898_+\|transposase	IS200/IS605 family transposase	I4AZI8	Saccharomonospora_phage	1.3e-13	31.6
WP_002317441.1\|48576_49896_-\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	6.9e-209	82.5
WP_002311711.1\|50167_50398_-	resolvase	NA	NA	NA	NA
WP_002289254.1\|50627_51446_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002289253.1\|51606_52296_+	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_002289252.1\|52309_53812_+	PTS glucose transporter subunit IIBC	NA	NA	NA	NA
WP_002287107.1\|53947_55198_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002300328.1\|55607_56084_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
53809:55599	attR	NA	NA	NA	NA
WP_106913781.1\|56180_56381_-	hypothetical protein	NA	NA	NA	NA
WP_127843772.1\|56581_57696_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.5e-79	51.3
WP_002287870.1\|58860_59379_+	ClbS/DfsB family four-helix bundle protein	NA	NA	NA	NA
WP_002301591.1\|61454_62540_+	tyrosine recombinase XerS	NA	NA	NA	NA
WP_000222572.1\|62647_63601_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.7e-34	35.8

DBSCAN-SWA_2

69706 : 198684

109

Streptococcus_phage(37.78%)

integrase,transposase

attL 134405:134464|attR 151100:151346

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_141655267.1\|69706_70821_-\|transposase	IS3-like element IS1485 family transposase	A0A2I7SC85	Paenibacillus_phage	1.1e-79	51.3
WP_002322511.1\|71089_71365_+	hypothetical protein	NA	NA	NA	NA
WP_002287937.1\|71496_72924_+\|transposase	IS1182-like element ISEfa12 family transposase	A0A1X9I5T2	Streptococcus_phage	4.4e-124	47.8
WP_002287522.1\|73131_73536_+\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
WP_002330559.1\|73552_74701_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	1.0e-200	91.0
WP_002317307.1\|74940_76326_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002317308.1\|76338_77679_-	glycoside hydrolase family 32 protein	S6ATV4	Bacillus_phage	1.4e-10	23.3
WP_002322539.1\|77832_78687_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_002322538.1\|78761_80882_+	family 10 glycosylhydrolase	NA	NA	NA	NA
WP_002317311.1\|80874_81339_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_096157807.1\|81649_82812_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	5.9e-79	50.9
WP_096157805.1\|83069_84408_+\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-78	52.7
WP_002297185.1\|86244_87540_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A1S5SBP9	Streptococcus_phage	5.3e-44	29.8
WP_002287522.1\|87935_88340_+\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
WP_002287525.1\|88356_89505_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	1.2e-204	93.4
WP_002313174.1\|89778_90039_-	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|90194_91373_+\|transposase	IS256-like element ISEf1 family transposase	A0A220NQR7	Corynebacterium_phage	3.0e-30	25.6
WP_002300494.1\|91462_92782_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_002285815.1\|92778_93432_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.0e-24	33.2
WP_010729615.1\|93719_94994_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.7e-55	36.1
WP_032494987.1\|95048_96614_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	2.4e-19	31.6
WP_002288609.1\|96973_97906_-	hypothetical protein	NA	NA	NA	NA
WP_002288608.1\|97945_99607_-	hyaluronate lyase	NA	NA	NA	NA
WP_002305865.1\|99603_102585_-	glycoside hydrolase family 42	L0N6M2	Herpes_simplex_virus	2.2e-122	28.8
WP_002304880.1\|102712_104626_-	beta-N-acetylhexosaminidase	NA	NA	NA	NA
WP_002304878.1\|104655_105267_-	DUF624 domain-containing protein	NA	NA	NA	NA
WP_002304876.1\|105318_106791_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_002289655.1\|106814_107726_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002304874.1\|107737_108676_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_002304873.1\|108904_110479_+	ATP-binding protein	Q9EYF3	Enterobacteria_phage	1.6e-10	30.0
WP_002302980.1\|110456_111185_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_002340466.1\|111567_112842_-\|transposase	ISL3-like element IS1476 family transposase	A0A1S5SBP9	Streptococcus_phage	2.3e-55	36.4
WP_002302261.1\|113064_114096_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.8e-26	34.6
WP_002304872.1\|114102_114933_-	hypothetical protein	NA	NA	NA	NA
WP_033605953.1\|114929_115736_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_002302267.1\|115741_116566_-	type I phosphodiesterase/nucleotide pyrophosphatase	NA	NA	NA	NA
WP_002302268.1\|116555_117656_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_002302270.1\|117833_118619_+	histidinol phosphate phosphatase	NA	NA	NA	NA
WP_002317021.1\|118651_119035_+	hypothetical protein	NA	NA	NA	NA
WP_077828694.1\|119110_119242_+	hypothetical protein	NA	NA	NA	NA
WP_002322470.1\|119210_119447_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_002302275.1\|119524_120496_-	radical SAM protein	NA	NA	NA	NA
WP_002326809.1\|123052_124348_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A1S5SBP9	Streptococcus_phage	5.3e-44	29.5
WP_002296127.1\|124434_125982_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.7e-44	28.9
WP_002285758.1\|126425_126620_-	hypothetical protein	NA	NA	NA	NA
WP_002298085.1\|126929_128306_-	ABC transporter permease	NA	NA	NA	NA
WP_002298083.1\|128305_128962_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-22	32.1
WP_002301194.1\|128971_130249_-	ABC transporter permease	NA	NA	NA	NA
WP_111944785.1\|130498_131660_+\|transposase	IS3-like element ISEfa8 family transposase	A0A2I7SC85	Paenibacillus_phage	1.8e-80	54.2
WP_010706480.1\|132297_132648_-	hypothetical protein	NA	NA	NA	NA
WP_115250354.1\|133114_134276_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	5.9e-79	53.8
134405:134464	attL	NA	NA	NA	NA
WP_002305939.1\|135232_136192_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	4.5e-32	33.9
WP_002305121.1\|136178_136784_-	hypothetical protein	NA	NA	NA	NA
WP_002343836.1\|137023_138172_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	3.9e-200	90.8
WP_002287522.1\|138188_138593_-\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
WP_002301108.1\|138841_139396_-\|integrase	tyrosine-type recombinase/integrase	W8CYP1	Bacillus_phage	8.6e-36	46.1
WP_010706260.1\|139892_140801_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_002311756.1\|141222_141828_-	cell division protein Fic	NA	NA	NA	NA
WP_002317381.1\|142429_142729_-	hypothetical protein	NA	NA	NA	NA
WP_002302055.1\|142913_143867_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	9.6e-35	35.9
WP_002311759.1\|143979_144630_-	hypothetical protein	NA	NA	NA	NA
WP_002294762.1\|144729_145239_-	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	2.8e-17	34.8
WP_002301446.1\|145555_146119_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_002292292.1\|146133_147177_-	hypothetical protein	NA	NA	NA	NA
WP_002292291.1\|147324_147729_-	organic hydroperoxide resistance protein	NA	NA	NA	NA
WP_002292290.1\|147928_148177_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_060854031.1\|148296_149475_+\|transposase	IS256-like element ISEf1 family transposase	A0A220NQR7	Corynebacterium_phage	4.0e-30	25.6
WP_000997695.1\|150965_152144_-\|transposase	IS256-like element ISEf1 family transposase	A0A220NQR7	Corynebacterium_phage	3.0e-30	25.6
151100:151346	attR	NA	NA	NA	NA
WP_002343830.1\|152779_153658_-	hypothetical protein	NA	NA	NA	NA
WP_002343829.1\|153654_154614_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	8.8e-36	35.9
WP_002311502.1\|155457_156912_-	PTS sugar transporter	NA	NA	NA	NA
WP_069972708.1\|157190_158486_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.1e-54	37.2
WP_002289586.1\|158702_159545_-	PRD domain-containing protein	NA	NA	NA	NA
WP_002289584.1\|159581_161048_-	glycoside hydrolase family 1 protein	NA	NA	NA	NA
WP_002289583.1\|161102_162947_-	PTS beta-glucoside transporter subunit EIIBCA	NA	NA	NA	NA
WP_102829706.1\|163330_164017_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.7e-126	99.1
WP_002301682.1\|164577_165387_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002301683.1\|165386_166133_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002301684.1\|166150_166618_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002301685.1\|166617_167028_-	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_002301686.1\|167038_168052_-	SIS domain-containing protein	NA	NA	NA	NA
WP_002301687.1\|168268_169003_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002317374.1\|168986_169685_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002322453.1\|171077_171905_-	PRD domain-containing protein	NA	NA	NA	NA
WP_002311505.1\|172803_173436_-	HAD family phosphatase	A0A1D8KNV9	Synechococcus_phage	1.0e-08	28.4
WP_002343825.1\|173448_176172_-	PRD domain-containing protein	NA	NA	NA	NA
WP_002322451.1\|176287_177253_-	SIS domain-containing protein	NA	NA	NA	NA
WP_002298371.1\|177306_178119_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002298373.1\|178132_178906_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002298375.1\|178919_179390_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002343823.1\|179386_179803_-	hypothetical protein	NA	NA	NA	NA
WP_002311511.1\|180127_180970_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_002330559.1\|181319_182468_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	1.0e-200	91.0
WP_002287522.1\|182484_182889_-\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
WP_002311512.1\|183255_184680_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_002322527.1\|184679_185285_+	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	4.2e-20	34.6
WP_096948718.1\|185307_185987_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.1e-122	94.7
WP_002287937.1\|186184_187612_-\|transposase	IS1182-like element ISEfa12 family transposase	A0A1X9I5T2	Streptococcus_phage	4.4e-124	47.8
WP_002292681.1\|187756_188305_-	hypothetical protein	NA	NA	NA	NA
WP_002292680.1\|188305_189163_-	ParA family protein	F0PIG8	Enterococcus_phage	8.1e-33	30.7
WP_002292679.1\|189448_189736_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_002292678.1\|189725_190055_-	AbrB family transcriptional regulator	NA	NA	NA	NA
WP_002343821.1\|190227_190908_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.3e-126	98.7
WP_002290394.1\|191420_191738_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_002290397.1\|191738_191993_-	AbrB family transcriptional regulator	NA	NA	NA	NA
WP_029744575.1\|192754_192937_-	hypothetical protein	NA	NA	NA	NA
WP_002326809.1\|194508_195804_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A1S5SBP9	Streptococcus_phage	5.3e-44	29.5
WP_002326809.1\|195948_197244_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A1S5SBP9	Streptococcus_phage	5.3e-44	29.5
WP_002326809.1\|197388_198684_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A1S5SBP9	Streptococcus_phage	5.3e-44	29.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_CP014535

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 2729

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002311819.1\|403_967_+	hypothetical protein	NA	NA	NA	NA
WP_002354451.1\|953_1838_+	hypothetical protein	NA	NA	NA	NA
WP_000868795.1\|2231_2729_+	trimethoprim-resistant dihydrofolate reductase DfrG	G3MBI7	Bacillus_virus	4.0e-40	49.1

DBSCAN-SWA_2

8967 : 14106

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002311832.1\|8967_11331_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	6.0e-54	33.4
WP_002317408.1\|11648_12248_+	hypothetical protein	NA	NA	NA	NA
WP_002311835.1\|12359_12584_+	hypothetical protein	NA	NA	NA	NA
WP_002311837.1\|12935_13172_+	hypothetical protein	NA	NA	NA	NA
WP_002311838.1\|13251_14106_+	ParA family protein	A0A1X9I765	Streptococcus_phage	6.4e-30	31.4

DBSCAN-SWA_3

30223 : 32140

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002351219.1\|30223_32140_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	8.4e-30	27.6

DBSCAN-SWA_4

39453 : 40590

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002311861.1\|39453_40590_+	hypothetical protein	A0A1S5SEZ8	Streptococcus_phage	1.6e-52	39.3

DBSCAN-SWA_5

48789 : 49863

Brevibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002311873.1\|48789_49863_+	hypothetical protein	A0A0K2CPF9	Brevibacillus_phage	2.1e-17	36.5

DBSCAN-SWA_6

55303 : 63383

Streptococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287659.1\|55303_55657_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	5.7e-17	38.7
WP_002301317.1\|55758_57306_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.7e-44	28.9
WP_002305129.1\|58089_58467_-	antitoxin HicB	A0A1X9I5X0	Streptococcus_phage	6.9e-29	52.1
WP_002305130.1\|58512_58701_-	type II toxin-antitoxin system HicA family toxin	A0A1X9I5T5	Streptococcus_phage	1.7e-15	66.1
WP_002305131.1\|58871_59414_+	helix-turn-helix transcriptional regulator	Q9AZH9	Lactococcus_phage	3.8e-12	45.0
WP_002305840.1\|59608_60505_+	helix-turn-helix transcriptional regulator	Q9AZH9	Lactococcus_phage	9.1e-11	40.7
WP_002305133.1\|60553_61936_+	helix-turn-helix domain-containing protein	I3VYY8	Thermoanaerobacterium_phage	5.9e-09	32.2
WP_002305134.1\|61949_62732_+	helix-turn-helix domain-containing protein	A0A1X9I5A1	Streptococcus_phage	5.0e-05	35.2
WP_002305817.1\|62771_63383_+	recombinase family protein	A0A1V0E035	Clostridioides_phage	3.4e-17	39.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage