CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP015956	Legionella pneumophila strain E9_O chromosome, complete genome	0 crisprs	RT,PD-DExK,DEDDh,DinG,cas3,WYL,csa3	0	0	5	0
NZ_CP015957	Legionella pneumophila strain E9_O plasmid unnamed1, complete sequence	1 crisprs	NA	0	3	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

873078 : 917720

Pseudomonas_phage(22.22%)

transposase,tRNA,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011213315.1\|873078_874374_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_126297583.1\|874412_874628_+	hypothetical protein	NA	NA	NA	NA
WP_010946524.1\|874723_875260_+\|transposase	transposase	NA	NA	NA	NA
WP_011213316.1\|875598_876765_+	DUF1574 family protein	NA	NA	NA	NA
WP_010946526.1\|876761_878204_+	MBOAT family protein	A0A125RNP0	Pseudomonas_phage	3.9e-72	40.5
WP_010947893.1\|878295_879702_+\|transposase	IS4-like element ISLpn6 family transposase	Q9JMP3	Wolbachia_phage	1.0e-72	34.1
WP_010946527.1\|879802_881179_-	L-serine ammonia-lyase	NA	NA	NA	NA
WP_011213317.1\|881383_882085_+	FKBP-type peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_011213318.1\|882250_883510_+	MFS transporter	NA	NA	NA	NA
WP_011213319.1\|885364_886015_+	lpg0796 family Dot/Icm T4SS effector	NA	NA	NA	NA
WP_010946534.1\|886294_886681_+	DUF3757 domain-containing protein	NA	NA	NA	NA
WP_010946535.1\|886784_888128_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_010946536.1\|888202_889852_-	L-aspartate oxidase	NA	NA	NA	NA
WP_010946537.1\|889848_891219_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	2.2e-112	49.7
WP_010946538.1\|891371_893075_+	sulfate permease	A0A2H4J153	uncultured_Caudovirales_phage	6.5e-42	26.5
WP_010946539.1\|893277_894981_-	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_010946540.1\|895210_896209_-	linear amide C-N hydrolase	NA	NA	NA	NA
WP_010946541.1\|896433_898821_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	7.0e-175	38.1
WP_010946542.1\|899062_900502_+	cation:proton antiporter	NA	NA	NA	NA
WP_010946543.1\|900498_901341_+	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_010946544.1\|901337_902429_+	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_010946545.1\|902403_903819_+	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_010946546.1\|903910_904228_+	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_011213320.1\|904423_905461_+	rod shape-determining protein	NA	NA	NA	NA
WP_010946548.1\|905438_906347_+	rod shape-determining protein MreC	NA	NA	NA	NA
WP_010946549.1\|906343_906823_+	rod shape-determining protein MreD	NA	NA	NA	NA
WP_011213321.1\|906758_907361_-	pseudouridine synthase	NA	NA	NA	NA
WP_010946551.1\|907621_908320_+	hypothetical protein	NA	NA	NA	NA
WP_011213322.1\|908429_909686_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	1.9e-14	74.1
WP_010946553.1\|910087_910423_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	5.8e-11	36.5
WP_011213323.1\|910454_912722_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	8.7e-167	42.1
WP_010946555.1\|913022_914108_+\|transposase	IS4-like element ISLpn9 family transposase	NA	NA	NA	NA
WP_010946556.1\|914133_914427_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_010946557.1\|914582_915362_+	glycosyltransferase family 2 protein	S5WBE2	Pseudomonas_phage	6.9e-07	30.8
WP_010946558.1\|915364_916615_+	O-antigen ligase family protein	NA	NA	NA	NA
WP_011213324.1\|916615_916951_-	hypothetical protein	NA	NA	NA	NA
WP_010946560.1\|917120_917720_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA

DBSCAN-SWA_2

928048 : 934888

Acinetobacter_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010946569.1\|928048_928825_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	3.3e-57	48.2
WP_010946570.1\|928817_929852_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	3.5e-75	47.6
WP_010946571.1\|929829_930408_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.0e-55	53.2
WP_010946572.1\|930441_931167_-	LPS export ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-17	28.3
WP_010946573.1\|931163_931673_-	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_010946574.1\|931653_932223_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_011213328.1\|932219_932747_-	3-deoxy-manno-octulosonate-8-phosphatase KdsC	A0A140XBD6	Dickeya_phage	1.4e-27	47.7
WP_010946576.1\|932760_933723_-	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	4.2e-38	34.1
WP_010946577.1\|934090_934888_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.3e-21	33.8

DBSCAN-SWA_3

1317616 : 1323553

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010946911.1\|1317616_1318690_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	2.8e-30	27.8
WP_010946912.1\|1318674_1319289_+	riboflavin synthase	A0A2I2L4R9	Orpheovirus	3.5e-22	38.4
WP_010946913.1\|1319285_1320494_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	5.4e-99	48.7
WP_010946914.1\|1320501_1320969_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	9.2e-23	49.1
WP_010946915.1\|1321094_1322732_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	3.6e-154	52.3
WP_010946916.1\|1322728_1323553_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	1.8e-53	43.9

DBSCAN-SWA_4

2227090 : 2237214

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010947735.1\|2227090_2228779_-	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	8.0e-16	30.4
WP_015444337.1\|2228910_2229918_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_010947737.1\|2230041_2231367_-	adenosylhomocysteinase	S4VPF6	Pandoravirus	1.4e-47	31.2
WP_010947738.1\|2231385_2232534_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.3e-126	58.5
WP_015444336.1\|2232742_2233855_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	2.9e-51	35.2
WP_010947740.1\|2233950_2235090_-	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	1.6e-23	26.9
WP_015444335.1\|2235279_2237214_-	molecular chaperone DnaK	G8DDB7	Micromonas_pusilla_virus	1.3e-147	49.6

DBSCAN-SWA_5

2279045 : 2334070

Wolbachia_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010947782.1\|2279045_2280497_+\|transposase	IS4-like element ISLpn5 family transposase	Q9JMP3	Wolbachia_phage	6.1e-158	56.8
WP_010947783.1\|2280567_2282088_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.9e-124	48.2
WP_010947785.1\|2282935_2283310_+	hypothetical protein	NA	NA	NA	NA
WP_010947786.1\|2283507_2285115_-	hypothetical protein	NA	NA	NA	NA
WP_015444248.1\|2285117_2285609_-	hypothetical protein	NA	NA	NA	NA
WP_010947788.1\|2285619_2286456_-	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S6L1V5	Vibrio_phage	4.9e-67	48.9
WP_010947789.1\|2287048_2288140_-	DUF4917 family protein	NA	NA	NA	NA
WP_010947790.1\|2288371_2294317_-	conjugative transfer relaxase/helicase TraI	NA	NA	NA	NA
WP_010947791.1\|2294337_2296230_-	type IV conjugative transfer system coupling protein TraD	NA	NA	NA	NA
WP_021437030.1\|2296294_2296759_+	hypothetical protein	NA	NA	NA	NA
WP_015444244.1\|2296762_2299483_-	conjugal transfer protein TraG N-terminal domain-containing protein	NA	NA	NA	NA
WP_010947793.1\|2299488_2300874_-	conjugal transfer protein TraH	NA	NA	NA	NA
WP_010947794.1\|2300870_2301293_-	type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB	NA	NA	NA	NA
WP_010947795.1\|2301282_2302065_-	type-F conjugative transfer system pilin assembly protein TraF	NA	NA	NA	NA
WP_010947796.1\|2302057_2303869_-	type-F conjugative transfer system mating-pair stabilization protein TraN	NA	NA	NA	NA
WP_015444243.1\|2303868_2304537_-	type-F conjugative transfer system pilin assembly protein TrbC	NA	NA	NA	NA
WP_010947798.1\|2304552_2305548_-	TraU family protein	NA	NA	NA	NA
WP_010947799.1\|2305544_2306153_-	type-F conjugative transfer system protein TraW	NA	NA	NA	NA
WP_015444242.1\|2306149_2306485_-	TrbI F-type domain-containing protein	NA	NA	NA	NA
WP_015444241.1\|2306477_2309030_-	type IV secretion system protein TraC	NA	NA	NA	NA
WP_010947801.1\|2309041_2309392_-	type IV conjugative transfer system lipoprotein TraV	NA	NA	NA	NA
WP_015444240.1\|2309405_2310692_-	TraB/VirB10 family protein	NA	NA	NA	NA
WP_010947803.1\|2310693_2311407_-	type-F conjugative transfer system secretin TraK	NA	NA	NA	NA
WP_010947804.1\|2311409_2311973_-	type IV conjugative transfer system protein TraE	NA	NA	NA	NA
WP_010947805.1\|2311976_2312270_-	type IV conjugative transfer system protein TraL	NA	NA	NA	NA
WP_010947806.1\|2312271_2312574_-	fimbrial protein	NA	NA	NA	NA
WP_010947807.1\|2312588_2312825_-	carbon storage regulator CsrA	A0A2I7RT00	Vibrio_phage	2.5e-08	52.9
WP_025520140.1\|2312838_2313216_-	hypothetical protein	NA	NA	NA	NA
WP_010947808.1\|2313163_2314048_-	hypothetical protein	NA	NA	NA	NA
WP_015444237.1\|2314220_2314901_+	helix-turn-helix domain-containing protein	A0A1I9KG86	Aeromonas_phage	1.6e-07	28.1
WP_016356978.1\|2315049_2315724_+\|transposase	transposase	NA	NA	NA	NA
WP_010947811.1\|2316172_2316745_+	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_015444236.1\|2316728_2317226_+	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_010947813.1\|2317218_2317806_-	CDP-alcohol phosphatidyltransferase family protein	NA	NA	NA	NA
WP_010947814.1\|2317810_2319946_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_010947815.1\|2319964_2320846_-	sterol desaturase family protein	NA	NA	NA	NA
WP_010947816.1\|2320952_2321099_-	hypothetical protein	NA	NA	NA	NA
WP_010947817.1\|2321290_2321467_+	MAPEG family protein	NA	NA	NA	NA
WP_010947818.1\|2321636_2322134_-	DoxX family protein	NA	NA	NA	NA
WP_010947819.1\|2322123_2322903_-	DUF2063 domain-containing protein	NA	NA	NA	NA
WP_010947820.1\|2322895_2323750_-	DUF692 domain-containing protein	NA	NA	NA	NA
WP_010947821.1\|2323764_2324058_-	DUF2282 domain-containing protein	NA	NA	NA	NA
WP_010947822.1\|2324247_2324769_-	hypothetical protein	NA	NA	NA	NA
WP_015444234.1\|2325073_2325532_-	hypothetical protein	NA	NA	NA	NA
WP_015444232.1\|2326105_2326333_-	hypothetical protein	NA	NA	NA	NA
WP_010947824.1\|2326490_2327012_-	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_010947825.1\|2327183_2327738_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_010947826.1\|2328171_2328372_+	ATP-dependent DNA helicase	NA	NA	NA	NA
WP_010947827.1\|2328465_2328849_+\|transposase	transposase	NA	NA	NA	NA
WP_010947828.1\|2328902_2329856_-	Abi family protein	A3QSC6	Clostridium_virus	4.8e-34	31.8
WP_015444229.1\|2330365_2331784_+\|transposase	IS4-like element ISLpn3 family transposase	Q9JMP3	Wolbachia_phage	2.3e-56	32.9
WP_010947829.1\|2331816_2332992_-\|transposase	ISL3 family transposase	A4PE56	Ralstonia_virus	5.2e-14	21.2
WP_010947830.1\|2333044_2334070_-\|transposase	IS481 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP015957

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015957_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015957_1

30708-30928

Orphan

Consensus_repeat	Method
AATGGTTCACAAACGGTTCAC	PILER-CR

3 spacers

The CRISPR arrays of NZ_CP015957_1

>merge|NZ_CP015957|1|30708-30928|PILER-CR
AATGGTTCACAATCGGTTCACTAATTTGTTTTATTAAAATGAGTTACGAGTTGACAAATGGTTCACAAACGGTTTACGAACGGTTCACGTTAGCTTGATTTTATTCATATACAACAAACATGAACGGTTCACAAACGGTTCACTTTTTTTGAGGTTATTATTTTTAATGGTTCACGAGATTGGTACTATTTATGGTAATTAATGGTTCACAAATAGTTCAC

>NZ_CP015957|1|1|30708-30928|PILER-CR
AATGGTTCACAATCGGTTCAC	TAATTTGTTTTATTAAAATGAGTTACGAGTTGACA
AATGGTTCACAAACGGTTTAC	GAACGGTTCACGTTAGCTTGATTTTATTCATATACAACAAACATGAAC
GGTTCACAAACGGTTCACTTT	TTTTGAGGTTATTATTTTTAATGGTTCACGAGATTGGTACTATTTATGGTAATTAAT
GGTTCACAAATAGTTCAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015957.1\|WP_019232986.1\|18087_18315_-\|ChaB-family-protein	unknown	unknown	gnl\|CDD\|377614
NZ_CP015957.1\|WP_019233026.1\|29034_30261_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370445
NZ_CP015957.1\|WP_019233020.1\|35203_35863_-\|LexA-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP015957.1\|WP_019232976.1\|27474_28215_+\|acetoacetyl-CoA-reductase	unknown	unknown	gnl\|CDD\|273823
NZ_CP015957.1\|WP_019232983.1\|21124_21829_+\|sensor-domain-containing-diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NZ_CP015957.1\|WP_019233024.1\|32211_32931_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015957.1\|WP_019232977.1\|26780_27272_-\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|223149
NZ_CP015957.1\|WP_019233018.1\|36281_37373_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015957.1\|WP_019233022.1\|33950_34484_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015957.1\|WP_019233016.1\|38283_38571_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015957.1\|WP_019233017.1\|37417_38161_+\|complement-resistance-protein-TraT	unknown	unknown	gnl\|CDD\|377558
NZ_CP015957.1\|WP_019232982.1\|23492_23687_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015957.1\|WP_019233023.1\|32969_33812_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP015957.1\|WP_019233021.1\|34452_35220_-\|VUT-family-protein	unknown	unknown	gnl\|CDD\|376842
NZ_CP015957.1\|WP_019233019.1\|36061_36304_+\|TraY-domain-containing-protein	unknown	unknown	gnl\|CDD\|368477
NZ_CP015957.1\|WP_019232984.1\|19835_21059_+\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|272971
NZ_CP015957.1\|WP_019233025.1\|31162_32212_+\|ParA-family-protein	unknown	unknown	gnl\|CDD\|224113
NZ_CP015957.1\|WP_019232981.1\|23961_24354_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015957.1\|WP_019232980.1\|24477_25635_+\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NZ_CP015957.1\|WP_019232985.1\|18629_19379_-\|mechanosensitive-ion-channel-family-protein	unknown	unknown	gnl\|CDD\|366370

Protein	Function_ID	Function_description	E-value
NZ_CP015957.1\|WP_019232986.1\|18087_18315_-\|ChaB-family-protein	gnl\|CDD\|377614	pfam06150, ChaB, ChaB. This family of proteins contain a conserved 60 residue region. This protein is known as ChaB in E. coli and is found next to ChaA which is a cation transporter protein. ChaB may be regulate ChaA function in some way.	3.02969e-23
NZ_CP015957.1\|WP_019233026.1\|29034_30261_-\|hypothetical-protein	gnl\|CDD\|370445	pfam09339, HTH_IclR, IclR helix-turn-helix domain.	0.000741936
NZ_CP015957.1\|WP_019233020.1\|35203_35863_-\|LexA-family-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.7928e-08
NZ_CP015957.1\|WP_019232976.1\|27474_28215_+\|acetoacetyl-CoA-reductase	gnl\|CDD\|273823	TIGR01829, Acetoacetyl-CoA_reductase, acetoacetyl-CoA reductase. This model represent acetoacetyl-CoA reductase, a member of the family short-chain-alcohol dehydrogenases. Note that, despite the precision implied by the enzyme name, the reaction of EC 1.1.1.36 is defined more generally as (R)-3-hydroxyacyl-CoA + NADP+ = 3-oxoacyl-CoA + NADPH. Members of this family may act in the biosynthesis of poly-beta-hydroxybutyrate (e.g. Rhizobium meliloti) and related poly-beta-hydroxyalkanoates. Note that the member of this family from Azospirillum brasilense, designated NodG, appears to lack acetoacetyl-CoA reductase activity and to act instead in the production of nodulation factor. This family is downgraded to subfamily for this NodG. Other proteins designated NodG, as from Rhizobium, belong to related but distinct protein families.	2.37826e-118
NZ_CP015957.1\|WP_019232985.1\|18629_19379_-\|mechanosensitive-ion-channel-family-protein	gnl\|CDD\|366370	pfam00924, MS_channel, Mechanosensitive ion channel. Two members of this protein family of M. jannaschii have been functionally characterized. Both proteins form mechanosensitive (MS) ion channels upon reconstitution into liposomes and functional examination by the patch-clamp technique. Therefore this family are likely to also be MS channel proteins.	1.44603e-46
NZ_CP015957.1\|WP_019232977.1\|26780_27272_-\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|223149	COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones].	1.57033e-35
NZ_CP015957.1\|WP_019233017.1\|37417_38161_+\|complement-resistance-protein-TraT	gnl\|CDD\|377558	pfam05818, TraT, Enterobacterial TraT complement resistance protein. The traT gene is one of the F factor transfer genes and encodes an outer membrane protein which is involved in interactions between an Escherichia coli and its surroundings.	8.32589e-81
NZ_CP015957.1\|WP_019232983.1\|21124_21829_+\|sensor-domain-containing-diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	2.61065e-64
NZ_CP015957.1\|WP_019233023.1\|32969_33812_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.41012e-19
NZ_CP015957.1\|WP_019233021.1\|34452_35220_-\|VUT-family-protein	gnl\|CDD\|376842	pfam02592, Vut_1, Putative vitamin uptake transporter.	5.10476e-13
NZ_CP015957.1\|WP_019233019.1\|36061_36304_+\|TraY-domain-containing-protein	gnl\|CDD\|368477	pfam05509, TraY, TraY domain. This family consists of several enterobacterial TraY proteins. TraY is involved in bacterial conjugation where it is required for efficient nick formation in the F plasmid. These proteins have a ribbon-helix-helix fold and are likely to be DNA-binding proteins.	5.42914e-15
NZ_CP015957.1\|WP_019232984.1\|19835_21059_+\|PAS-domain-S-box-protein	gnl\|CDD\|272971	TIGR00229, Sensor_protein_FixL, PAS domain S-box. The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator. [Regulatory functions, Small molecule interactions].	7.46159e-17
NZ_CP015957.1\|WP_019233025.1\|31162_32212_+\|ParA-family-protein	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	1.46398e-34
NZ_CP015957.1\|WP_019232980.1\|24477_25635_+\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	1.61672e-51

>NZ_CP015957.1|WP_019233026.1|29034_30261_-|hypothetical-protein
MGNLCSIFHVRFKNLMKVIPSARKAQLVDYILLGWQSSTYKLKNSDLIWFMKPYTQIVEDTGIPKSTLERYIKELHEAGFIERRQALYSRTKEQGGFEVKKGTYIHITEKLLNLIKHSAPVSEPPKADTTHIHKDKHDSYQKCNEDQNALKSECNKFDINEGIDPLKMRGLYISDNYTSFFINNIILKKLTCSVDKPTLQRLSQQFETIQNLLSSEIKEEIPDEVKKLVLGTFFNLTFEHKKQFSSPKQLAAEYLFALLNIDFYLPDVACFKHRNNILSKMIRQNLWRTPKGFYKHFYLGQNFKDKHELREQQWQRKKDKEMSQDYNSNSDRKDERLIQLEAQMIAKSTLIDELTQSIYQQSSEEVILKIRENIQSLRNELETLWNQQIFIEQEIEKQQLLHSTRLCA
>NZ_CP015957.1|WP_019232976.1|27474_28215_+|acetoacetyl-CoA-reductase
MDKKIAVVTGGTGGIGSAICKHLASNYQVIACYFKNGNHDEAKRWQEEQRKTGFDMDILYADISKFADCEEMAHLILEKYGQVDVLVNNAGITADTSLKKMSPEQWQQVIDANLTSVFNVTRTILPSMLDKGYGRIISISSINGRKGQFGQCNYAATKAALFGFTKSLALEVASKGITVNTISPGYIETPMLAAMKEEVLNAIISNIPIGRLGKPEEIANVVAFLANPASGFITGANFDINGGQYM
>NZ_CP015957.1|WP_019232977.1|26780_27272_-|Hsp20/alpha-crystallin-family-protein
MSKLATWKKETPIAVEHSHNPFLRLQNEVDRVFSEFNDFFSPSRFNLGFDNLNLAPSMDVVEDKDHYSIQLEMPGMDEKDIKVSLADNVLTITGEKSTSKKNEDKKFLSREISYGKYERSISLPATVDVDKAKATFKKGMLWVELPKKEEAKRSARDIKIEKA
>NZ_CP015957.1|WP_019232980.1|24477_25635_+|GGDEF-domain-containing-protein
MEQRTADSLRIERFLYLLKGTLRSIPFNSVGAGFLSLAFLYNQGLSLRVLFWFFLISLLSLGRWLYNRIVIAKKSYQSHFELTRSLFLVFIFLTGLAWGSAFFIFPPGINVTEQAIIALVLGGMAAGAIAALSGYLPSFYAYVVPMFLPIILYDFYSLTPNKVIIGVLYCMFLALVFLTAQTNAQLLTNSFKYGHEKDILINELTLMNLRLEKSIEEIKTLSITDSLTGLYNRRHFDALLYNELKTAQHHHYPIHLVLIDIDNFKFINDTYGHPSGDDFLIYVANTLKNATKCASDMIFRLGGDEFALIVSHSVPHDVLYFCNALQDRFSQSNRHKQVTLSIGIISVVSFKSLDKEAVIHAADRTLYQAKKDGKNKIIAEVISEV
>NZ_CP015957.1|WP_019232981.1|23961_24354_+|hypothetical-protein
MSLNNSWYGLNLLPIYVDIIDERLESVCLQLKNLENVRTNPQQLNSETLTRIMKYCYAQKENNQAYFEQCSQWRNSTPNEEQLQLIARIEKSAAKLEFINQEILKLVESYQKKDQQWWKKTLKLTFDVFH
>NZ_CP015957.1|WP_019232982.1|23492_23687_+|hypothetical-protein
MSHQYAAKIYVDDTIIANSSGDNVEQLYVWMLAKVNGSRGNIRGEIIENATQKIVRHFKKAAIE
>NZ_CP015957.1|WP_019232983.1|21124_21829_+|sensor-domain-containing-diguanylate-cyclase
MNQKQHSSLCIPLMAQNEIFGLLFIYRGTDVLPSEKLNTLISVVAETISLAIANIRLKELLHSQSIRDPLTGLLNRRFLDEYLIKQIGQAKRTQTSIAFIMLDVDNFKKVNDTFGHETGDYVLSLLGNLLGASGREGDVTCRYGGEEFLFVLPNCDLEHAKECAETIRNEVHNMPIRIKENVCSITISLGISIFPNSGSTSKELIDTADKALYEAKKRGKNRTFIFSDIDKQEK
>NZ_CP015957.1|WP_019232984.1|19835_21059_+|PAS-domain-S-box-protein
MDTSQNFKEDAKVILESAPDLYLILCPKLHIVGASDAYLKATMVKREEILGRYLFDVFPDNPDDTLATGVNNLHYSLNRVLKDKTSDSMAIQKYDIKRPASSGGDFEVRYWSPLNCPVLDKKNQVQYIIHRVEDVTEFIRLQQSHDSQLKVIEALQSHEGKINAEILQRAHDIQELNKQLEERERYNLSFLSAIPDAMILTNQEGKIEFINNQVEVMFDCTKEELLGKTVEYLMPDNAAKIHPNHRGNYFKSPRVRPMGQGMELQGKRKNGEIFPVEISLSPLQTTSGLSAIAIIRDVTLRVEQNKLLQQKEASLRKLYDVNEKEKLQLESINQKMFLITQLSETLLACKNIDEILESSSSFANKILDFSDGVLYLMHNSRNYLEKKLPGEIQIIMQKLFPQMNAGL
>NZ_CP015957.1|WP_019232985.1|18629_19379_-|mechanosensitive-ion-channel-family-protein
MQTLAKIGWIHFSYALVLALIGFIIAGYVRRITNHAVKKRYSEHEALICGRLVFFGILLIFLITAMQQIGIQMTAILGAAGVVTVALSFAAKTAASNFVSGIFLIFERPFKIGDIIQIKNIQGTVDAIDLLSTKLKTSENTLIRIPNEMINKSEITNLSHFKTRAVSIKIPVSYTVDVNPIKNILLDLANKDKEIMEKPSPEVTLGDFTDSTIDINLKFWAHNRDTNAVKNRLQEAIKQEFEKKKIEIS
>NZ_CP015957.1|WP_019232986.1|18087_18315_-|ChaB-family-protein
MPYKKINELPDSVKDNLPNHAQEIYKEAYNNAWDQYDEPDKRQGDRDREETAHAVAWSAVKKEYEKNSEGKWVKK
>NZ_CP015957.1|WP_019233025.1|31162_32212_+|ParA-family-protein
MEQISWTNSDIRKLFKMDNRFKSIQTLYNAEDRGEIPVAGREPRGKVSTRIWKLDQLPEIGKRFGFLKPPTEQKVLCTYMQKGGVYKTTTSYNRARTLALNGMKVLLIGLDPECSVTDIIIPQQELNRLDDFEQGIGLFHYFVENAQLKDIIRPTSLPTLDFIPETHDLVKLNKWMTHEKRREYIFQDKLIPHLSNYDVIIFDNSPTWNHLVENSILVSSAVIMPLGCTLLAYNASATNMQNIWDFQEVMKLTDQKLVMFSTALERSSLSQQINATYLTRYVDYMITTPIRKSVKWEEALMSQQTILEYALGSPQAEEYYHLISEEWARINGGRDKFVELNLTNELEVV
>NZ_CP015957.1|WP_019233024.1|32211_32931_+|hypothetical-protein
MAIKKGAFELYTQERKLPDKRTSSSGKKNHFFDDIDKESNGTQTVHNQFTNGSSQVIVDDCNLLQNQSEQLETNPILDGECNADDTLNKPRKLNLGSFDNSPQTVHKRFTSDRSEVEITTDKLLSLKSNAKQHNHEKKLLTSFSKIIGNQREIVIALYKNIRLNKSDMTEELTLETIATLTGINPKSLKNTLFRLTSAGVIIRADQKVGRGGWVKYQINSEIIEQIQQADFLTFTKIKR
>NZ_CP015957.1|WP_019233023.1|32969_33812_-|class-I-SAM-dependent-methyltransferase
MISHIYRNPNKYSKNNALQYNFAMKLLSKISFNNQSRVLDVGCGDGVITNEIAGIVHEGCVIGTDISEQMIEFASKKYADQYNLRFLAMDASKNIFREQFDIITSFNCLHWVKDQQNALFGIARSAVYGAQVALLLSHKKSLYHLVLDKICSSSKWKDYFTDFISPRSFFDPLDYKEMVVRSGLDVIEISEEEMTYSFKSKEQLKDFFNAAGSQIKQIPEAKKSDFLNDFIDEYLKEASFSEETLIPVSFWCLQVIATKPKPKLIKTSELDNRSTLFSKL
>NZ_CP015957.1|WP_019233022.1|33950_34484_+|hypothetical-protein
MSVLSIISSIIKEIKSPAFKIESDDEDPKTGLIFVWVKIENKSVLPMKKDPIELLREARSKNCFSKKDYDWIIDVMLENQKRLIENKFKKNFSLIKHQFSEQLEEPLVVYKDLTNKIYIKPAKEIYSSIEKLKKFNSEDSACIGNIVGSHEAEQEYRLRNQCKNSNVIKFDTSLLSR
>NZ_CP015957.1|WP_019233021.1|34452_35220_-|VUT-family-protein
MILKNKIGIFLKTHFFKKISDYFANIDKGAYLVLIGMLYATIFFCSFVMGYKTVDLYGRILCSSVFIFPLLFPINDSITELLGAKVSYLMIVAIIFCEFMFSFITHALAILPSPSHWQNQEIYPLLTTGFIHIAIADSISLAIGFFANTYVLDKWGMKWFGSGFFRRSLGATAVGELLFTISTNLITFHMLSTANLMDTTNIIISDYILKMAYSFIICIPNAYLVSLIKKHIQKEDIIKDRKIIPLNGIRVRYRT
>NZ_CP015957.1|WP_019233020.1|35203_35863_-|LexA-family-transcriptional-regulator
MSISNVLSELLKKYNLNALELERLTGVPSSTIYRLLKDKDGNPTIEVLKKLASFFQITVSQLIGEDPFGCKQIPLVQPSAIFSFITSAQARKDELDSVPIDFPLSDKCFATLSQDNMMEPFILVNSIVIVDPERDITNKDFVLLIKSRDDKPIIRQIISDGDDFYLKVLNSNFPVELKKVDLKDYTFIGVIVHYRTNLFDFCLSNSNKDYDGLIYDFKK
>NZ_CP015957.1|WP_019233019.1|36061_36304_+|TraY-domain-containing-protein
MESEINNKKYPKVFISFQLSEEANKLLTESCERSGRKKIPEAALRLEDHLKRFRSISELNQTTPHQPEAMDADHGRTTNP
>NZ_CP015957.1|WP_019233018.1|36281_37373_+|hypothetical-protein
MAVLRIHKKQQNFVILDKTCLNDQTLSWGAKGLHAYLISLPDNWKVRVSDLKERARNGRDAVRGLLSELEQAGYIQKVTSRDDASGRFGGVEYLVLEIPEPKNQENNPETKKPYSVKNEQKTPSPENPSLVNPETGNPLPVNPTLININRINNKRLNNKTATADRSISVKELNAKTQAEKAATVFSQSVRHEVMSVEKAELEYNHIDFLSQDDALIGSQLTQSQKQRIRTLVKSLNISQKEALIEEIEFCLINPKHFTACGKDFSRKLNAIRSVILRGDWQTPSGMIQELSIVQNSNDVAVRELEKELREAQAEVVHFKRLLTTAREHTRAHFETIIYQAQNKIKDLEGRIRDFLSQPQEVSC
>NZ_CP015957.1|WP_019233017.1|37417_38161_+|complement-resistance-protein-TraT
MKDNNNIISKTLIVGTIAVLTGCAATQTAIEHGSLQVSTKQSETVFLDPVFNAQKTVYVSVKNTSDEDVDIAPQLKTALSSHGYKVINNPNSAHYLLQANVLKVGKMSVAASQSALGGGYGSAIAGAVAGTAAGSFTQSSTGMIAGGLAGGVIGLAADSLVKDVNYTMITDIQISERVGKGIKVNEQFQSNLKNGRSSVTSQISSRDSQYQRYRTRVVSNADKVNLKFQDARPALEQGLVKVISGIF
>NZ_CP015957.1|WP_019233016.1|38283_38571_+|hypothetical-protein
MKMGKKIGSLIQKGGSVLIFTLLSKGVFANDLLARALEGDVKDSLGSGSMFWKVFILVDIILATAMAVKSKNPMVFVGVTAVAFIPAFLLKTFVF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP015957_1	1.1\|30729\|35\|NZ_CP015957\|PILER-CR	30729-30763	35	NZ_CP015957	Legionella pneumophila strain E9_O plasmid unnamed1, complete sequence	30729-30763	0	1.0
NZ_CP015957_1	1.2\|30785\|48\|NZ_CP015957\|PILER-CR	30785-30832	48	NZ_CP015957	Legionella pneumophila strain E9_O plasmid unnamed1, complete sequence	30782-30829	0	1.0
NZ_CP015957_1	1.3\|30854\|57\|NZ_CP015957\|PILER-CR	30854-30910	57	NZ_CP015957	Legionella pneumophila strain E9_O plasmid unnamed1, complete sequence	30851-30907	0	1.0
NZ_CP015957_1	1.1\|30729\|35\|NZ_CP015957\|PILER-CR	30729-30763	35	NC_015704	Runella slithyformis DSM 19594 plasmid pRUNSL02, complete sequence	88444-88478	8	0.771

1. spacer 1.1|30729|35|NZ_CP015957|PILER-CR matches to NZ_CP015957 (Legionella pneumophila strain E9_O plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

taatttgttttattaaaatgagttacgagttgaca	CRISPR spacer
taatttgttttattaaaatgagttacgagttgaca	Protospacer
***********************************

2. spacer 1.2|30785|48|NZ_CP015957|PILER-CR matches to NZ_CP015957 (Legionella pneumophila strain E9_O plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tacgaacggttcacgttagcttgattttattcatatacaacaaacatg	CRISPR spacer
tacgaacggttcacgttagcttgattttattcatatacaacaaacatg	Protospacer
************************************************

3. spacer 1.3|30854|57|NZ_CP015957|PILER-CR matches to NZ_CP015957 (Legionella pneumophila strain E9_O plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tttttttgaggttattatttttaatggttcacgagattggtactatttatggtaatt	CRISPR spacer
tttttttgaggttattatttttaatggttcacgagattggtactatttatggtaatt	Protospacer
*********************************************************

4. spacer 1.1|30729|35|NZ_CP015957|PILER-CR matches to NC_015704 (Runella slithyformis DSM 19594 plasmid pRUNSL02, complete sequence) position: , mismatch: 8, identity: 0.771

taatttgttttattaaaatgagttacgagttgaca---	CRISPR spacer
taatttgttttattaaaatgactt---aacttactttg	Protospacer
********************* **   *..* **

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP015956

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP015957

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection