CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP017560	Sporosarcina ureilytica strain LMG 22257 chromosome, complete genome	2 crisprs	DEDDh,cas3,csa3,cas14j,cas14k,RT,WYL,c2c10_CAS-V-U3,DinG	0	0	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP017560_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017560_1

286804-286909

Orphan

Consensus_repeat	Method
TATTCCAAAAGTATGCAACGCTCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP017560_1

>merge|NZ_CP017560|1|286804-286909|CRISPRCasFinder
TATTCCAAAAGTATGCAACGCTCTCGGAAGGATGCAACGTATAGCTGGAAGTACACAACGCTGCGATGAAAGTACACAACACTATTTCAAAAGTATGCAACGCTCT

>NZ_CP017560|1|1|286804-286909|CRISPRCasFinder
TATTCCAAAAGTATGCAACGCTCT	CGGAAGGATGCAACGTATAGCTGGAAGTACACAACGCTGCGATGAAAGTACACAACAC
TATTTCAAAAGTATGCAACGCTCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017560.1\|WP_075526499.1\|287058_288249_-\|coenzyme-F420-0:L-glutamate-ligase	unknown	unknown	gnl\|CDD\|376711
NZ_CP017560.1\|WP_075526498.1\|284598_285363_-\|peptidoglycan-editing-factor-PgeF	unknown	unknown	gnl\|CDD\|376831
NZ_CP017560.1\|WP_075526493.1\|279915_280587_-\|DNA-alkylation-repair-protein	unknown	unknown	gnl\|CDD\|132880
NZ_CP017560.1\|WP_075526494.1\|280831_281044_-\|amphi-Trp-domain-containing-protein	unknown	unknown	gnl\|CDD\|275149
NZ_CP017560.1\|WP_082294931.1\|289501_289792_+\|phospholipase	unknown	unknown	gnl\|CDD\|285583
NZ_CP017560.1\|WP_082294930.1\|282231_283206_+\|acetyl-esterase	unknown	unknown	gnl\|CDD\|236660
NZ_CP017560.1\|WP_075529184.1\|284111_284546_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379326
NZ_CP017560.1\|WP_075526503.1\|291397_291979_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017560.1\|WP_075526495.1\|281225_281843_+\|CoA-pyrophosphatase	unknown	unknown	gnl\|CDD\|239518
NZ_CP017560.1\|WP_082294932.1\|292928_294203_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341035
NZ_CP017560.1\|WP_075526500.1\|288372_289263_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP017560.1\|WP_075526508.1\|295784_296429_+\|LytTR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|335768
NZ_CP017560.1\|WP_075526502.1\|290207_291386_+\|ParM/StbA-family-protein	unknown	unknown	gnl\|CDD\|212669
NZ_CP017560.1\|WP_075526497.1\|283250_284030_+\|nucleotidyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|313370
NZ_CP017560.1\|WP_155767443.1\|285564_286733_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP017560.1\|WP_075526504.1\|292177_292774_+\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|182340
NZ_CP017560.1\|WP_075526506.1\|294305_294938_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341358
NZ_CP017560.1\|WP_168157238.1\|281922_282084_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017560.1\|WP_075526507.1\|295084_295606_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017560.1\|WP_155767450.1\|278229_279557_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853

Protein	Function_ID	Function_description	E-value
NZ_CP017560.1\|WP_075526499.1\|287058_288249_-\|coenzyme-F420-0:L-glutamate-ligase	gnl\|CDD\|376711	pfam01996, F420_ligase, F420-0:Gamma-glutamyl ligase. F420-0:Gamma-glutamyl ligase (EC:6.3.2.-) is an enzyme involved in F420 biosynthesis pathway. It catalyzes the GTP-dependent successive addition of multiple gamma-linked L-glutamates to the L-lactyl phosphodiester of 7,8-didemethyl-8-hydroxy-5-deazariboflavin (F420-0). This reaction produces polyglutamated F420 derivatives. GTP + F420-0 + n L-glutamate -> GDP + phosphate + F420-n.	8.19392e-36
NZ_CP017560.1\|WP_075526498.1\|284598_285363_-\|peptidoglycan-editing-factor-PgeF	gnl\|CDD\|376831	pfam02578, Cu-oxidase_4, Multi-copper polyphenol oxidoreductase laccase. Laccases are multi-copper oxidoreductases able to oxidize a wide variety of phenolic and non-phenolic compounds and are widely distributed among both prokaryotes and eukaryotes. There are two main active catalytic sites with conserved histidines that are capable of binding four copper atoms.	6.8084e-64
NZ_CP017560.1\|WP_075526493.1\|279915_280587_-\|DNA-alkylation-repair-protein	gnl\|CDD\|132880	cd06561, AlkD_like, A new structural DNA glycosylase. This domain represents a new and uncharacterized structural superfamily of DNA glycosylases that form an alpha-alpha superhelix fold that are not belong to the identified five structural DNA glycosylase superfamilies (UDG, AAG/MNPG, MutM/Fpg and helix-hairpin-helix). DNA glycosylases removing alkylated base residues have been identified in all organisms investigated and may be universally present in nature. DNA glycosylases catalyze the first step in Base Excision Repair (BER) pathway by cleaving damaged DNA bases within double strand DNA to produce an abasic site. The resulting abasic site is further processed by AP endonuclease, phosphodiesterase, DNA polymerases, and DNA ligase functions to restore the DNA to an undamaged state. All glycosylase examined to date utilize a similar strategy for binding DNA and base flipping despite their structural diversity.	1.14875e-19
NZ_CP017560.1\|WP_075526494.1\|280831_281044_-\|amphi-Trp-domain-containing-protein	gnl\|CDD\|275149	TIGR04354, conserved_hypothetical_protein, amphi-Trp domain. This domain usually comprises most of the span of bacterial or archaeal proteins with a length of about 90 amino acids. Some members, however, are extended by one or two copies of domain pfam07411 in the C-terminal region. No residue in this domain is invariant. A striking feature of this domain is a C-terminal region that alternates strongly charged with strongly hydrophobic residues and usually ends with a Trp residue, e.g. LEIEIEW or FEIKVRW, suggesting an amphipathic beta strand structure. We suggest the name amphi-Trp for this domain. Some members of this function occur regularly in genomic contexts that include putative kinases of unknown specificity related to (but distinct from) HPr kinase, a Ser-specific protein kinase. The function is unknown.	7.56073e-07
NZ_CP017560.1\|WP_082294931.1\|289501_289792_+\|phospholipase	gnl\|CDD\|285583	pfam08398, Parvo_coat_N, Parvovirus coat protein VP1. This is the N-terminal region of the Parvovirus VP1 coat protein. Also see Parvovirus coat protein VP2 (pfam00740).	0.000115118
NZ_CP017560.1\|WP_082294930.1\|282231_283206_+\|acetyl-esterase	gnl\|CDD\|236660	PRK10162, PRK10162, acetyl esterase.	2.39325e-138
NZ_CP017560.1\|WP_075529184.1\|284111_284546_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379326	pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	4.83537e-19
NZ_CP017560.1\|WP_082294932.1\|292928_294203_+\|MFS-transporter	gnl\|CDD\|341035	cd17482, MFS_YxiO_like, Bacillus subtilis YxiO, Listeria monocytogenes BtlA, and similar transporters of the Major Facilitator Superfamily. This family is composed of Bacillus subtilis MFS-type transporter YxiO, and similar proteins including Listeria monocytogenes BtlA. The function of B. subtilis YxiO is still unknown, and L. monocytogenes BtlA is a putative secondary transporter involved in bile tolerance and general stress resistance. This family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.35931e-153
NZ_CP017560.1\|WP_075526495.1\|281225_281843_+\|CoA-pyrophosphatase	gnl\|CDD\|239518	cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative stress. CoAse has a conserved Nudix fold and requires a single divalent cation for catalysis. In addition to a signature Nudix motif G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val, CoAse contains an additional motif upstream called the NuCoA motif (LLTXT(SA)X3RX3GX3FPGG) which is postulated to be involved in CoA recognition. CoA plays a central role in lipid metabolism. It is involved in the initial steps of fatty acid sythesis in the cytosol, in the oxidation of fatty acids and the citric acid cycle in the mitochondria, and in the oxidation of long-chain fatty acids in peroxisomes. CoA has the important role of activating fatty acids for further modification into key biological signalling molecules.	2.67856e-58
NZ_CP017560.1\|WP_075526500.1\|288372_289263_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	2.11773e-49
NZ_CP017560.1\|WP_075526508.1\|295784_296429_+\|LytTR-family-transcriptional-regulator	gnl\|CDD\|335768	pfam04397, LytTR, LytTr DNA-binding domain. This domain is found in a variety of bacterial transcriptional regulators. The domain binds to a specific DNA sequence pattern.	9.68547e-33
NZ_CP017560.1\|WP_075526502.1\|290207_291386_+\|ParM/StbA-family-protein	gnl\|CDD\|212669	cd10227, ParM_like, Plasmid segregation protein ParM and similar proteins. ParM is a plasmid-encoded bacterial homolog of actin, which polymerizes into filaments similar to F-actin, and plays a vital role in plasmid segregation. ParM filaments segregate plasmids paired at midcell into the individual daughter cells. This subfamily also contains Thermoplasma acidophilum Ta0583, an active ATPase at physiological temperatures, which has a propensity to form filaments.	3.97397e-43
NZ_CP017560.1\|WP_075526497.1\|283250_284030_+\|nucleotidyltransferase-domain-containing-protein	gnl\|CDD\|313370	pfam10127, Nuc-transf, Predicted nucleotidyltransferase. Members of this family of bacterial proteins catalyze the transfer of nucleotide residues from nucleoside diphosphates or triphosphates into dimer or polymer forms.	3.31918e-88
NZ_CP017560.1\|WP_155767443.1\|285564_286733_+\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	3.70495e-57
NZ_CP017560.1\|WP_075526504.1\|292177_292774_+\|SAM-dependent-methyltransferase	gnl\|CDD\|182340	PRK10258, PRK10258, biotin biosynthesis protein BioC; Provisional.	5.0249e-05
NZ_CP017560.1\|WP_075526506.1\|294305_294938_-\|CBS-domain-containing-protein	gnl\|CDD\|341358	cd02205, CBS_pair_SF, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains superfamily. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	9.77488e-10
NZ_CP017560.1\|WP_155767450.1\|278229_279557_+\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	3.41423e-38

>NZ_CP017560.1|WP_155767443.1|285564_286733_+|IS3-family-transposase
MLKRNRYSSEVKWAVVKDKLSGNFTDKEILERHGIKNRAQIASWMKWYKNNETYRFDQPIGQQYAYGFRYDFKNGQERQDHQLSQLKMENEVLKKVFRDKKGVGKEEVIRTVEEMKGKYTITSILSALQVPRSNYYRWLGEEREKSLSTKEEAIIELCKKTKYRYGHRKIKALLKKEYGIRLNRNTVQSIMQKHNVQCRVKPKRKWKSQGETVVIRPNLLNRHFTASAPNEKWVTDITYIQYGSKTKYLSTIMDLYNNEIVAYKLYDHQQTSLVIDTLKGALEARNNPEGVIIHCDQGTVYTSYAFQDYVTANHLVCSMSRRGNCWDNAVIESFHSSLKSEEFQYVKFNSLSNAEVTKRVTDYLNYYNEERIQEKLGYLSPREYFVEAA
>NZ_CP017560.1|WP_075526498.1|284598_285363_-|peptidoglycan-editing-factor-PgeF
MKIKKYFTNSNVLAGTTLKNDSVPELNNMALHTCQQADVVLENRQQLANFLGVPLSDFVSANQTHSANFYRVTNEDKGRGAHELDTAIPNTDALYTYEPNIILCSFTADCVPVMFYHETNGLIGVIHSGWQGTIKEITLKLFQHLKTEEKCQLEKVHVQIGMALSQEKFEVDEDVYTKFKDLGYADVFMYFNKETNKYHIDNQLVVKKQCELAGIPTDQIFVDRTCTFVNEEGFSYRQDKKCGRHLSFMMRENE
>NZ_CP017560.1|WP_075529184.1|284111_284546_-|GNAT-family-N-acetyltransferase
MRIDKITSEDELTTAFTIRKAVFVEEQGVPLADEYDEFDKLSAPCEHVLVYHNDTPVGTGRVRWVDDFGKLERISILENYRSLGLGKAIIGALEEIAKENGIERVKLHGQTHAEGFYHKLGYETGSPVFMEDGIPHVLMKKVLA
>NZ_CP017560.1|WP_075526497.1|283250_284030_+|nucleotidyltransferase-domain-containing-protein
MNELIRKKIIEIEVRFQVKILYAVESGSRAWGIHSNDSDYDVRFIYIHQPNWYLSIDRQGVGAKRDVIELPINDILDISGWEITKALRLFRKSNPTLLEWLRSDNIYRQNSSLATQLRVLEPETFNPTASLHHYLNMAKNNYRLYLQKSEIKNCLYAIRSILACKWIEENKTPPPIRFNDLVEASVPKGQFRNIIEHLAERKMAGNESEKEVSISIMNECLESEISRIETYIQTVFVEVEDSTKKLDELFRNVLKEVYQ
>NZ_CP017560.1|WP_082294930.1|282231_283206_+|acetyl-esterase
MKMNKLNVYEMMTPEMVETLNIQNKLVGDAFSTDVTYEKMRENYMNERKYWNEGGPEPKRTVNLHIEGPHGVIPIRMHYPEKRIGKGVIIYIHGGGFTVGNLDTHSKIMRLLMAETGAVVVGIDYRLAPEYKYPTQVEECVFLVEWLRSHAEKYGINQDDIALAGDSAGANLCLATALYIRDRQKDTSFIRSLLLYYGTYGLTDSMSMRLLGGDYDGLSREDLNAYIKMYIGEEKQDLRYFDCFSNDLTEGLPPCYIAYGDLDPLQDDSKLLYDILNTHGQKAVLEEFKGVIHSFLHHSSIVPEAKEAIQSGASFYKSLETTNE
>NZ_CP017560.1|WP_168157238.1|281922_282084_-|hypothetical-protein
MICGSKCFLVEVALNGEKQIKRVRARTPVSARKVIRRKYGYEVVILSSVEEKK
>NZ_CP017560.1|WP_075526495.1|281225_281843_+|CoA-pyrophosphatase
MFLDKLKDRLNEKQSQFIGEETAFRSAVLIPLVQVNGEWHILFEVRAFTMRKQPGDISFPGGKIDLTDPTPLAAALRETHEELGVNPETVTVIEELSPYIASPTFVIYPFVAVIDYNEIIPNYNKEEVEEVFTIPLKWLLNYEPYMHLVSVQPTPASDFPFEKIVNGADYEWGTRAIEEWFYDFEDYTIWGITARILKHFIECVE
>NZ_CP017560.1|WP_075526494.1|280831_281044_-|amphi-Trp-domain-containing-protein
MTNSENRRKEVLVDFEEKMSLENAATYFETIAKKLKEEGSFTLTHNGQTIEIKPSSTVELEIKVEIHCTV
>NZ_CP017560.1|WP_075526493.1|279915_280587_-|DNA-alkylation-repair-protein
MNENKCIEIKRSSKAENILSQINSKTKLGDLRKIAKDIKKDHELAMELWSTEEFLPRLLAILIMDKKLLSQDVLNKLDKDMQTHPFDERNNLMDWLMANQLTKDKKKITLMESWENSPSALQRRAFWYYQGRLRWTGQTPPDNTADLLSAIEANITQEEPEVQWAMNFTAGWIGVYDEKNRARCIKLGEKTGLYKDEIVSKGCTPSYLPEFITIEVNKRNKVQ
>NZ_CP017560.1|WP_155767450.1|278229_279557_+|IS3-family-transposase
MSKIIFNEIQRKQLESNPNVASVSDRAIQYNAEFKIRAVKKNMNGKGPTQIFMENGFNLDVIGAKKAQSAISRWKNTYKTLGEQGFLEERRGKGGTGRPSTKDISSEKKLEKAEARIKYLEAELELPKKARGTRKAGEEVILAPREKYALINEVIRKYQLKNMTRYLCALTGVSRSGYYAWLQNSEKHAIREEQDYQDYLLLRCIYDAFKGKIGYRGLYMALEELVVTPMNHKKILRLMRKYNFFAKVRRANPYKYIAKATQAHRTVPNHLNRAFNQDEPGKVYLTDITYLQYRNGQTAYLSCIKDVATREIVAYELSTSLKMGLVYRTLDKLEETLDGNIHPEAMIHSDQGVHYTHPEYQGRVKKIGLLQSMSRRGNCLDNAPMESFFGHFKDEVDYEEACNLRELREMIDEYLEHYNTTRKQWTLKKMTPAQYRSHLIAA
>NZ_CP017560.1|WP_075526499.1|287058_288249_-|coenzyme-F420-0:L-glutamate-ligase
MERVVGTVARGLRCPIINEGDHIEEIVVDSVLKASEVEGLQVNDRDIVAITESIVARAQGNYATIDHIAKDIEAKFGDDTIGVIFPILSRNRFGNCLRGIAKGAKKIVIMLSYPSDEVGNHLVDLDKLDEKGINPWVDVLTEKEFRELFGVNKHAFTGIDYIEYYKTLAAEFDTESEIIFSNKPETILEHTTSILACDVHSRERTKRILRKNGGQKVYSLDDILTESIDGSGYNEDYGLLGSNTATDDGMKLFPRDCQPVVDNIQKMLKEKTGKTVEVMVYGDGAFKDPVGKIWELADPVVSPAYTPGLDGTPNEIKLKYLADNNFAELRGDELKQAISEFIDSREDALADSLEAQGTTPRKLTDLIGSLADLTSGSGDKGTPIVFIQGYFDNFTK
>NZ_CP017560.1|WP_075526500.1|288372_289263_+|LysR-family-transcriptional-regulator
MVSKLDLYKIFCQVGESKSFSQAAKALYMTQPAVSQSIMQLERELDIRLFHRTPQGTFLTDEGKVLFEYANSALNLLNVGQEKMIEFKNLTAGELKIGVGDTISRYFLLPYLERFHNRYPNVKFKIENGTTSELCTFLKAGEVDIVVCNFPLADSALTLKPFIDVHDIFVCGEKYRHILTNPISYEELMKYPLIFLEPKSNSRQYVEKFILSKGVQIEPEFELGSHDLLLEFAKINLGIACVTKEFSQDYINKGIVSEVKTKEAIPKREIGVCYLESVPLSLAATRFVEMVESDNR
>NZ_CP017560.1|WP_082294931.1|289501_289792_+|phospholipase
MHRREHHGFRFCIFPGYNWCGPRCNGPSEPVNEIDAACKAHDKCYELYGDKCFCDEDFLRRLYPYIHERSQLGKHARLIYRYMKIQHQFTCRFGRY
>NZ_CP017560.1|WP_075526502.1|290207_291386_+|ParM/StbA-family-protein
MTESRIAAIDVGNDSLKAIFGKLEAELNIPNVIAQDIEDRPIIGIEELDKQDPTDGIHIRLHSPSLSDNNSIYRVGNLATKGNNPTELDPGSNKSEEDQTLVMLFAALALDAARDENKNVFKRSNNVIEATYTLGTGLPLREVKEGRDVGYRSQLLGSVHQVEFLVTPKYQGLKVNIKFEEVKVYPEGFAAFINLVMDNNLNVINKELIDKRILIQDIGGLSTDVAVIKDRKVDDDKAQGFNLGVSESLDAIREEIFSRYGVELDSRLDVVEIITKKNDRNHIMVRGSRTSVHDIVDRELLELAKKQYRHLRNVWQRNSQSEICYFIGGGSLILKDYLKALNNSLDGFNIDFFEDEKESVWMMANAYYKLISDFASKNQKVKQKEEKLVKTK
>NZ_CP017560.1|WP_075526503.1|291397_291979_+|hypothetical-protein
MKETGLKRGQPITFRIPSDTSDHVLKQLQTLRDVEKRNFSSKIAEFVINGVTDSLVKHREAITVPLPKGLTKAQRDWLKHEHSEALLGSIVYQLMSDPIRTSALFASLNSNALEVEDALYLQEEQTTIDDLEAERKIVIESKQDNGNSSSMTGNIEDDLDNIDWESFRTSSEPVETEEEESNPLGDFLAQMNK
>NZ_CP017560.1|WP_075526504.1|292177_292774_+|SAM-dependent-methyltransferase
MAELKYEQVLNIRTTGLREWRKETHYHRYEATPYKALDELFKVYKLERSDRVVDFGCGRGRVSFYIHNRFKIPVTGVEVNDLTFDEALDNKRSYRYIAKDIEAPIQFDYALAEQYDVSETDNVFYFFNPFSVDIFKKVVHNILNSVKVNNRPIDLILYYPTGSYKNFIAKNTPFKLMNKVKVPDARDRKEKFLVYRLA
>NZ_CP017560.1|WP_082294932.1|292928_294203_+|MFS-transporter
MEGGNWLRKFTKVENSWMMYDWANSAYSVIITTAVFPIFYKSVASSAGVSNADSTAYLGYAVAIATFILAMIGPILGSIADYEGLKKKFFFFFFAVGSLSTLSLAFVPEGNWIWLLIIYTITAVGFHGANIFYDAFLVDVTPANRMDNISARGFGLGYIGSAIPFIISIAIILLADSGVLPLSMTIATKLAFVITAIWWITFTIPMLKNVIQIHSVPRESSIIVGSFKRLGSTFKDIRKYRHVFLFLIAYFFYIDGVGTIISMSTAYGTDLGISATTLLIVLLVTQIVAAPFAVIYGRLSDKFTGKKMLYVGIGVYIIVCIYAFFMKTELDFWILAMLVATSQGGIQSLSRSYFAKLVPKEKSNEFFGFYNIFGKFASVMGPLLLGATTQITGSSSYGVFSLVLLFIVGGVILKFVPEQDAEVV
>NZ_CP017560.1|WP_075526506.1|294305_294938_-|CBS-domain-containing-protein
MFVRDLYLDLHEVVTVNNNQSVQDVYDTLKKSGYRCIPVVNEEGHYKGMVYKVHVMEDIYENNGAEKNNIDHLLKHHDLYIHQRSPFLNALLEIKALPFISVVEDGKLIGILTHNKVESVLEDAFGLHTGGINITISSIEAKGMIEKLTKTLRGENIEGMFTLDNGSVVARRVVITLESGKSEAEIQDIKDRLENNGFRILHIDYLESRQ
>NZ_CP017560.1|WP_075526507.1|295084_295606_-|hypothetical-protein
MRKGLLTVFVLLLSFMLVACSNDSSGESVVKDIKEKVHEYSVGSFEDDVTASITSHELIVNEKGKETAFDLPSDEFFVSIAPFVETTHPCAIHSLTGCQGELVEKEFDVLIQDEDGNVVVDETITSLENGFIDLWLPRDKNYQVKITHEDKTVESTISTFEGDNTCITTMQLT
>NZ_CP017560.1|WP_075526508.1|295784_296429_+|LytTR-family-transcriptional-regulator
MNQLSMGSLLDVMGELFSDEVSIAVSNTKEYIYYRPSKRVDLKINEGDLVKEGTLAYKAIVQNQKVSEFVNRNIFGVPYHGMAVPYYHEGQLAGCVLAIYPAYTDGKSVVTVKTQDGWCPISFKDVTYVEVKNRKTFVVGNGLIGTHKNTLQEFEYILPKDSFVRCHRSFIVNVHHIQEIFPDTHSTFLLAMKDGTKIPVSQSYSSYFRKLLGF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP017560_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017560_2

3374599-3374709

Orphan

Consensus_repeat	Method
TTCATGGGCGTTGCATACTTTCCTGATAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP017560_2

>merge|NZ_CP017560|2|3374599-3374709|CRISPRCasFinder
TTCATGGGCGTTGCATACTTTCCTGATAGCGTTGCTTACTTTCCGGAAAATGTTGCGATCTTTTTGATTTACGTTGTAAACTTTCATGGGCGTTGCATACTTTTCTGATAG

>NZ_CP017560|2|2|3374599-3374709|CRISPRCasFinder
TTCATGGGCGTTGCATACTTTCCTGATAG	CGTTGCTTACTTTCCGGAAAATGTTGCGATCTTTTTGATTTACGTTGTAAACT
TTCATGGGCGTTGCATACTTTTCTGATAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017560.1\|WP_075529110.1\|3367576_3368677_-\|3-isopropylmalate-dehydrogenase	unknown	unknown	gnl\|CDD\|234832
NZ_CP017560.1\|WP_075529107.1\|3364543_3365332_-\|aspartate-dehydrogenase	unknown	unknown	gnl\|CDD\|237342
NZ_CP017560.1\|WP_075529111.1\|3368804_3370352_-\|2-isopropylmalate-synthase	unknown	unknown	gnl\|CDD\|234864
NZ_CP017560.1\|WP_075529119.1\|3383412_3383646_-\|molybdopterin-converting-factor-subunit-1	unknown	unknown	gnl\|CDD\|340452
NZ_CP017560.1\|WP_075529109.1\|3366147_3367557_-\|3-isopropylmalate-dehydratase-large-subunit	unknown	unknown	gnl\|CDD\|235490
NZ_CP017560.1\|WP_075529115.1\|3379285_3380491_-\|butyryl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173847
NZ_CP017560.1\|WP_155767443.1\|3376136_3377305_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP017560.1\|WP_075529120.1\|3383638_3384088_-\|molybdenum-cofactor-biosynthesis-protein-MoaE	unknown	unknown	gnl\|CDD\|223391
NZ_CP017560.1\|WP_075529117.1\|3381831_3382842_-\|GTP-3',8-cyclase-MoaA	unknown	unknown	gnl\|CDD\|274250
NZ_CP017560.1\|WP_155767443.1\|3374757_3375926_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP017560.1\|WP_075529421.1\|3372105_3373818_-\|acetolactate-synthase-large-subunit	unknown	unknown	gnl\|CDD\|236076
NZ_CP017560.1\|WP_075529106.1\|3363374_3364280_-\|phosphotransferase-family-protein	unknown	unknown	gnl\|CDD\|270700
NZ_CP017560.1\|WP_075529113.1\|3371593_3372109_-\|acetolactate-synthase-small-subunit	unknown	unknown	gnl\|CDD\|183365
NZ_CP017560.1\|WP_075529114.1\|3377614_3379048_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143421
NZ_CP017560.1\|WP_075529116.1\|3380841_3381804_-\|D-glycerate-dehydrogenase	unknown	unknown	gnl\|CDD\|240626
NZ_CP017560.1\|WP_075529105.1\|3361702_3363046_-\|sodium:glutamate-symporter	unknown	unknown	gnl\|CDD\|223857
NZ_CP017560.1\|WP_075529121.1\|3384084_3384591_-\|molybdopterin-guanine-dinucleotide-biosynthesis-protein-B	unknown	unknown	gnl\|CDD\|224677
NZ_CP017560.1\|WP_075529118.1\|3382834_3383416_-\|molybdenum-cofactor-guanylyltransferase	unknown	unknown	gnl\|CDD\|133000
NZ_CP017560.1\|WP_075529108.1\|3365536_3366130_-\|3-isopropylmalate-dehydratase-small-subunit	unknown	unknown	gnl\|CDD\|179314
NZ_CP017560.1\|WP_075529112.1\|3370338_3371373_-\|ketol-acid-reductoisomerase	unknown	unknown	gnl\|CDD\|235491

Protein	Function_ID	Function_description	E-value
NZ_CP017560.1\|WP_075529110.1\|3367576_3368677_-\|3-isopropylmalate-dehydrogenase	gnl\|CDD\|234832	PRK00772, PRK00772, 3-isopropylmalate dehydrogenase; Provisional.	0
NZ_CP017560.1\|WP_075529107.1\|3364543_3365332_-\|aspartate-dehydrogenase	gnl\|CDD\|237342	PRK13303, PRK13303, aspartate dehydrogenase.	4.59497e-82
NZ_CP017560.1\|WP_075529111.1\|3368804_3370352_-\|2-isopropylmalate-synthase	gnl\|CDD\|234864	PRK00915, PRK00915, 2-isopropylmalate synthase; Validated.	0
NZ_CP017560.1\|WP_075529119.1\|3383412_3383646_-\|molybdopterin-converting-factor-subunit-1	gnl\|CDD\|340452	cd00754, Ubl_MoaD, ubiquitin-like (Ubl) domain found in molybdenum cofactor biosynthesis protein D (MoaD) and similar proteins. MoaD, also termed molybdopterin synthase sulfur carrier subunit, or MPT synthase subunit 1, or MPT synthase small subunit, or molybdopterin-converting factor small subunit, or molybdopterin-converting factor subunit 1, is a conserved small sulfur carrier protein that has beta-grasp ubiquitin-like (Ubl) fold involved in biosynthesis of the molybdenum cofactor (Moco), an essential cofactor of a diverse group of redox enzymes. MoaD is activated in an ATP-dependent manner by sulfurtransferases similar to the activation mechanism of ubiquitin-activating enzyme E1.	4.75307e-28
NZ_CP017560.1\|WP_075529109.1\|3366147_3367557_-\|3-isopropylmalate-dehydratase-large-subunit	gnl\|CDD\|235490	PRK05478, PRK05478, 3-isopropylmalate dehydratase large subunit.	0
NZ_CP017560.1\|WP_075529115.1\|3379285_3380491_-\|butyryl-CoA-dehydrogenase	gnl\|CDD\|173847	cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases. Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers.	2.48398e-156
NZ_CP017560.1\|WP_155767443.1\|3376136_3377305_-\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	3.70495e-57
NZ_CP017560.1\|WP_075529120.1\|3383638_3384088_-\|molybdenum-cofactor-biosynthesis-protein-MoaE	gnl\|CDD\|223391	COG0314, MoaE, Molybdopterin converting factor, large subunit [Coenzyme metabolism].	3.41217e-55
NZ_CP017560.1\|WP_075529117.1\|3381831_3382842_-\|GTP-3',8-cyclase-MoaA	gnl\|CDD\|274250	TIGR02666, Cyclic_pyranopterin_monophosphate_synthase, molybdenum cofactor biosynthesis protein A, bacterial. The model for this family describes molybdenum cofactor biosynthesis protein A, or MoaA, as found in bacteria. It does not include the family of probable functional equivalent proteins from the archaea. MoaA works together with MoaC to synthesize precursor Z from guanine. [Biosynthesis of cofactors, prosthetic groups, and carriers, Molybdopterin].	2.55762e-158
NZ_CP017560.1\|WP_155767443.1\|3374757_3375926_-\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	3.70495e-57
NZ_CP017560.1\|WP_075529421.1\|3372105_3373818_-\|acetolactate-synthase-large-subunit	gnl\|CDD\|236076	PRK07710, PRK07710, acetolactate synthase large subunit.	0
NZ_CP017560.1\|WP_075529106.1\|3363374_3364280_-\|phosphotransferase-family-protein	gnl\|CDD\|270700	cd05151, ChoK-like, Choline Kinase and similar proteins. This subfamily is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC), and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. Bacterial ChoK is also referred to as licA protein. ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major phospholipid, phosphatidylethanolamine (PtdEtn). Unlike ChoK, ETNK shows specific activity for its substrate and displays negligible activity towards N-methylated derivatives of Etn. ChoK plays an important role in cell signaling pathways and the regulation of cell growth. The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	6.6689e-52
NZ_CP017560.1\|WP_075529113.1\|3371593_3372109_-\|acetolactate-synthase-small-subunit	gnl\|CDD\|183365	PRK11895, ilvH, acetolactate synthase 3 regulatory subunit; Reviewed.	4.10384e-71
NZ_CP017560.1\|WP_075529114.1\|3377614_3379048_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143421	cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like. Succinate-semialdehyde dehydrogenase, mitochondrial (SSADH, GabD, EC=1.2.1.24) catalyzes the NAD+-dependent oxidation of succinate semialdehyde (SSA) to succinate. This group includes the human aldehyde dehydrogenase family 5 member A1 (ALDH5A1) which is a mitochondrial homotetramer that converts SSA to succinate in the last step of 4-aminobutyric acid (GABA) catabolism. This CD also includes the Arabidopsis SSADH gene product ALDH5F1. Mutations in this gene result in the accumulation of H2O2, suggesting a role in plant defense against the environmental stress of elevated reactive oxygen species.	0
NZ_CP017560.1\|WP_075529116.1\|3380841_3381804_-\|D-glycerate-dehydrogenase	gnl\|CDD\|240626	cd05301, GDH, D-glycerate dehydrogenase/hydroxypyruvate reductase (GDH). D-glycerate dehydrogenase (GDH, also known as hydroxypyruvate reductase, HPR) catalyzes the reversible reaction of (R)-glycerate + NAD+ to hydroxypyruvate + NADH + H+. In humans, HPR deficiency causes primary hyperoxaluria type 2, characterized by over-excretion of L-glycerate and oxalate in the urine, possibly due to an imbalance in competition with L-lactate dehydrogenase, another formate dehydrogenase (FDH)-like enzyme. GDH, like FDH and other members of the D-specific hydroxyacid dehydrogenase family that also includes L-alanine dehydrogenase and S-adenosylhomocysteine hydrolase, typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann-fold NAD+ binding form, despite often low sequence identity. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. While many members of this family are dimeric, alanine DH is hexameric and phosphoglycerate DH is tetrameric.	1.42892e-180
NZ_CP017560.1\|WP_075529105.1\|3361702_3363046_-\|sodium:glutamate-symporter	gnl\|CDD\|223857	COG0786, GltS, Na+/glutamate symporter [Amino acid transport and metabolism].	2.16451e-44
NZ_CP017560.1\|WP_075529121.1\|3384084_3384591_-\|molybdopterin-guanine-dinucleotide-biosynthesis-protein-B	gnl\|CDD\|224677	COG1763, MobB, Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism].	4.72281e-27
NZ_CP017560.1\|WP_075529118.1\|3382834_3383416_-\|molybdenum-cofactor-guanylyltransferase	gnl\|CDD\|133000	cd02503, MobA, MobA catalyzes the formation of molybdopterin guanine dinucleotide. The prokaryotic enzyme molybdopterin-guanine dinucleotide biosynthesis protein A (MobA). All mononuclear molybdoenzymes bind molybdenum in complex with an organic cofactor termed molybdopterin (MPT). In many bacteria, including Escherichia coli, molybdopterin can be further modified by attachment of a GMP group to the terminal phosphate of molybdopterin to form molybdopterin guanine dinucleotide (MGD). This GMP attachment step is catalyzed by MobA, by linking a guanosine 5'-phosphate to MPT forming molybdopterin guanine dinucleotide. This reaction requires GTP, MgCl2, and the MPT form of the cofactor. It is a reaction unique to prokaryotes, and therefore may represent a potential drug target.	8.32289e-54
NZ_CP017560.1\|WP_075529108.1\|3365536_3366130_-\|3-isopropylmalate-dehydratase-small-subunit	gnl\|CDD\|179314	PRK01641, leuD, 3-isopropylmalate dehydratase small subunit.	2.86325e-114
NZ_CP017560.1\|WP_075529112.1\|3370338_3371373_-\|ketol-acid-reductoisomerase	gnl\|CDD\|235491	PRK05479, PRK05479, ketol-acid reductoisomerase; Provisional.	0

>NZ_CP017560.1|WP_075529421.1|3372105_3373818_-|acetolactate-synthase-large-subunit
MKNDKEKQLNDGSAVLIQALKDQEVEIIFGYPGGAVLPIYDALYKNPISHVLARHEQGAIHAAEGYARVSGKPGVVIATSGPGATNLVTGITDAMMDSLPLVIFTGQVAQEVIGTDAFQEADIIGITQPITKHNYQVNDINDLPRIIKEAFHIASTGRRGPVLVDIPKNIATDLFEPVDVESKAVEVNLPGYQPTTKPNFLQIQKAASAISEAKKPLLLGGAGILHAQAMEEFKTFVERHRIPVVNTLLGLGSIHGEHELFLGMAGMHGTYTANMAINDCDLLVNIGARFDDRLTGNLQKFAPNAKVIHIDIDPAEIGKNVPTEIPIVADAKEALSELLKQEFSSPNTEEWVAHLKKSAEEYPLWYKEDDSCLLPQQAVQLIHRITEGDAIVTTDVGQHQMWAAQYYSLNNPDHWVTSGGLGTMGFGFPAAIGAQLAKPNAKVVSIVGDAGFQMTAQELSLLQELRIPVKVVILNNESLGMVRQWQETFYEERYSESLIPVQPDFVKLAEAYDLKGYRINSAEEAEAIFKEALLSDEPVVIDCRVKQLENVYPMVAPGKGLSEMIGVRGE
>NZ_CP017560.1|WP_075529113.1|3371593_3372109_-|acetolactate-synthase-small-subunit
MKRVITVTVINQSGVLNRVTGLLMKRQFNIESITVGHTEQYGMSKMTFIVHVEDERKIEQLVKQLQKQIDVIKVDDITDKAIVMRELALIKVVSPPHMRSEMNSIVEPFRATVIDTGKNVITYQVTGNPEKIEAFIDLIKPYGIKELTRTGATAFVRETQKTHIPQLSILK
>NZ_CP017560.1|WP_075529112.1|3370338_3371373_-|ketol-acid-reductoisomerase
MAKMYYNDNINEGVLQDKKVAIIGYGSQGHAHAQNLKDSGFDVVVGVRPGKSFDAAKEDGLQVATVKEAAEQADLVMVLLPDERQKKVYEEEIEPVLTEGKSLVFAHGFNVHFGEIKPPANVDVFLVAPKGPGHLVRRTYEAGAGVPALFAVYQDASGQAKDVALAYAKGIGSARAGVLETTFKEETETDLFGEQAVLCGGTTALVKAGYETLVEAGYQPELAYFETLHELKLIVDLMYEGGLSGMRYSISDTAQWGDYVAGDRIIDAGTKDRMKELLAEIQSGEFAKGWIKENAEGRPNFNAITEKEEQHSIEKVGEKLRDMMPFVNASKKQQEKEVVASAKN
>NZ_CP017560.1|WP_075529111.1|3368804_3370352_-|2-isopropylmalate-synthase
MRKIDIFDTTLRDGEQAAGINLNTAEKLEIARQLERFGATIIEAGFPASSPGDFEAVQRIANTVKNSKVTGLARTVKKDIDTSWEALKGAEQPHIHIFLATSPIHMEYKLKKSPEEVVELAVEAVKYARKKFPLVQWSAEDAFRSDPEFLVHIVNKVIAAGATTINIPDTVGYATPVEYGALFKYLKENVTGIDNVKLSAHCHNDLGMATANTIAAIENGADQIEGTINGIGERAGNVALEEIAVALHIRKDIYGFETDVNLQEIKRTSQLVSQLTGVVIQPNKAIVGKNAFAHESGIHQDGMLKNPETYEIITPELIGEKAVPLALGKHSGRHAFKDRSISMGFDLSEEKLNEAFVAFKELADRKKEITEDDLFVLFTDQQIESGDTPVYELTNVQVQYGTANIPTATVSAIAPNGETISKAATGSGSVEAIFNTLEELVQGKVHILDYRVTSIGKGRDALGEALVNLSYNGQVSTGRDVAQDVLEASAKAYLNAINRQLIKADVRVKAAPVTS
>NZ_CP017560.1|WP_075529110.1|3367576_3368677_-|3-isopropylmalate-dehydrogenase
MRKRIAVLPGDGIGPEVTEAAVKVLQVIGRRFKHTFDVEYGSIGGEAIDKYKMPLPDETIELCQQSDAILLGAVGGPKWDKNPSELRPEKGLLAIRKHFDLFANLRPVIAVPSLLKASPLKEEVVKDVDLMIVRELTGGLYFGEPSKRTEKAAFDTLVYTKKEIERIVEKAFELARLRKGKVTSVDKENVLQSSKLWREVVEEKKKGYPDVEVEHMLVDSAAMQLVTNPCAFDVVVTENMFGDILSDEASVITGSLGVLPSASIRADGFGMYEPIHGTAPDIAGQGKANPAATILSVAMMLKYSFGLEEECAAIEEAVNAVFEDGFYTADLASPTDRVLSTNEWTDKVVDELDLQSVCNDIMHAYI
>NZ_CP017560.1|WP_075529109.1|3366147_3367557_-|3-isopropylmalate-dehydratase-large-subunit
MPKTIIEKIWNKHIVHEEQGKPDLLYIDLHLLHEVTSPQAFEGLRLANRKVRRPDLCFATMDHNVPTRNLPVISDPIAKKQVTTLQKNCDEFGVPLANMDHPDQGIVHIIGPELGLTQPGKTIVCGDSHTSTHGAFGAIAFGIGTSEVEHVLSTQTLWQARPKTMEVRINGELGFGVTAKDIILAIIAKFGIDMGTGHIIEYTGEAIRNLSMEERMTVCNMSIEAGAKAGLISPDETTISYLKGRRHVPTGEAFEKAAAEWLALATDEGATYDTVVEIDANEIEPFVTWGTNPSMGSGISNRVPSVDDYTTASDKEALTKALDYMGLEQGMPLTSIDIQHVFIGSCTNARLSDLRAAAKVVEGKKVHDSVTAIVVPGSRTVKKQAEEEGLDKVFLDAGFEWRESGCSMCLAMNDDVVPAGERCASTSNRNFEGRQGAGSRTHLMSPAMAAAAAIAGRFVDVRELNVAHA
>NZ_CP017560.1|WP_075529108.1|3365536_3366130_-|3-isopropylmalate-dehydratase-small-subunit
MEPINKVKSVIAPLNRTNVDTDQIISKEFLKRIERTGFGRFLFYHWRHDAEGNENKDFVLNDERFKDANILVAHENFGCGSSREHAPWSILDYGFKVVIAPSFADIFYSNCMKNGLLPIRLAVSEVEQLLEKGQGAAYSVEVNLEEQTVTTEDGDTYEFSIDPYYKKMLLNGWDEIELTFQYEDKIRAYEEKLARTV
>NZ_CP017560.1|WP_075529107.1|3364543_3365332_-|aspartate-dehydrogenase
MKIGLIGCGSIGQFLLEKINKDKLFPHYKVSAVFDAREKSVAKLKELSEQYQFESFQDLDAFLDSDIDVVVECANIQFVNDYATKIVERSDLLLISIGALANTYLYDEITSIAKTNGNKVYLPAGAIGGLDIVKAANVMGGLHTVKLVSRKPSKALSGELIANETILFEGTAREAIEKFPKNANVAIALSLAGIGIEKTAVIIIADPNVDKNIHTIQVNGEFGQTEITISNNPSPTNPKTSYLTSLSILSALQSLKQQISIG
>NZ_CP017560.1|WP_075529106.1|3363374_3364280_-|phosphotransferase-family-protein
MRVEKLTGMVREALQLPNATVKNLGRVGGMTNLNYLVEIDSEPYIVRIPGHGTKSLINRVEEEQNLKLGSDLGINPELVYFNARTGLKITRKIENAQTLTRDTAKDEGMIVKAAEIFKKLHHSTKKMGNQFKLFEMMAHYESLALNADGDFYSGFEKVKAQIKELQYKFNAFSIIQTPCHIDPACSNFILDDEGKMYLIDWEYGGMFDPMWDVAAFALESGLSKSEEAKFHSYYFNREVTAEEQERILLHKIFQDYLWSLWTVFKEEKGDDFGLYGYRRFERAKTNIKLYHQFYEVKYNVQ
>NZ_CP017560.1|WP_075529105.1|3361702_3363046_-|sodium:glutamate-symporter
MDFSPWVLFTDIGLISLLLLLGTIIRAKVKFVQKMFLPASIIAGILALTFGPNGFGLLPFSDQMKTYPGILIAVIFGTLPLLSPRIDWKAIKTRVGSMWSYSQLAMVLMWGGGLLFAMLFLNPFWDGLHDGFGLLLAAGFVGGHGTAAAIGATFAQNGWEEATSLAMTSATVGIISAILIGILFIKRGSAKGDTSFLASFSDLPNELRTGLIPPGSRVKSETDTVSSISIDPYVFHLAIVTIIAMGGYYLSQLGALLLPSVVIPAFSLAFLVGLLVKKILNSTNTEKYVSTAVIDRISGSATDILVAFGIGSISISVVLDYAVPLLLLFVFGLLYAYLFFAVLSKRFFEHYWFEKGIFTWGWTTGTVAMGMALLRIVDPDSESKTLDDYGLAYIPIAPVEILLVTFAPLFVLNSQSWIFITLVFIFSLLIYGMAIKYKWLNRTSATK
>NZ_CP017560.1|WP_155767443.1|3374757_3375926_-|IS3-family-transposase
MLKRNRYSSEVKWAVVKDKLSGNFTDKEILERHGIKNRAQIASWMKWYKNNETYRFDQPIGQQYAYGFRYDFKNGQERQDHQLSQLKMENEVLKKVFRDKKGVGKEEVIRTVEEMKGKYTITSILSALQVPRSNYYRWLGEEREKSLSTKEEAIIELCKKTKYRYGHRKIKALLKKEYGIRLNRNTVQSIMQKHNVQCRVKPKRKWKSQGETVVIRPNLLNRHFTASAPNEKWVTDITYIQYGSKTKYLSTIMDLYNNEIVAYKLYDHQQTSLVIDTLKGALEARNNPEGVIIHCDQGTVYTSYAFQDYVTANHLVCSMSRRGNCWDNAVIESFHSSLKSEEFQYVKFNSLSNAEVTKRVTDYLNYYNEERIQEKLGYLSPREYFVEAA
>NZ_CP017560.1|WP_155767443.1|3376136_3377305_-|IS3-family-transposase
MLKRNRYSSEVKWAVVKDKLSGNFTDKEILERHGIKNRAQIASWMKWYKNNETYRFDQPIGQQYAYGFRYDFKNGQERQDHQLSQLKMENEVLKKVFRDKKGVGKEEVIRTVEEMKGKYTITSILSALQVPRSNYYRWLGEEREKSLSTKEEAIIELCKKTKYRYGHRKIKALLKKEYGIRLNRNTVQSIMQKHNVQCRVKPKRKWKSQGETVVIRPNLLNRHFTASAPNEKWVTDITYIQYGSKTKYLSTIMDLYNNEIVAYKLYDHQQTSLVIDTLKGALEARNNPEGVIIHCDQGTVYTSYAFQDYVTANHLVCSMSRRGNCWDNAVIESFHSSLKSEEFQYVKFNSLSNAEVTKRVTDYLNYYNEERIQEKLGYLSPREYFVEAA
>NZ_CP017560.1|WP_075529114.1|3377614_3379048_-|NAD-dependent-succinate-semialdehyde-dehydrogenase
MNEYLMYIDGNWVGESLQKLEVINPANKQLVGSVPVGGIEEANEAIDSAYDAFQTWSKTTAYERAAYLKRLHKLLLEHKEELAEVMTKEMGKPINESRGEVIYAASFIEWFAEEGKRVYGETVPSHMTEKRMQVWKKPVGVVAAITPWNFPIAMLTRKMGPALAAGCTIVIKPSGESPISAVKLVELCEKAGFPKGVVNLVTGSSSKIGQAIMENEKVRKVTFTGSTEVGKVLIKQSADQVKRLSLELGGHAPIIVLEDADLDIAVKGAMASKFRNTGQTCVCGNRIYVQAQVYEAFLEKFTEAVDALKVGDGMDEEVQIGPLINQKGVDKVASHVANAVQHGASIVTGGKGLTEKEGTFYAPTVLRDVTSDMLVMNEETFGPVAPVQKFETIEEVIKLANHTKYGLAAYVFTESVRKGTRLIEQLDYGIVGWNDGTPSAAQVPFGGMKESGIGREGGREGIEAFLETQYVSIGVES
>NZ_CP017560.1|WP_075529115.1|3379285_3380491_-|butyryl-CoA-dehydrogenase
MNFSFTEEQKMLRSTVRTFVDKEIMPHIAEWDRKGQSDPAIYTRLADLGLMGVCIPTEYGGSGMDYNSLAIVCEELERGDTAFRTAVSVHTGLNSLTLLQWGNEAQKQKYLVPQAEGKKIGAFGLTEPAAGSDVVALQTTAVKEGDYYILNGQKTWISLCDVADHFLVFAYTGNRSDKHKAISAFIVERTWEGFSSVATKGKLGIRAGNTGELFFEDVKVPKENLLGEEGEGFKIAMSALDSGRFTVAAGAVGQIMACMEASVKYCHERKTFGKDIGKHQLVQQMIANMEAGYQMSRLLVYRAGELKNAGERNTRETSLAKWQACDFANKAADDAVQIHGAYGYSDEYPVERYLRNSKAPVIYEGTREIHTVMQAEYVLGYREDKRLNKMLPAWQDNLINS
>NZ_CP017560.1|WP_075529116.1|3380841_3381804_-|D-glycerate-dehydrogenase
MKQTIFITRKLPEEAIQPLREKFTVRMWEEEEIEVPVDVLKKEVQQADALWTTISDQITKEIMMSAPNLKVIANLAVGFNNIDVEAAKELGITVTNTPDVLTETTADLAFALLLASARRITEAERVLRDGKWTSWAPMQLTGMDVFGATLGIIGMGRIGEAAAKRAKGFDMRVLYYNRTRKLDAEEKYGFSYAELDSLLQQSDFVLIFAPLTEETKNMIAKRELGLMKKTAILLNVARGGIVNEQDLYEALKNGDIWGAGLDVFETEPVPLNHPLLTLPNVTVLPHIGSASIQTRLAMMKMNQQAIMDVLEGRVPRNVVV
>NZ_CP017560.1|WP_075529117.1|3381831_3382842_-|GTP-3',8-cyclase-MoaA
MSEMVDKLGRPIRDLRISVTDRCNFRCTYCMPKEVFGDDYAFLPKDQLLSFEEIERFAQIFADLGVKKLRITGGEPLMRKDISILVGKLLKIDGIEDVGLTTNAVLLRQHAQALYDAGLRRLNISLDALNPEIFGAINGRGVKPDFILSNIDFAQKIGFEIKVNMVVEKGVNESEIIPMATYFKERGIMLRFIEFMDVGNDNGWSFEKVVTKKEIYHMLREIYDIEPAEQHYYGEVAKRYRYQDNGAEVGFITSVSESFCSTCTRARLSSDGKLFTCLFASDGFDLKALIRSGKTDEALVEAIQNVWERRTDRYSDERTEQTAINRKKIGMGYIGG
>NZ_CP017560.1|WP_075529118.1|3382834_3383416_-|molybdenum-cofactor-guanylyltransferase
MKTVGIVLAGGLSRRFGSPKAFARMGNKYFYEYATAALAPHCDQIVIVTRPEHVEHFSNELHVITDDDRFTGLGPLAGIYSVMNIIAAKRYVILPCDMPYIEASVIEGLMPYRQEDVIAVKTSDTHHPLVSVWHWRVKEKLQQSLEQRRLSVMKFLKEVDILWVDGDGLTKHANKIFKNINYETDLERGEENE
>NZ_CP017560.1|WP_075529119.1|3383412_3383646_-|molybdopterin-converting-factor-subunit-1
MIKVHYFARLRELTGKSEETIDKDSMTVQQLLDWAEEKYPGFGKDMIHVAINEEYALKEDTIQTGDVCAFIPPVSGG
>NZ_CP017560.1|WP_075529120.1|3383638_3384088_-|molybdenum-cofactor-biosynthesis-protein-MoaE
MKPFEIVEGPIDIQKYADYVLHASAGAVTIFTGNVREWTHGVRTLYLSYEAYVPMAEKKMAEIGAEMEEKWPGIKVAIVHRIGELHISDIAVLIAVSSPHRQAAYAANEYAIERIKEVVPIWKKEIWEDGEEWIGAQKKYPTKGRKLND
>NZ_CP017560.1|WP_075529121.1|3384084_3384591_-|molybdopterin-guanine-dinucleotide-biosynthesis-protein-B
MGTMKTLHVVGFKNSGKTTLISRWVRLLKSEGMTVSVLKHHGHASLLNMPDENTDGMQFFKSGADLSLVAGAGTAQMLLNEEPSFAQLIDMATLNQPDVLLIEGYKNEQGCKVVLLRDDNDWQDLQQLSDIQFIIGHGKMELDVEVIDRSNEGQVDDWFLQWVKEDGL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1041268 : 1102019

Staphylococcus_phage(35.0%)

integrase,tRNA,holin,transposase

attL 1079656:1079671|attR 1101623:1101638

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075527152.1\|1041268_1042714_+	o-succinylbenzoate--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	3.2e-66	32.6
WP_075527153.1\|1042695_1043808_+	o-succinylbenzoate synthase	NA	NA	NA	NA
WP_075527154.1\|1043841_1044792_-	zinc ABC transporter solute-binding protein	NA	NA	NA	NA
WP_075527155.1\|1044933_1045167_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	5.4e-24	69.0
WP_075527156.1\|1045267_1045717_+	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	1.7e-42	57.5
WP_075527157.1\|1045775_1045958_+	putative motility protein	NA	NA	NA	NA
WP_082295159.1\|1046027_1046345_+\|transposase	transposase	NA	NA	NA	NA
WP_075527159.1\|1046392_1046854_+	NUDIX domain-containing protein	A0A2H4PQM4	Staphylococcus_phage	2.4e-15	38.1
WP_075527160.1\|1046843_1047647_+	S9 family peptidase	A0A2H4PQM6	Staphylococcus_phage	1.3e-32	39.5
WP_075527161.1\|1047698_1049285_-	phosphoenolpyruvate carboxykinase (ATP)	A0A2H4PQN1	Staphylococcus_phage	3.8e-193	63.2
WP_075527162.1\|1050379_1051576_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	2.3e-166	77.5
WP_082294963.1\|1051836_1052889_+	calcium/proton exchanger	NA	NA	NA	NA
WP_075527163.1\|1052937_1053213_-	hypothetical protein	NA	NA	NA	NA
WP_075527164.1\|1053271_1053784_-	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_075527165.1\|1053881_1054670_+	alpha/beta hydrolase	A0A0G3G493	Raccoon_poxvirus	4.4e-09	23.6
WP_075527166.1\|1054683_1055178_+	cupin domain-containing protein	NA	NA	NA	NA
WP_075527167.1\|1055279_1055822_+	signal peptidase I	NA	NA	NA	NA
WP_075529244.1\|1056057_1056462_+\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	1.7e-36	53.1
WP_075527168.1\|1056499_1057846_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A1L2BWW3	Bacteriophage	2.6e-46	32.7
WP_075527169.1\|1058206_1060357_+	ATP-dependent helicase	A0A1P8CWU5	Bacillus_phage	2.0e-35	26.3
WP_082294964.1\|1060360_1060738_+	CrcB family protein	NA	NA	NA	NA
WP_155767477.1\|1060710_1061091_+	fluoride efflux transporter CrcB	NA	NA	NA	NA
WP_075527172.1\|1061198_1061933_+	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_075529245.1\|1062135_1063113_+\|tRNA	tRNA-dihydrouridine synthase	NA	NA	NA	NA
WP_082294965.1\|1063231_1064353_-	hypothetical protein	NA	NA	NA	NA
WP_075527173.1\|1064395_1065544_-	hypothetical protein	NA	NA	NA	NA
WP_075527174.1\|1065808_1066387_+	hypothetical protein	A0A1P8CWK6	Bacillus_phage	2.6e-43	59.7
WP_075527175.1\|1066534_1067155_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_075527176.1\|1067628_1069017_+	Na+/H+ antiporter NhaC	NA	NA	NA	NA
WP_075527177.1\|1069246_1070239_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_075529248.1\|1070324_1071272_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_075527178.1\|1071301_1072042_-	ABC transporter permease	NA	NA	NA	NA
WP_075527179.1\|1072038_1072788_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-33	38.7
WP_075529247.1\|1072774_1073467_-	thiaminase II	NA	NA	NA	NA
WP_168157251.1\|1073823_1074348_-	isoprenylcysteine carboxyl methyltransferase	NA	NA	NA	NA
WP_075527180.1\|1074358_1075435_-	type III polyketide synthase	NA	NA	NA	NA
WP_075527181.1\|1075634_1076087_+	YaiI/YqxD family protein	NA	NA	NA	NA
WP_075527182.1\|1076411_1077389_+	proline dehydrogenase	A0A2H4PQT6	Staphylococcus_phage	5.3e-89	50.6
WP_075527183.1\|1077551_1078934_+	leucyl aminopeptidase family protein	Q6GYZ8	Mycoplasma_phage	4.6e-46	34.5
WP_075527184.1\|1079001_1079343_+	DUF3221 domain-containing protein	NA	NA	NA	NA
1079656:1079671	attL	NA	NA	NA	NA
WP_075527185.1\|1080210_1080687_+	hypothetical protein	NA	NA	NA	NA
WP_075527186.1\|1080866_1081289_+	hypothetical protein	NA	NA	NA	NA
WP_075527187.1\|1081593_1083051_+	hypothetical protein	NA	NA	NA	NA
WP_075527188.1\|1083229_1083427_+	hypothetical protein	NA	NA	NA	NA
WP_075527189.1\|1083502_1083772_+	hypothetical protein	NA	NA	NA	NA
WP_075527190.1\|1083875_1084205_+	hypothetical protein	NA	NA	NA	NA
WP_075527191.1\|1084350_1084635_+	hypothetical protein	NA	NA	NA	NA
WP_155767566.1\|1084925_1085423_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_075527193.1\|1085409_1086408_+	hypothetical protein	NA	NA	NA	NA
WP_075527194.1\|1086524_1087313_+	hypothetical protein	NA	NA	NA	NA
WP_075527195.1\|1087610_1088330_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	1.5e-35	40.8
WP_075527196.1\|1088326_1089832_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_075527197.1\|1089979_1090306_+	hypothetical protein	NA	NA	NA	NA
WP_075527198.1\|1090474_1091005_+	hypothetical protein	NA	NA	NA	NA
WP_075529251.1\|1091854_1093630_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.7e-32	27.1
WP_075527199.1\|1094128_1094971_+\|integrase	tyrosine-type recombinase/integrase	A0A0K2CP59	Brevibacillus_phage	5.0e-27	32.0
WP_075527200.1\|1095352_1096294_-	RNA methyltransferase	NA	NA	NA	NA
WP_075527201.1\|1096290_1096890_-	branched-chain amino acid aminotransferase	NA	NA	NA	NA
WP_155767478.1\|1097146_1098427_+	serine hydrolase	A0A1D8EXR7	Mycobacterium_phage	2.3e-15	25.8
WP_075529252.1\|1098429_1099143_+	gamma-glutamyl-gamma-aminobutyrate hydrolase family protein	NA	NA	NA	NA
WP_075527203.1\|1099146_1100073_+	membrane dipeptidase	NA	NA	NA	NA
WP_075527204.1\|1100126_1100390_-	DUF3006 domain-containing protein	NA	NA	NA	NA
WP_082294967.1\|1100393_1101521_-	MBL fold metallo-hydrolase	Q332B9	Clostridium_botulinum_C_phage	1.6e-44	37.1
WP_075527206.1\|1101671_1102019_-\|holin	phage holin family protein	NA	NA	NA	NA
1101623:1101638	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP017560

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection