CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP017404	Bordetella pertussis strain 6229 chromosome, complete genome	4 crisprs	csa3,cas3,DinG,DEDDh	0	0	32	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP017404_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017404_1

252687-252771

Orphan

Consensus_repeat	Method
GGTGCCTGTCCCCGCGGGGACAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP017404_1

>merge|NZ_CP017404|1|252687-252771|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAGATACCGTCTTGGCCGTCAAGCGTTCATGGCGTATGACAGGGTGCCTGTCCCCGCGGGGACAG

>NZ_CP017404|1|1|252687-252771|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAG	ATACCGTCTTGGCCGTCAAGCGTTCATGGCGTATGACAG
GGTGCCTGTCCCCGCGGGGACAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017404.1\|WP_003814321.1\|263058_264813_+\|gamma-glutamyltransferase	unknown	unknown	gnl\|CDD\|223482
NZ_CP017404.1\|WP_003814355.1\|243645_245748_+\|TRAP-transporter-large-permease-subunit	unknown	unknown	gnl\|CDD\|129868
NZ_CP017404.1\|WP_003814363.1\|240212_240623_+\|4-carboxymuconolactone-decarboxylase	unknown	unknown	gnl\|CDD\|131478
NZ_CP017404.1\|WP_003814351.1\|247158_248115_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP017404.1\|WP_003814337.1\|252781_253723_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NZ_CP017404.1\|WP_010929705.1\|253719_255609_-\|DNA-mismatch-repair-endonuclease-MutL	unknown	unknown	gnl\|CDD\|234630
NZ_CP017404.1\|WP_003814358.1\|241644_242388_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP017404.1\|WP_010929702.1\|248621_249977_-\|polynucleotide-adenylyltransferase-PcnB	unknown	unknown	gnl\|CDD\|130997
NZ_CP017404.1\|WP_003814339.1\|251626_252676_+\|phosphoribosylformylglycinamidine-cyclo-ligase	unknown	unknown	gnl\|CDD\|235439
NZ_CP017404.1\|WP_010929707.1\|258480_259872_+\|class-II-fumarate-hydratase	unknown	unknown	gnl\|CDD\|234779
NZ_CP017404.1\|WP_003814356.1\|242431_243475_-\|TRAP-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270320
NZ_CP017404.1\|WP_010929703.1\|249977_250676_-\|HAD-IB-family-hydrolase	unknown	unknown	gnl\|CDD\|319796
NZ_CP017404.1\|WP_010929708.1\|259888_260869_-\|AEC-family-transporter	unknown	unknown	gnl\|CDD\|223751
NZ_CP017404.1\|WP_010929701.1\|248133_248625_-\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	unknown	unknown	gnl\|CDD\|172582
NZ_CP017404.1\|WP_033446171.1\|255713_256334_+\|membrane-protein	unknown	unknown	gnl\|CDD\|182775
NZ_CP017404.1\|WP_010929709.1\|262052_262952_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176107
NZ_CP017404.1\|WP_010929704.1\|250672_251374_-\|DnaA-regulatory-inactivator-Hda	unknown	unknown	gnl\|CDD\|236347
NZ_CP017404.1\|WP_010929706.1\|257792_258329_-\|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	unknown	unknown	gnl\|CDD\|223873
NZ_CP017404.1\|WP_019247543.1\|256476_257862_-\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|182376
NZ_CP017404.1\|WP_003814324.1\|261004_261988_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE	unknown	unknown	gnl\|CDD\|270295

Protein	Function_ID	Function_description	E-value
NZ_CP017404.1\|WP_003814321.1\|263058_264813_+\|gamma-glutamyltransferase	gnl\|CDD\|223482	COG0405, Ggt, Gamma-glutamyltransferase [Amino acid transport and metabolism].	0
NZ_CP017404.1\|WP_003814355.1\|243645_245748_+\|TRAP-transporter-large-permease-subunit	gnl\|CDD\|129868	TIGR00786, TRAP_transporter_permease_protein_SiaT, TRAP transporter, DctM subunit. The Tripartite ATP-independent Periplasmic Transporter (TRAP-T) Family (TC 2.A.56)- DctM subunit TRAP-T family permeases generally consist of three components, and these systems have so far been found in Gram-negative bacteria, Gram-postive bacteria and archaea. Only one member of the family has been both sequenced and functionally characterized. This system is the DctPQM system of Rhodobacter capsulatus (Forward et al., 1997). DctP is a periplasmic dicarboxylate (malate, fumarate, succinate) binding receptor that is biochemically well-characterized. DctQ is an integral cytoplasmic membrane protein with 4 putative transmembrane a-helical spanners (TMSs). DctM is a second integral cytoplasmic membrane protein with 12 putative TMSs. These proteins have been shown to be both necessary and sufficient for the proton motive force-dependent uptake of dicarboxylates into R. capsulatus. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	2.77055e-96
NZ_CP017404.1\|WP_003814363.1\|240212_240623_+\|4-carboxymuconolactone-decarboxylase	gnl\|CDD\|131478	TIGR02425, putative_gamma-carboxymuconolactone_decarboxylase, 4-carboxymuconolactone decarboxylase. Members of this family are 4-carboxymuconolactone decarboxylase, which catalyzes the third step in the catabolism of protocatechuate (and therefore the fourth step in the catabolism of para-hydroxybenzoate, of 3-hydroxybenzoate, of vanillate, etc.). Most members of this family are encoded within protocatechuate catabolism operons. This protein is sometimes found as a fusion protein with other enzymes of the pathway, as in Rhodococcus opacus, Streptomyces avermitilis, and Caulobacter crescentus. [Energy metabolism, Other].	1.36265e-47
NZ_CP017404.1\|WP_003814351.1\|247158_248115_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	6.01101e-118
NZ_CP017404.1\|WP_003814337.1\|252781_253723_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	4.17279e-156
NZ_CP017404.1\|WP_010929705.1\|253719_255609_-\|DNA-mismatch-repair-endonuclease-MutL	gnl\|CDD\|234630	PRK00095, mutL, DNA mismatch repair endonuclease MutL.	0
NZ_CP017404.1\|WP_003814358.1\|241644_242388_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	5.58304e-45
NZ_CP017404.1\|WP_010929702.1\|248621_249977_-\|polynucleotide-adenylyltransferase-PcnB	gnl\|CDD\|130997	TIGR01942, pcnB, poly(A) polymerase. This model describes the pcnB family of poly(A) polymerases (also known as plasmid copy number protein). These enzymes sequentially add adenosine nucleotides to the 3' end of RNAs, targeting them for degradation by the cell. This was originally described for anti-sense RNAs, but was later demonstrated for mRNAs as well. Members of this family are as yet limited to the gamma- and beta-proteobacteria, with putative members in the Chlamydiacae and spirochetes. This family has homology to tRNA nucleotidyltransferase (cca).	4.58369e-147
NZ_CP017404.1\|WP_003814339.1\|251626_252676_+\|phosphoribosylformylglycinamidine-cyclo-ligase	gnl\|CDD\|235439	PRK05385, PRK05385, phosphoribosylaminoimidazole synthetase; Provisional.	0
NZ_CP017404.1\|WP_010929707.1\|258480_259872_+\|class-II-fumarate-hydratase	gnl\|CDD\|234779	PRK00485, fumC, fumarate hydratase; Reviewed.	0
NZ_CP017404.1\|WP_003814356.1\|242431_243475_-\|TRAP-transporter-substrate-binding-protein	gnl\|CDD\|270320	cd13602, PBP2_TRAP_BpDctp6_7, Substrate-binding domain of a pyroglutamic acid binding DctP subfamily of the tripartite ATP-independent periplasmic transporters; contains the type 2 periplasmic binding protein fold. DctP6 and DctP7 groups of the TRAP transporters that involved in pyroglutamic acid transport. TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. They are comprised of a periplasmic substrate-binding protein (SBP; often called the P subunit) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process (the M subunit) and a smaller membrane of unknown function (the Q subunit). The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.99378e-85
NZ_CP017404.1\|WP_010929703.1\|249977_250676_-\|HAD-IB-family-hydrolase	gnl\|CDD\|319796	cd02612, HAD_PGPPase, phosphatidylglycerol-phosphate phosphatase, similar to Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C. This family includes Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C, PgpC (previously named yfhB) which catalyzes the dephosphorylation of phosphatidylglycerol-phosphate (PGP) to phosphatidylglycerol (PG). This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.91431e-64
NZ_CP017404.1\|WP_010929708.1\|259888_260869_-\|AEC-family-transporter	gnl\|CDD\|223751	COG0679, COG0679, Predicted permeases [General function prediction only].	1.13912e-41
NZ_CP017404.1\|WP_010929701.1\|248133_248625_-\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	gnl\|CDD\|172582	PRK14092, PRK14092, 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.	2.78166e-87
NZ_CP017404.1\|WP_033446171.1\|255713_256334_+\|membrane-protein	gnl\|CDD\|182775	PRK10847, PRK10847, DedA family protein.	8.25718e-70
NZ_CP017404.1\|WP_010929709.1\|262052_262952_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176107	cd08415, PBP2_LysR_opines_like, The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulators, OccR and NocR, involved in the catabolism of opines and that of LysR for lysine biosynthesis which clustered together in phylogenetic trees. Opines, such as octopine and nopaline, are low molecular weight compounds found in plant crown gall tumors that are produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. NocR and OccR belong to the family of LysR-type transcriptional regulators that positively regulates the catabolism of nopaline and octopine, respectively. Both nopaline and octopalin are arginine derivatives. In Agrobacterium tumefaciens, NocR regulates expression of the divergently transcribed nocB and nocR genes of the nopaline catabolism (noc) region. OccR protein activates the occQ operon of the Ti plasmid in response to octopine. This operon encodes proteins required for the uptake and catabolism of octopine. The occ operon also encodes the TraR protein, which is a quorum-sensing transcriptional regulator of the Ti plasmid tra regulon. LysR is the transcriptional activator of lysA gene encoding diaminopimelate decarboxylase, an enzyme that catalyses the decarboxylation of diaminopimelate to produce lysine. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.62875e-38
NZ_CP017404.1\|WP_010929704.1\|250672_251374_-\|DnaA-regulatory-inactivator-Hda	gnl\|CDD\|236347	PRK08903, PRK08903, DnaA regulatory inactivator Hda; Validated.	2.81236e-100
NZ_CP017404.1\|WP_010929706.1\|257792_258329_-\|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	gnl\|CDD\|223873	COG0802, COG0802, Predicted ATPase or kinase [General function prediction only].	2.28113e-54
NZ_CP017404.1\|WP_019247543.1\|256476_257862_-\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|182376	PRK10319, PRK10319, N-acetylmuramoyl-L-alanine amidase AmiA.	1.25625e-84
NZ_CP017404.1\|WP_003814324.1\|261004_261988_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE	gnl\|CDD\|270295	cd13577, PBP2_BugE_Glu, Glutamate transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	4.35876e-158

>NZ_CP017404.1|WP_003814339.1|251626_252676_+|phosphoribosylformylglycinamidine-cyclo-ligase
MTNQHSAPLTYRDAGVDIDAGDALVDRIKPLAARTMRPGVLAGIGGFGALFEVPKKFREPVLVSGTDGVGTKLRLAFDWNRHDTVGIDLVAMSVNDILVQGAEPLYFLDYFACGKLSVDTAAAVVGGIARGCELAGCALIGGETAEMPGMYPDGEYDLAGFAVGAVDKSAIIDGKSIQPGDVVLGLASSGAHSNGYSLVRKILERAGARPDQDFHGQPLVDVVMAPTRIYVKQVLAALDRHGPAIKGLAHITGGGLLDNVPRILQPGMAAQLQRDGWEMPKLFQWLQQQGSVADAEMHRVFNCGIGMVLVVAADQADAVAATLREQGEIVNRIGEIVPQQDGMAQTVVV
>NZ_CP017404.1|WP_010929704.1|250672_251374_-|DnaA-regulatory-inactivator-Hda
MNRQLLLDVLPAPAPALNNYIAGPNGQALAAAHALTAGRAIYLWGPAGCGRTHLLRGLSARPEAIYIDAARAAQSLRELAEADSTAPMPRLVAVDDVHRMDDARQAGLFALYNRWRESAATGRAFALAVSGDRAPMSLPLREDLRTRLGWDLVFRLDPLSDADKLAALTAQAAERGLQLAPEVINWMLTHHERDIRKLAALLDALDRYSLATGRPITIPLLRAMLADPHSQAT
>NZ_CP017404.1|WP_010929703.1|249977_250676_-|HAD-IB-family-hydrolase
MTTRRLALFDLDHTLLPLDSDYQWADFLARTGRAGDPAEARRRNDDLMERYNRGELTAEQAAEFMLGLLAAHSPVELAAWHEEFMRDVIRPSLTVQAVDVVRGHLAAGDLCALVTATNSFVTAPIARAFGVQHLIATDPEYRDGRYTGRIEGTPSFREGKVVRVNQWLAGMGLALGDFAESYFYSDSVNDVPLLEAVTRPIAANPSPGLREIAQARGWQVIDLFDHLEDAKS
>NZ_CP017404.1|WP_010929702.1|248621_249977_-|polynucleotide-adenylyltransferase-PcnB
MITETIRKFVGRLFAPALRGPQRIGAERHGIDRRNVSRHAIKVCDVLRQHGYEAYIVGGAVRDLIVGLEPKDFDVATNATPEQIRPLFRRARIIGRRFQLVHVVFGQEIIETSTFRAPASDDQETDEHGRILRDNVFGSQEEDAARRDFTMNALYYDPHTEEVIDYHQGVQDLKKRQVRIIGDPVKRYREDPVRMLRAVRFAAKLNGSIDTATRQPIRTMASLIENVPASRLFDEMLKLLTCGHAMDCLRQLRNDGLHHGLLPLLDVVLEQPGGENFVELALERTDARVRAGKTISPSFLFAALLWQLVDVRWKQLRAQGEHNIPALVQAADSVLDEQTEKLAIQRRFSSDMREIWFMQPRFERRAGKTIYRMLEQPRFRAACDFLQLRAAAGEFDSVLAQWWMDLANGDDATRAEMIEETAHLPRETGDAPAQKRRRPRRRPSNRPREPQ
>NZ_CP017404.1|WP_010929701.1|248133_248625_-|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase
MNGSPASTLAYVGLGASLGDAAATLRSVLAELAAAPGILACKASRLYRTAPVEAQGPDFVNAVAALDTTLAPLDLLDLLQALEQRHGRERPYRNAPRTLDLDLLLYGEQAIDHPRLSVPHPRMHERAFVLAPLCELVPALRLAQGDCAALLAALEDQAIEPLR
>NZ_CP017404.1|WP_003814351.1|247158_248115_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKKRIWGTLLAAAMTVGSGAAHAGYPDKAVRIVVPFAAGGGVDALARPFAKELGDILGQSIVVENKPSNTGQIGATDVARAAADGYTLLLSSAAFATTPAFYPQVPYDPVKDFSPVMIMAAAPQVLVASNRFKAASLPDVLAQARQSDRINFALSASTGIQALATAMLAGQGGVTFMTIPYKGAGAAFMDLISGEVDLMIDNPASSLVHVRAGKLRVLATTGSKRMAILPDVPTVAETLPGFEARNWFVLAAPQGTPPAVIQKLNEASARALNTPAMRQMLERDGIDLVADSPAHAAAFLQDEIAKWGKVVKEGNLQP
>NZ_CP017404.1|WP_003814355.1|243645_245748_+|TRAP-transporter-large-permease-subunit
MSSIEMPAPVMPIEPAELAGASPYPLAIDQDFCLIRWMAAISRACGALATVALLLMALSMCYEIFSRYLFNAPTAWATEISGYLLVATVFFGLAAAQASNSHVQVELWIDRLSAPVRLRVELLCQWLALLFCVVLGWQMASFNVREYLNDTRDWGLLSTPQWMPELAVSVGMVVFCMSILVDIYRLSPPAQAWRRWLTPALLALLAAALVALGANAVPMAAGGRFDWGMALIVAALLACAWAWSGVRTLAHVVLVVGGCAVLYGLARGQSLGWVAFLLVASMMLLLFLGVRIGVALGLVGLFGVYFLLSRPQLSLLAERAWSSTNTFTLTAVPMFIFMGGLLLRSGITAGMFDALVRWFGRAPGGLAHASAGASAVFAAVSGSSLATAATLGKVACPDMIERGYSPRLTYGVAAAGATLGILIPPSIPMIIYGTTVGASVTHLFLAGMLPGLLLMACFMLGALVWALAVPGSAPVARAYTLREKLSASRGMVPFVAIIGAVLGSMYTGVATPTEAAAIGAVSAFVLCLVRRQLSWRALFEIAHDSAKVTALLLLIVVGAGIFSWVFDYLRLPREVVNLIQGADLSPALIVAAMVLAYLVLGMFVESIAMMLMTLPVTYPIAMSLGLDPIWFGVFLVLMIELGLITPPVGMVLFVLRSMNEKARFTDIIRGALPFVLIILLFLCLIYIYPQIVMWLPQQVK
>NZ_CP017404.1|WP_003814356.1|242431_243475_-|TRAP-transporter-substrate-binding-protein
MSQRFPLPRGFQAALAAAALCTASWSGAAAAQTYDLTMAVITSPGDGYSILTASVPERVAKATDGKVKVTVSDSLVPPAQIATAVREGRVDMSAALHTYLAADEPRMGIFNLPGLINNIQEYKQVCDAFWCEDTRKIWKDKWNAIVLAEGAWCTQQLFSKDPIHKVEDFKGKRLRVHNPQTAEVVNALGGKPVAMPTTEIFPALERGVIDGLFISTCVGGSLEFWRIAKNVQNWSLGPINGWAILANPDSWQKLPADVQKQVQGAMDALQQEAFGNYDTFVSNAQQEMMKKGVTFWVAPEEERAKLMQQQYIGPSYEAWNKRAKQVGFDGPAYLDRVRTTLGKSASN
>NZ_CP017404.1|WP_003814358.1|241644_242388_-|GntR-family-transcriptional-regulator
MPFPFCNTNRMTSPAAPEGEFKVQRVASVLRHSVTESIRNAILVGRFRPGERLPERELCEMTGVSRTLVREALRQLESEGLIVVIPHRGPVVERLSPEQARGIYQVREELEGLACQLFAEHATEPQLAALQEAFQALKRALTRGTPLEQIAAKNAFYQQLLDGAGNEALTTTLRLLNSRVMLLRSTSMQAPGRAKHSVAELSNLLQALVARDGKAARKAGSLHVRNAASVAIAILQDSLADAAATAE
>NZ_CP017404.1|WP_003814363.1|240212_240623_+|4-carboxymuconolactone-decarboxylase
MALRPEFQTEQFQKGLAVRRAVVGDAYVDKSLNSADDLTASLQKLVTEYCWGEVWTRPGLERKTRSFLNLAMLIALNRPNELRLHLRGAINNGVTKDEIVEVVLQAAIYCGVPAALDAMKAVREVVETMEKEGAFA
>NZ_CP017404.1|WP_003814337.1|252781_253723_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MTPRAIICLAGPTAAGKSASTLALAQRWPLEIINVDSATIYRGMDIGTAKPSAAERAQVPQHLLDIRDPAQSYSAAEFRADALRLIAEIHARGRIPLLAGGTMLYYKALREGLDDLPQADPALRAELEARAARLGWPALHAELALLDPATAARLSPNDSQRIQRALEICRLAGQPMSALLQGERRGDAPSPYRYVTLSLEPSERAALHARIAQRFDAMLAAGLVEEVRGLHARPDLHPGLPSVRCVGYRQMWSYLDGDIDLDTAREQGVAATRQLAKRQLTWLRAQPERVIIDCLAGDAVARTVDAMARALPD
>NZ_CP017404.1|WP_010929705.1|253719_255609_-|DNA-mismatch-repair-endonuclease-MutL
MSDRRPIATLPDLLISQIAAGEVIERPASVLKEILENAIDAGARAIEVRLEGGGIRRIAVTDDGSGIPPEELPLALTRHATSKIRSLDELESVASMGFRGEALASIASVADLTIISRTRGAEHAWQIDGGSLQVSPASGPPGTTIDVRQLFDRVPARRKFLRSEATEFGHCVDAMERIALAHPEVAFRLFHHDRAQRQWLPADHGQRIRDVLGAEFVGHVLPVLAAAGAIALMGMVTRPTAARARADRQYLYVNGRFVRDRTVSHALRSAYADVLHGDRQPAYVLYLDIDPGAVDVNVHPAKHEVRFRDSGAVHRFVSQVVGQTLAQTGGAEAVPAGVPDGAAPDTAYAGEPAAAAPGLAEPRAPYPAAYPSPGQSPYQGSPARPHTQVPFRLHGEPAGIPATDWQSLYRPLPGDAAPAATALRAAPATPLPTADEHPLGQALAQLHGIYILAQNSRGLVLVDMHAAHERVVYEQLKRALDDRALPRQDLLVPVVFHAAEKDVALVEEHETQLNELGFEMRPSGPASIAVRSVPALLARGDIESLARAVLRDLGAVGVSRLLTEQRNELLSTMACHGSVRANRRLTLEEMNALLRQMEITERADQCNHGRPTWVQWSVNDLDKLFLRGQ
>NZ_CP017404.1|WP_033446171.1|255713_256334_+|membrane-protein
MVLHIDQTLGIWVEQYGVWVYLVLFLIVFAETGLVVLPFLPGDSLLFIAGAFGATGHMDPVLTAALLIVAAISGNTVNYTIGRYIGPRVFSMNLRFLDRNALMRTHAFYEKHGGKTIVMSRFIPVIRTFAPFVAGVADMRLARFQLFNIGGALLWVISLVAAGYFFGNIPLVREHLNTIVLIGLGAAIVPVVIGALVRLLQVRRGQ
>NZ_CP017404.1|WP_019247543.1|256476_257862_-|N-acetylmuramoyl-L-alanine-amidase
MVERDCPPAHGALSPRAAARRRLISVAATLLVLPVVPRLAHAATILAVRTWPADEYTRVTLELDSELKAEHFTLENPHRLVVDIEGLSVNAALNDLVSKVRHDDPYIQGLRVAQNRPNVVRLVFDLKQSVAPQVFTLKPVADYQYRLVLDLYPKVAQDPLMAILNKQSGPDVDDPLARVLDEIARNQPAPDQPAAPLARGQEPAPALPAPPIKPLPAPGRSASRKRMLTIALDPGHGGEDPGAIGRSGLREKDVVLRIARRLKTLIDAQPYMRAYLTRDDDYFVPLHVRVQKARRVRADLFVSIHADAFIKPTANGSSVFALSERGASSTQARWLADKENAADLIGGVNLGSHDRQVAKVLLDLSTTAQINDSLKVGSAFLDEIKKINRLHKNRVEQAGFAVLKAPDIPSILVETAFISNPKEEALLRSAAHQEKLAQAMMTGIDRYFTANPPLARVGDVS
>NZ_CP017404.1|WP_010929706.1|257792_258329_-|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE
MSAPPTTLCLHLPDEAATENLARQLAPLVDGRRGGQPGGQIHLQGDLGAGKTAFTRALLRECGIQGRIKSPSYALLESYKVSNLYFYHLDFYRFSDSREWLDAGFRDLLRDDAVVLIEWPERAAGLLPPPDLLISLAYADQGRDASLTAHTARGQTWLNAIVPPPTARSLPAPPPADA
>NZ_CP017404.1|WP_010929707.1|258480_259872_+|class-II-fumarate-hydratase
MKTRTEKDTFGPIEVPEQHLWGAQTQRSLHFFAISTEKMPVPLVAAMARLKRAAAKVNAELGELDPQVADAIMRAADEVIAGKWPDEFPLSVWQTGSGTQSNMNMNEVLANRASELLGGERGEGRKVHPNDHVNRGQSSNDTFPTAMHVAAAVEVEHRVLPALKALRGTLAAKSAAFYDIVKIGRTHLQDATPLTLGQEISGYVAQLDLAEQQIRATLAGLHQLAIGGTAVGTGLNAHPQFSAKVSAELAHDTGSAFVSAPNKFQALASHEALLFAHGALKTLAAGLMKIANDVRWLASGPRSGLGEISIPENEPGSSIMPGKVNPTQCEAVTMLAAQVMGNDVAINVGGASGNFELNVFKPLVIHNFLQSVRLLADGMVSFDKHCAAGIEPNRERITELVERSLMLVTALNPHIGYDKAAQIAKKAHKENLSLKEAALALGHLTEAQFAEWVVPGDMTNARR
>NZ_CP017404.1|WP_010929708.1|259888_260869_-|AEC-family-transporter
MSENSSLRRDAEAPLLSIFLPGSMSVALLVLPDFMLVALGWALRHKLGFSREFFAGTERMVYFVLFPALLFQSILRTPISAGHAMQLLQATAALMACGVALAWLAGPVLRPAPVALASAAQCGYRFNTYIGLALAASLAGGPGQTIMALIVGFAVPMANVAAVYGLARHSGNGLLRELARNPLLVSTLLSLACNLAGLSLPGPIDTVMARLGAAALALGIMCVGASLAWEGGKGHGRLIGWMLAVKLAAMPSAALGIAWALGLPALETRMLVLFSALPTASAAYVLAMRMGGDGRMVAVLISLGTLASAATIPLWLTAAAGLGAPN
>NZ_CP017404.1|WP_003814324.1|261004_261988_+|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE
MNKVRTLVQAIAVATGLVAAAGAQAADAYPSKAIRVIVPFAPGGSTDIIARLVTQRMSQELGQPMVVENKGGAGGAIGASEAARAEPDGYTLSIATVSTMAVNPACRPKDLPYDPIKDFQPVTNFANTANVVAVNPKFPAKDFKGFLEELKKNPGKYSYGSSGTCGVLHLMGESFKMATGTDIVHVPYKGSGPAVADAVGGQIELIFDNLPSSMPQIQAGKLRAMAIAWPTRIDAIKDVPTFADAGFPVLNQPVWYGLLAPKGTPMDVVNKLRDAAVVALKDPKVIKALDDQGSAPSGNTPEEFAKEIKEQYDWAQDVVKKQNIKLD
>NZ_CP017404.1|WP_010929709.1|262052_262952_-|LysR-family-transcriptional-regulator
MRLRHIEIFEAIRRTGSLTEAAAALHISQPAASKLLAHAEAQLGFKLFERVKGRLVATREAEILAPEVARLNQDLGSVRRLAASLRDRPHGHLRLGCAPALGLGLLPGVVRASRDAQPGITFDIHTHHSAELVQGLLAHELDLAITFDANNHPGLTRTSLGHTELVHLSRLPGAGTTRLQELGGETLIVLDARDASGSLLQMALDAQGLAPRVAIQVQTHYVACALAEAGCGDAVVDAITARAMLRPGMALRRLEPALRVPISVMTRSQDALSTLHHDFIERLRQACSVLQAQPAPQPE
>NZ_CP017404.1|WP_003814321.1|263058_264813_+|gamma-glutamyltransferase
MPLRTLLAALCAAAICQAPAWAREAPGVAREDVNPEIASARSERAQAHAQRYMIATANPLASEAGYRILRAGGSATDAIIAAQLVLNLVEPQSSGIGGGAFMVHYDRGAGELRVYDSRETAPAAARPDRFLREGKPLSYAESVNNGRAVGTPGLLRGLELAHRQHGKLPWQALFEPAIAMAEQGFAVSPRLHESIAGDKALAAQPAAARYFYGPDGQAWPVGHRLRNPEFAATLRSIAREGADAFYRGPIARDIVAAVRAHPTPGDLAEADLAGYRAVVREPVCGLYRGYRLCGAPPPSSGPLAVLQMLGELEQYPLARMRPGSVEAVHYFSEAGRLAFADRDFYVADPAFVDVPVRALLDPAYLRQRGALIRPDRSMKTALPGDPQGLLAERARDDAIEVPSTSHLVAVDAAGNVVSMTSTIEAAFGSKIFVRGFLLNNEMTDFSSSYRDPEGRLVANRVEPGKRPRSSMAPMIVFRAGKPVLALGSPGGSAIINYVAKTLVGVLDWKLDVQQAIALPNLGSRNKETELERGTALEALAPALRRMGHEVRITDFPSGIQGIVIGPHGLAGGADPRREGLALGD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP017404_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017404_2

435179-435272

Orphan

Consensus_repeat	Method
GTGCCTGTCCCCGCCGGGACAGGCAC	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of NZ_CP017404_2

>merge|NZ_CP017404|2|435179-435272|CRISPRCasFinder
GTGCCTGTCCCCGCCGGGACAGGCACCCGGGCCCAGGAAAACCCCCACGCTGCGCCCGCTGTGCGGGCGTGCCTGTCCCCGCCGGGACAGGCAC

>NZ_CP017404|2|2|435179-435272|CRISPRCasFinder
GTGCCTGTCCCCGCCGGGACAGGCAC	CCGGGCCCAGGAAAACCCCCACGCTGCGCCCGCTGTGCGGGC
GTGCCTGTCCCCGCCGGGACAGGCAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017404.1\|WP_033446199.1\|423706_424201_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP017404.1\|WP_010929791.1\|442355_443141_+\|crotonase/enoyl-CoA-hydratase-family-protein	unknown	unknown	gnl\|CDD\|181723
NZ_CP017404.1\|WP_019247421.1\|434549_434948_-\|GTP-binding-protein	unknown	unknown	gnl\|CDD\|234569
NZ_CP017404.1\|WP_003814681.1\|444189_445167_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176106
NZ_CP017404.1\|WP_022997984.1\|424293_425271_+\|IS481-like-element-IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP017404.1\|WP_010929789.1\|439550_440069_-\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP017404.1\|WP_010929788.1\|436361_437762_-\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
NZ_CP017404.1\|WP_010929785.1\|425466_426672_+\|sodium/glutamate-symporter	unknown	unknown	gnl\|CDD\|129314
NZ_CP017404.1\|WP_003814691.1\|441130_442363_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110
NZ_CP017404.1\|WP_010929577.1\|433467_434418_+\|IS481-like-element-IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP017404.1\|WP_003820700.1\|435917_436262_-\|TIGR01244-family-phosphatase	unknown	unknown	gnl\|CDD\|225984
NZ_CP017404.1\|WP_003814720.1\|422518_423577_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133030
NZ_CP017404.1\|WP_003814730.1\|430288_431023_-\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|235574
NZ_CP017404.1\|WP_010929786.1\|426668_428180_+\|TAXI-family-TRAP-transporter-solute-binding-subunit	unknown	unknown	gnl\|CDD\|270238
NZ_CP017404.1\|WP_003814685.1\|443207_444179_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
NZ_CP017404.1\|WP_003814701.1\|435358_435829_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NZ_CP017404.1\|WP_003814694.1\|440179_440935_+\|TerC-family-protein	unknown	unknown	gnl\|CDD\|223930
NZ_CP017404.1\|WP_003814726.1\|428195_429509_-\|short-chain-fatty-acid-transporter	unknown	unknown	gnl\|CDD\|224942
NZ_CP017404.1\|WP_019247419.1\|445292_446465_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173841
NZ_CP017404.1\|WP_003814728.1\|429699_429879_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377342

Protein	Function_ID	Function_description	E-value
NZ_CP017404.1\|WP_033446199.1\|423706_424201_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.34959e-07
NZ_CP017404.1\|WP_010929791.1\|442355_443141_+\|crotonase/enoyl-CoA-hydratase-family-protein	gnl\|CDD\|181723	PRK09245, PRK09245, crotonase/enoyl-CoA hydratase family protein.	5.15941e-155
NZ_CP017404.1\|WP_019247421.1\|434549_434948_-\|GTP-binding-protein	gnl\|CDD\|234569	PRK00007, PRK00007, elongation factor G; Reviewed.	1.37761e-90
NZ_CP017404.1\|WP_003814681.1\|444189_445167_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176106	cd08414, PBP2_LTTR_aromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LTTRs involved in degradation of aromatic compounds, such as CbnR, BenM, CatM, ClcR and TfdR, as well as that of other transcriptional regulators clustered together in phylogenetic trees, including XapR, HcaR, MprR, IlvR, BudR, AlsR, LysR, and OccR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	2.33368e-60
NZ_CP017404.1\|WP_022997984.1\|424293_425271_+\|IS481-like-element-IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.0826e-23
NZ_CP017404.1\|WP_010929789.1\|439550_440069_-\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	1.12064e-44
NZ_CP017404.1\|WP_010929788.1\|436361_437762_-\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	3.43796e-109
NZ_CP017404.1\|WP_010929785.1\|425466_426672_+\|sodium/glutamate-symporter	gnl\|CDD\|129314	TIGR00210, Sodium/glutamate_symport_carrier_protein, sodium--glutamate symport carrier (gltS). [Transport and binding proteins, Amino acids, peptides and amines].	1.2444e-106
NZ_CP017404.1\|WP_003814691.1\|441130_442363_+\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	8.36236e-118
NZ_CP017404.1\|WP_010929577.1\|433467_434418_+\|IS481-like-element-IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.02206e-23
NZ_CP017404.1\|WP_003820700.1\|435917_436262_-\|TIGR01244-family-phosphatase	gnl\|CDD\|225984	COG3453, COG3453, Uncharacterized protein conserved in bacteria [Function unknown].	3.40043e-35
NZ_CP017404.1\|WP_003814720.1\|422518_423577_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	4.18053e-89
NZ_CP017404.1\|WP_003814730.1\|430288_431023_-\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|235574	PRK05711, PRK05711, DNA polymerase III subunit epsilon; Provisional.	2.40573e-142
NZ_CP017404.1\|WP_010929786.1\|426668_428180_+\|TAXI-family-TRAP-transporter-solute-binding-subunit	gnl\|CDD\|270238	cd13520, PBP2_TAXI_TRAP, Substrate binding domain of TAXI proteins of the tripartite ATP-independent periplasmic transporters; the type 2 periplasmic binding protein fold. This group includes Thermus thermophilus GluBP (TtGluBP) of TAXI-TRAP family and closely related proteins. TRAP transporters are ubiquitous in prokaryotes, but absent from eukaryotes. They are comprised of an SBP (substrate-binding protein) of the DctP or TAXI families and two unequally sized integral membrane components. Although TtGluBP is predicted to be an L-glutamate and/or an L-glutamine-binding protein, the substrate spectrum of TAXI proteins remains to be defined. A sequence-homology search also shows that TtGluBP shares low sequence homology with putative immunogenic proteins of uncharacterized function. The substrate-binding domain of TAXI proteins belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and tworeceptor cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	9.13066e-82
NZ_CP017404.1\|WP_003814685.1\|443207_444179_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	2.06741e-117
NZ_CP017404.1\|WP_003814701.1\|435358_435829_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	9.38587e-30
NZ_CP017404.1\|WP_003814694.1\|440179_440935_+\|TerC-family-protein	gnl\|CDD\|223930	COG0861, TerC, Membrane protein TerC, possibly involved in tellurium resistance [Inorganic ion transport and metabolism].	1.14565e-78
NZ_CP017404.1\|WP_003814726.1\|428195_429509_-\|short-chain-fatty-acid-transporter	gnl\|CDD\|224942	COG2031, AtoE, Short chain fatty acids transporter [Lipid metabolism].	6.57351e-166
NZ_CP017404.1\|WP_019247419.1\|445292_446465_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173841	cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26. Putative acyl-CoA dehydrogenases (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	4.27565e-82
NZ_CP017404.1\|WP_003814728.1\|429699_429879_-\|hypothetical-protein	gnl\|CDD\|377342	pfam04391, DUF533, Protein of unknown function (DUF533). Some family members may be secreted or integral membrane proteins.	0.00323203

>NZ_CP017404.1|WP_019247421.1|434549_434948_-|GTP-binding-protein
MTRRTSIERYRNIGISAHIDAGKATTTERILFYTGITHKLGEVHEGAATMDWMEQEQGRGITITSAATTAFWRGMAGNYPEHRINIIDTPGHVDFTIEVERSMRVLDGACMVYDSVGGVQEVATVMVVLPGQ
>NZ_CP017404.1|WP_010929577.1|433467_434418_+|IS481-like-element-IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDKYNLLTVHS
>NZ_CP017404.1|WP_003814730.1|430288_431023_-|DNA-polymerase-III-subunit-epsilon
MRQIIFDTETTGLDPAQGHRIVEIGCVEIVNRMVTGNNLHLYLNPDRDSDPEALAVHGLTTEFLADKPRFAEVAEQFLAFIADAELIAHNAAFDVKFFNAELQRIGRDPLNTHCENIVDSLLHARSLHPGKRNSLDALCDRYGISNAHRTLHGALLDSQLLAEVWLAMTRGQDALLIDVDDQGANANGALVLGKFDASVLTVLAASEAELAEHAAYLQALDKAVGGACAWRAIEPLPAESGQPG
>NZ_CP017404.1|WP_003814728.1|429699_429879_-|hypothetical-protein
MHPDTNTMLIIIAAAVALMIVGFGLRDRNLGLGLLGIGLIAALATIAYKAYITFNSFYY
>NZ_CP017404.1|WP_003814726.1|428195_429509_-|short-chain-fatty-acid-transporter
MFKLMSRSAVKMVERYLPDPYVFVVLLTLVAAGAAMIIEGQTPMAVVRWWGNGFWGLLTFAMQMLLVLVTGYMLASTPLVKRMLARLASLATSAGGAIILVSVVSLAASWINWGFGLVVGALFAKQIARQVRVDYRLLVASAYSGFIIWHGGLAGSIPLTIATEGHFSADKIGIIPTGDTIFAVFNLVIVVAMFILVPLVNRLMLPDEKESVYVDPARLEEASVPASDDDKRPAARLENSRLLAWLIAAGGLAYMFDYYVVRGAGLNLNVINFSFLILAILLHGTPRRLLASLDEAIKGGAGIVIQFPFYAGIMAIMMDSGLAATLSEWFVSIASAATLPFWTFISAGIVNIFIPSGGGQWAVQSPIVISAAQALGADMPRVAMAVAWGDAWTNMLQPFWALPVLAIAGLKAKDIMGYCIIQLLVTGVIISVGLSFF
>NZ_CP017404.1|WP_010929786.1|426668_428180_+|TAXI-family-TRAP-transporter-solute-binding-subunit
MTMFIRWLILSACLLLAACSRAPDTEILQRDVGQTLAATYGPDLFDIVALRRMGSATDSTAPPGQTRRVVYYDVVLGLKKDLTLGAWDQPGAAALVSLLGAGPRSISGVKSSGNAAGDQIVAHASAIYQRDAEQWVHVAPASFTATEAPSLDTGAPPPVTRQLLQTLEQITRSVPYSASSTAQHVVQQELERSVARINGRLARLQKGYPLATGPDKGEYLAFGQALAAIGRNEQVRVIPLITGGSADNMAMLRSGAAVAALSQADIAQLAYEGKGPFESQGPFSGLRALGSLYPELVHIVVRQGDGIATVGALRGKKIALGPSGSAVRTTLETVLAAHGLQPGRDYAVIDTPAAAALPQLSEGRVDAVAQVIGTPAAPLRAALTQARLALLPLDRAAIDKLVQADPTLMALDIPANTYPSQAAAIPTVGMAALLVTTADLTRDEAAHMVDVVYRAGQDLLAAGSAQGAQVSAANAGRGLSIPLHDGAVEAFEKLGAPPLPEGR
>NZ_CP017404.1|WP_010929785.1|425466_426672_+|sodium/glutamate-symporter
MISLTPVQSLLACCLVLVAGRILTTRIGVLSRYSIPDPIVGGLLFAVLATALDTWGGIQISLETNIKPTLLLIFFGCIGLTADLKLLARGGPRLIAFLLALIPFLVLQNAVGLGLAWLLDMHPLMGLIGGTITLVGGHGTGAAYAARFADINNIQDVMALAMTAATIGLVLGGIIGGPVAEWLIRRHKLDPRMAGKDANQVLPEVETTAEAPTATSFITSLTAVFVTVVVGTYLAGLVEDAPISLPNFLWCLATGAIIRNFGGYVGIRLDDRVSEIIGSISLSLFLGLTMMTLDLSSVVRLAGPLALMLVAQALVCALYAGWAVFRMLKRDYEAAVMAAAFCGFAMGATATAIANMQALTRRHGPAPESFIVVPVTGAFLVDILNVIVLTSLIALPFVGGM
>NZ_CP017404.1|WP_022997984.1|424293_425271_+|IS481-like-element-IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHSYMVRADLAG
>NZ_CP017404.1|WP_033446199.1|423706_424201_+|GNAT-family-N-acetyltransferase
MPQSYIVRTMRPADVEAVLRVQAAVYPASLLESAALFQNRIEIAPATCQVALDGQDLIGYLIAYPWDAGLPPALDRSLERLPGAADTWFVHDCAVLPAAQGGGVAAALLAGGRAQARRLGLRRASLVALAQAVGYWLRHGYQPLADSDALRAKLAGYGDGARYM
>NZ_CP017404.1|WP_003814720.1|422518_423577_-|glycosyltransferase-family-2-protein
MFMYTEFRSQLLAGAGTSAAGQSARMAVLAGDGATGVQVSCVVPGLNEAANLRVLVPALRACLEQWCASWEIIVVDDGSTDDTAELMAQWSAVEGIRYVQLSRNFGKEAALTAGLEAADGDAVICLDADMQHPPELIGDMLAAWRNGADMVYAVRRQRDDEPWFKRVGARAFYRLLSTARGVEVPPHAGDFRLMDRRVVEALVALPERTRFMKGLYAWVGFKSQAVPYTPQARRHGASHFSAWKLFRLACDGLTAFTTWPLRLVSLIGVLFALLSLSYGGYLVADYLISGNAVSGWTTIVTALLFFAGINLISLGVVGEYVARIFDEVKGRPLFIARQRRGRAKRAAKARSQ
>NZ_CP017404.1|WP_003814701.1|435358_435829_-|universal-stress-protein
MFKKILIPTDGSPLSAQAANAGICFARSTGAEVVALHVTQPFAATIGFDGMAAAYAITDEDYEKASAEQAEKYLKLILDRAETAGVKAESRAVSNFNVADGIVQAAGEAGCDLIFIGSHGRSGLSRLLLGSVTAKVLSLAHTAVLVYRVKEDKDKK
>NZ_CP017404.1|WP_003820700.1|435917_436262_-|TIGR01244-family-phosphatase
MSAAIKPLTENFAVAPQLGPADMADVAAAGYKSVIINRPDFEGGPDQPTAADVSQAAQALGLQVEYQPVVGSAMTAADVARFAELLRTMPGPVLAYCRTGTRCTNLFAAAQQLG
>NZ_CP017404.1|WP_010929788.1|436361_437762_-|PLP-dependent-aminotransferase-family-protein
MRQADATLVTQLADDLARRIDEHGLRPGTRLPSIRRMAEQSGVSRFTVVEAYDRLVARGLVQSRHGAGFFVRARSASLTALASARVPQAAPETPVRVDVSWLLRNMFRETAAGMPGGAGLLPPEWLDPDMVAAAVRAVGRTVRGNLVSYGSPQGYAPLRQQLASMLQADGVPAHPERNLLTTNGVTHGLDIVARHLIKPGDTVLVEDPAWFVIFGRLAAFGARPVGVPRGPDGPDLAMLDRLAAEHKPRLYIINGAVHNPIGHTLSAGAAYDILRLAERHDFMVVEDDTYADLHPGGAMKLAALDRLERVILVGGFSKMLAASLRVGYIAAGAETLQRLTDLKMLAGLTSPELGERVVHRVLVEGQYQRHIERVRARVNEARLRSIQALQQLGLSVPHEPHAGMFVWADCGRDSEPVARNAAERGMLLAPGTLFSPSGAPSTMLRFSVAMVDTPGIWQSIAAVMAQ
>NZ_CP017404.1|WP_010929789.1|439550_440069_-|MgtC/SapB-family-protein
MDTVWMEIWTTVRNEFADIPDVAEATRIVLRLGMAVALGGLLGYERERSGKAAGLRTHMLVALGAALFVLVPLQGGMEVGDLSRVLQGVIAGIGFLGAGVIIKLGNEGEIRGLTTSAGIWLTAAIGVAAGMGREATALASTLIALFVLAALRRLEKRIAARDDKRVVAQPPP
>NZ_CP017404.1|WP_003814694.1|440179_440935_+|TerC-family-protein
MDYLVSLAQQPAAWAALATLIAMEVVLGIDNLIFISILTNKLPPQHQTKARRIGIGMALILRLALLGTVAFIVQLTQPVFELFGHGFSWRDVILVAGGLFLVWKATKEIHHHVDPNPGDDMFGGKAATLGFAAAVAQILMLDLVFSIDSIITAVGMTEHIPIMFVAVIVAVAVMLLAAEPLARFIERNPTVVMLALAFLMMIGMTLIAEGFGAHVPKGYIYAAMAFSALVEGLNMMARRAREGRGAGAAGG
>NZ_CP017404.1|WP_003814691.1|441130_442363_+|CoA-transferase
MSGPLEGVRILDVTTVLMGPYATQILGDLGADVIKVEPPAGDNVRGIGPGRHADMGGIFLHANRSKRSIALDLKNPAGREALLKVAATCDVLVYNVRPQAMARLGLSYAEVAQANPSILYVGMYGYDQRGPYAARAAYDDLIQGAVGIPSLSVEAGSDIPRYAPSAMVDRIVGISAANAVTAGLYHRARTGQGQAIDVPMFETMAHLILGDHMMGQTFEPPLGPPGYPRILNADRRPYATRNGHICVLLYADKHWKAFFELIGQPGRDAADPRFRDIGTRTQHIHAIYRLVSDAIASRTTEEWLAAFEAADIPAMPVHTMASLLRDPHLEAIGFFGMVDHPSEGAVRMMAVPSRWSGTPPQPRGHAPRLGEHSVDVLKEAGYDDEAIAALVRNGAAIAAARQLPEGTDHD
>NZ_CP017404.1|WP_010929791.1|442355_443141_+|crotonase/enoyl-CoA-hydratase-family-protein
MTDFLRHERHGGVLLLTMDRERTRNALSDADAVEALVQACARIGADLSVRAVVLTGSHGVFSSGGNLKTLSDTVGAGLGEPVHSLQAYRSGIQRIPLALYNLEVPTIAAVNGPAIGAGCDLACMCDIRLAARQASFAESFVKLGLTPGDGGAWLLPRIVGMSRACELAFTGRSIDAARARELGLVSEVFDADALLPAALALAQEIAQHSGHALRLTKRLLREGQHTRLDTLLELSAGFQALAHHTQEHAGALDAHLSRKRG
>NZ_CP017404.1|WP_003814685.1|443207_444179_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MHSRTLALALLSVAALAQGGSARAASDYPAHPVKIIVSLPPGSGADTTARFLSKHLAERFKQPFVVENRPGGNSFIAAQAVATAPPDGYTLFVASNSPMTTNAAVFKNLPYDAVKDFAPVAPIARFPMALVVPANSPYRSVADLVAAARAAPGQLNFASGTATYQVVLELFHEQNGIKATHVPYKGTSAALADVAGGVVQYSVADVSAALPLIRGGKLRPLAVTSTRRIKDLPDVPTMQESGNKGFEAYAWTAAFFPAKVDPAIVARVSDAVQALVRSQEGKAFMEQLGGEPFVGGPDTLAAFQRDELASMRRIAKLANIQQE
>NZ_CP017404.1|WP_003814681.1|444189_445167_-|LysR-family-transcriptional-regulator
MWTGQYIVHIASPAHHWRRAVELRQLKQLLVLSETLNFHRAAERLHMAQPPLSTAIKKLEQELGVQLFERLPAGLQPTPAAEVVLRYARATLFYADEIQRAAQEGASGKQGMLKVGFVGSSIYSLMPQLLSAFRKDYPRVDLVIEESTTVDLLRRLDAHTLDVALVRFPVLEPSTARITLLQADHLMLAVPAGSRYAQRDDVALDELADEPFIGYSRTHVPGMHALIMYAFQQYGVVPHIAQEAIQVQTILSLVESGLGLAIVPKVACRQAGSGVRLVNVPQLAETIKVGIALAVHPDNATPTTANFVDMACRLMQTEPAAGQAR
>NZ_CP017404.1|WP_019247419.1|445292_446465_+|acyl-CoA-dehydrogenase
MGAILGTIIEALQLAAIPAHDEALRPAVRAFLDEALREMPADRRARSWMGHDAEFSRALARQGWLGLTLPVEYGGAGRSNFARFVLSEELLAVGAPVSAHWVADRQTAPLILRFGSPAQRAFYLPRIIRGEAFFAIGMSEPDTGSDLASVRTRATPVADGWLLNGRKIWTTNAHRSHYMCALVRTSGAPEDRHRGLSQMIFDLALPGIEIRPIRDIAGDAHFCEVLFDNVLLPHDALVGEEGSGWRQVMAELALERSGPERIYSSMVLLDGWLAHLRCDAAPQRAQVCLAGRLAARLAVLRSMSLAVSQRLEQGADASLAAVLVKDLGTEFEQAVPELIGQALHASPQPAPDDVLMRTLAYLTLINPTFSLRGGTRHILRGIIARELGLR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP017404_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017404_3

1002657-1002751

Orphan

Consensus_repeat	Method
TAAAAGGGCACCCGCAAGGGTGTCCTTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP017404_3

>merge|NZ_CP017404|3|1002657-1002751|CRISPRCasFinder
TAAAAGGGCACCCGCAAGGGTGTCCTTTTATTGCGAAAAGATATCTGGAAGAAAGCCTTTTCAGAGTAAAAGGGCACCCGCAAGGGTGCCTTTTT

>NZ_CP017404|3|3|1002657-1002751|CRISPRCasFinder
TAAAAGGGCACCCGCAAGGGTGTCCTTTT	ATTGCGAAAAGATATCTGGAAGAAAGCCTTTTCAGAG
TAAAAGGGCACCCGCAAGGGTGCCTTTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017404.1\|WP_010930111.1\|988167_989097_+\|electron-transfer-flavoprotein-subunit-alpha	unknown	unknown	gnl\|CDD\|224936
NZ_CP017404.1\|WP_003813315.1\|1002209_1002590_+\|50S-ribosomal-protein-L19	unknown	unknown	gnl\|CDD\|235418
NZ_CP017404.1\|WP_010930119.1\|1009020_1009752_+\|rRNA-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|224108
NZ_CP017404.1\|WP_010930121.1\|1011528_1014708_+\|efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|273335
NZ_CP017404.1\|WP_003821528.1\|992080_993115_+\|sulfate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224529
NZ_CP017404.1\|WP_023852693.1\|999215_1000490_+\|PA0069-family-radical-SAM-protein	unknown	unknown	gnl\|CDD\|275263
NZ_CP017404.1\|WP_029443805.1\|1009803_1010721_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP017404.1\|WP_023852686.1\|1000643_1001024_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017404.1\|WP_010930118.1\|1004676_1005726_+\|NADP(H)-dependent-aldo-keto-reductase	unknown	unknown	gnl\|CDD\|381320
NZ_CP017404.1\|WP_010930113.1\|996819_997728_+\|sulfate-adenylyltransferase-subunit-CysD	unknown	unknown	gnl\|CDD\|235375
NZ_CP017404.1\|WP_010926548.1\|1008388_1008961_-\|chorismate-lyase	unknown	unknown	gnl\|CDD\|225703
NZ_CP017404.1\|WP_010930112.1\|994957_996022_+\|sulfate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213263
NZ_CP017404.1\|WP_005012067.1\|1003621_1004572_-\|IS481-like-element-IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP017404.1\|WP_070797681.1\|1014704_1015919_+\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|273830
NZ_CP017404.1\|WP_014905652.1\|1001031_1001904_-\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|274527
NZ_CP017404.1\|WP_010930123.1\|1015988_1016240_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NZ_CP017404.1\|WP_003821527.1\|989340_991167_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173842
NZ_CP017404.1\|WP_003813314.1\|1002800_1003526_+\|CoA-pyrophosphatase	unknown	unknown	gnl\|CDD\|239518
NZ_CP017404.1\|WP_010930320.1\|1005863_1006880_-\|IS110-like-element-IS1663-family-transposase	unknown	unknown	gnl\|CDD\|376773
NZ_CP017404.1\|WP_003813333.1\|991249_991891_+\|peroxiredoxin	unknown	unknown	gnl\|CDD\|239314

Protein	Function_ID	Function_description	E-value
NZ_CP017404.1\|WP_010930111.1\|988167_989097_+\|electron-transfer-flavoprotein-subunit-alpha	gnl\|CDD\|224936	COG2025, FixB, Electron transfer flavoprotein, alpha subunit [Energy production and conversion].	1.05379e-120
NZ_CP017404.1\|WP_003813315.1\|1002209_1002590_+\|50S-ribosomal-protein-L19	gnl\|CDD\|235418	PRK05338, rplS, 50S ribosomal protein L19; Provisional.	1.34063e-62
NZ_CP017404.1\|WP_010930119.1\|1009020_1009752_+\|rRNA-pseudouridine-synthase	gnl\|CDD\|224108	COG1187, RsuA, 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases [Translation, ribosomal structure and biogenesis].	7.73356e-72
NZ_CP017404.1\|WP_010930121.1\|1011528_1014708_+\|efflux-RND-transporter-permease-subunit	gnl\|CDD\|273335	TIGR00915, Probable_aminoglycoside_efflux_pump, The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family. Proteins scoring above the trusted cutoff (1000) form a tight clade within the RND (Resistance-Nodulation-Cell Division) superfamily. Proteins scoring greater than the noise cutoff (100) appear to form a larger clade, cleanly separated from more distant homologs that include cadmium/zinc/cobalt resistance transporters. This family is one of several subfamilies within the scope of pfam00873. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Unknown substrate].	0
NZ_CP017404.1\|WP_003821528.1\|992080_993115_+\|sulfate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224529	COG1613, Sbp, ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism].	0
NZ_CP017404.1\|WP_023852693.1\|999215_1000490_+\|PA0069-family-radical-SAM-protein	gnl\|CDD\|275263	TIGR04470, hypothetical_protein_ALIPUT_00462, radical SAM mobile pair protein B. Members of this family are the downstream member (B) of a pair of tandem-encoded radical SAM enzymes. Most of these radical SAM gene pairs have an additional upstream regulatory gene in the MarR family. Examples of high sequence identity (over 96 percent) from cassettes in several Treponema species of the oral cavity to those in multiple Firmicutes in the gut microbiome suggest recent lateral gene transfer, as might be expected for antibiotic resistance genes. The function is unknown.	4.71758e-24
NZ_CP017404.1\|WP_029443805.1\|1009803_1010721_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.56316e-67
NZ_CP017404.1\|WP_010930118.1\|1004676_1005726_+\|NADP(H)-dependent-aldo-keto-reductase	gnl\|CDD\|381320	cd19094, AKR_Tas-like, Escherichia coli Tas protein and similar proteins. Escherichia coli Tas protein is the prototype of this family. It is an NADP(H)-dependent aldo-keto reductase that catalyzes the reversible reduction of ketones to the respective alcohols using NADP(H) as a hydride donor.	0
NZ_CP017404.1\|WP_010930113.1\|996819_997728_+\|sulfate-adenylyltransferase-subunit-CysD	gnl\|CDD\|235375	PRK05253, PRK05253, sulfate adenylyltransferase subunit CysD.	0
NZ_CP017404.1\|WP_010926548.1\|1008388_1008961_-\|chorismate-lyase	gnl\|CDD\|225703	COG3161, UbiC, 4-hydroxybenzoate synthetase (chorismate lyase) [Coenzyme metabolism].	1.05194e-17
NZ_CP017404.1\|WP_010930112.1\|994957_996022_+\|sulfate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|213263	cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter. Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	3.07125e-165
NZ_CP017404.1\|WP_005012067.1\|1003621_1004572_-\|IS481-like-element-IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	8.66858e-23
NZ_CP017404.1\|WP_070797681.1\|1014704_1015919_+\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	1.50968e-87
NZ_CP017404.1\|WP_014905652.1\|1001031_1001904_-\|EamA-family-transporter	gnl\|CDD\|274527	TIGR03340, phn_DUF6, phosphonate utilization associated putative membrane protein. This family of hydrophobic proteins has some homology to families of integral membrane proteins such as (pfam00892) and may be a permease. It occurs in the vicinity of various types of operons for the catabolism of phosphonates in Vibrio, Pseudomonas, Polaromonas and Thiomicrospira.	3.74356e-26
NZ_CP017404.1\|WP_010930123.1\|1015988_1016240_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	2.42408e-12
NZ_CP017404.1\|WP_003821527.1\|989340_991167_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173842	cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases similar to fadE5. Putative acyl-CoA dehydrogenase (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	6.94362e-153
NZ_CP017404.1\|WP_003813314.1\|1002800_1003526_+\|CoA-pyrophosphatase	gnl\|CDD\|239518	cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative stress. CoAse has a conserved Nudix fold and requires a single divalent cation for catalysis. In addition to a signature Nudix motif G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val, CoAse contains an additional motif upstream called the NuCoA motif (LLTXT(SA)X3RX3GX3FPGG) which is postulated to be involved in CoA recognition. CoA plays a central role in lipid metabolism. It is involved in the initial steps of fatty acid sythesis in the cytosol, in the oxidation of fatty acids and the citric acid cycle in the mitochondria, and in the oxidation of long-chain fatty acids in peroxisomes. CoA has the important role of activating fatty acids for further modification into key biological signalling molecules.	5.50907e-72
NZ_CP017404.1\|WP_010930320.1\|1005863_1006880_-\|IS110-like-element-IS1663-family-transposase	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	4.79535e-23
NZ_CP017404.1\|WP_003813333.1\|991249_991891_+\|peroxiredoxin	gnl\|CDD\|239314	cd03016, PRX_1cys, Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine. They are homodimeric thiol-specific antioxidant (TSA) proteins that confer a protective role in cells by reducing and detoxifying hydrogen peroxide, peroxynitrite, and organic hydroperoxides. As with all other PRXs, a cysteine sulfenic acid intermediate is formed upon reaction of 1-cys PRX with its substrates. Having no resolving cysteine, the oxidized enzyme is resolved by an external small-molecule or protein reductant such as thioredoxin or glutaredoxin. Similar to typical 2-cys PRX, 1-cys PRX forms a functional dimeric unit with a B-type interface, as well as a decameric structure which is stabilized in the reduced form of the enzyme. Other oligomeric forms, tetramers and hexamers, have also been reported. Mammalian 1-cys PRX is localized cellularly in the cytosol and is expressed at high levels in brain, eye, testes and lung. The seed-specific plant 1-cys PRXs protect tissues from reactive oxygen species during desiccation and are also called rehydrins.	3.35179e-132

>NZ_CP017404.1|WP_003813315.1|1002209_1002590_+|50S-ribosomal-protein-L19
MNLIAILEQEEIARLTGGNAVTEFAPGDTVVVSVNVVEGTRKRVQAFEGVVIAKRNRGLNSSFIVRKISSGEAVERTFQLYSPQIAGIEVKRRGDVRRAKLYYLRSRSGKSARIKEKLVLKKAKSA
>NZ_CP017404.1|WP_014905652.1|1001031_1001904_-|EamA-family-transporter
MSYTSLILVVLAAMAHAAWNLLAKRAAMVGPMFVFAYGLAATILYAPWVIWVLAHDGMVWSWPVVLCILASSMLHLGYSLCLQRGYQVADLSVVYPIARGTGPLLSTMGAFTLLSEPATTTGIAGMLCVVGGVLLIATQGRLGMFRQAQAWIGVRWGVVIGLFIAAYTVVDAYGVKILLIMPVLFDWFTCATRTLMMTPHVLRRRAQYWPAMRGYWHLAIAVGVLSPLGYILVLYALRNGAPLSLVAPAREMSMMLGTLAGMFLLREKVGIGRLAGCLAILAGVVLLGSS
>NZ_CP017404.1|WP_023852686.1|1000643_1001024_+|hypothetical-protein
MTIATTLDAATSLPTAVPGRTLGALRRLARAWAGAAVPQRKWPFPPTPPGQAQPCTPCTDSQPRSVQAVQPAQARALHAQAELSGAATQAATQVLSTKAKIIDVLLVAVWGAMIPALMWLGAAGGF
>NZ_CP017404.1|WP_023852693.1|999215_1000490_+|PA0069-family-radical-SAM-protein
MASTEHSFSAGFGSPAAAPAALRGRGAVTNVPHRFQQADRVRVDDGWANPDYTAGSDAAALPSVAEALGQGGRRAIPIAVEGADASPNTCAQAPAPRTIVQAEEARKMLSRNDSPDIPFDVAANPYRGCEHGCVYCYARPTHAYLGYSPGLDFETRLVAKANAVAALRAELARPGYRASPINIGSATDAYQPIERTWRLTRGMLELLLQTRHPLTVVTKNALVERDLDLLQDLARQKLVTVFVSITTLDAAMARTLEPRASAPYRRLQTVRTLAQAGVPVGVLVAPVIPFINDESLEHILQEASAAGACYASYTVLRLPWEVKEVFETWLQAHFPDRAQRVLHRIEDLRNGRRNDTAFGSRMRGTGIWADLLRQRFALATRKLDLNRHRPELDTHRFVPPLEPGLPPARGRREARAQPGQLALF
>NZ_CP017404.1|WP_010930113.1|996819_997728_+|sulfate-adenylyltransferase-subunit-CysD
MSAVMTRSHLDWLESEAIFILREVAAECARPALLFSGGKDSVVLLRLAEKAFRPGRFPFPLLHIDTGHNYDEVISFRDARAAELGETLLVRSVEDSIARGSVALRRETDSRNAAQAVTLLEAIEELGLDACIGGARRDEEKARAKERIFSFRDEFGQWDPKAQRPELWNLFNTRVHRGENMWVFPISNWTELDVWQYIQRERLALPSIYYSHTREVVRRKGLLVPVTRLTPPAEGETVEQLAVRFRTVGDISCTCPVASDAADPAAIIAETAVTDITERGATRMDDQTSEASMERRKREGYF
>NZ_CP017404.1|WP_010930112.1|994957_996022_+|sulfate-ABC-transporter-ATP-binding-protein
MSIEVRGLSKRFGAFRALDEVSLHIETGELVALLGPSGCGKTTLLRIIAGLESADAGSVLFAGEDATEVDVRQRQVGFVFQHYALFKHMTVFENVAFGLRVRHRSQRPSEARIRAKVLDLLGLVQLDWLADRYPAQLSGGQRQRIALARALAVEPRVLLLDEPFGALDAKVRKELRRWLRRLHDELHVASVFVTHDQEEALEVTDRVVLMNAGRIEQVGSPREVWERPATPFVYGFLGDVNQLHGHATRGVWRLGEVALPAPDLPEADNQRAIAYVRPHDIDLARAGTAAPGIPVRLNHVYLAGPSAYLELARQDDQAIIEAQVPEPLFRSLGLKEGEALLAQPRRARVFAVQP
>NZ_CP017404.1|WP_003821528.1|992080_993115_+|sulfate-ABC-transporter-substrate-binding-protein
MPRNTAGIRGAIVALATVFSLGLPWAVQAQDKQTLLNVSYDPTRELYRAVDEAFIKEYQARAGVDLTVRQSHGGSGRQARSVIDGLDADVVTLALAYDIDAIADRGLLPQDWQKRLPRNSSPYTSTIVFLVRKGNPRQIHDWDDLVKDGVQVITPNPKTSGGARWNYLAAWAYALARNEGSEAKAREFVGQLLSHVPVLDTGARGSTTTFVERGVGDVLLAWENEAFLAREELGPDKFDIVVPSLSILAEPPVAVVDKVVDRKGTRAAAQAYLEYLYTPAAQEIIARNFYRPTDAGVAAKYASRFPKLKLVTIDDPIFGGWRKAQKDHFSDGGTFDQVYQPQRK
>NZ_CP017404.1|WP_003813333.1|991249_991891_+|peroxiredoxin
MGQLRLGDTAPDFEQKSSIGPLRLYDYLGDSWGVLFSHPADFTPVCTTELGYTAKLAGEFAKRNVKVLALSVDPVDSHTKWIDDINDTQSTTVNFPILADDDRKVSELYDMIHPNANATLTVRSVFVIDPAKKVRLTITYPASTGRNFDEILRVIDSLQLTDSHSVATPVNWKDGEDVIIVPSLKDEAVIKEKFPKGYKALRPYLRITPQPNK
>NZ_CP017404.1|WP_003821527.1|989340_991167_+|acyl-CoA-dehydrogenase
MTYATPLQDFRFALNELAGLEEILKLPGFEEVTPDLVDAILEENARFVQQAIAPLNVAGDTKPPVWNDGQVTTTPGFSQGFADYTAGGWQGLQHPQKWGGQGLPKVVAAPAGENIQAASLAFSLCPMLTDGVIEALLTVGSEAQRQTYVPKLIGGQWTGTMNLTEPQAGSDLAQVATRAVRQDDGSYRLSGQKIFITYGEHDLAENIIHLVLARTPDAPAGVKGISLFIVPKYLVNEDGSRGKRNDVWCASLEHKLGIHGSPTAVLLYGAGKGEVGEGAVGYLVGEANRGLEYMFIMMNAARYSVGQQGIGVSERAYQHAQAYARERVQGRAIEGSAAPVTIAHHPDVQRMLLTMRALTEAARAVSYVAAAAHDKGTHHPDAEVRARNRAFYEYLVPIVKGFSTESAVEVASLGIQVHGGMGFIEETGAAQHYRDARILPIYEGTTAIQANDLVGRKTLRDGGATAHASIAAMRDTLKAVAAEAQRADTADHTALRVLRDNFDQAIQSYEGAVEFILAHAASNVRAVYSSSVPYLMLAGVVHGGWQMARAALACRRHLAAGSGDAFHRHKLGTALFYGAHILPRALALAAAVRAGDVADSCGSMADIA
>NZ_CP017404.1|WP_010930111.1|988167_989097_+|electron-transfer-flavoprotein-subunit-alpha
MTTLVIAEHDNAQLKGATLNTIAAASRLGGEVHVLVAGSGAQAVAEQAAQAARVSKVLLADAPQLAEGLAENLAAQVLAVAGGYSHILFAATASGKNVAPRVAAKLDVAQISDIIGVESADTFQRPIYAGNAIATVQSGDAVKVITVRTTGFDAVAAQGGSAAVEALDAVADSGLSRFVGREVAKSDRPELAGARVVVSGGRGLGSAENFKILDPLADKLGAALGASRAAVDAGYAPNDWQVGQTGKIVAPQLYVAVGISGAIQHLAGMKDSKVIVAINKDPEAPIFGVADYGLVGDLFQVVPELTGAL
>NZ_CP017404.1|WP_003813314.1|1002800_1003526_+|CoA-pyrophosphatase
MSDSAPSRPRRTPVRPLFDPMAQPWETANQGLARVDERLLTPPELRSSLRPADHWRLDPLCAAEPRAPGREGSLVAAAVLIPLVMRADGVRVMLTQRAAHLHDHAGQVSFPGGRIEVSDATPVAAALREAQEETGLPVQQVEVLGSMPQYFTATGFAITPVVSLVQPDFELAPDAFEVAEVFEVPLSFLMDPANHRLYRAALPDGYVRQYYAMPWQRYFIWGATAGMLRNLYQTVREALPG
>NZ_CP017404.1|WP_005012067.1|1003621_1004572_-|IS481-like-element-IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS
>NZ_CP017404.1|WP_010930118.1|1004676_1005726_+|NADP(H)-dependent-aldo-keto-reductase
MKYRKLGHTDLDVSLIGLGTMTWGEQNTEAQAHEQLDYALAHGINLVDAAEMYPVPPKPETQGRTESCIGSWLARTGRRHEVVLASKAAGPVRDAKRPSHIRDGKTFLDRKNLTQALDASLKRLQTDYLDLYQLHWPDRTTNTFGKLAYPWVDDAHTVPIEETLEVLQDFVRAGKVRHVGLSNETPWGVARFLQAAEKHGLPKVATIQNPYNLLNRIFEIGLAEFSHREGVGLLAYSPLAMGILSGKYLDGARPEGSRLALFTRFTRYSNPQAEAAARDYVMLARDHGLAPAQMALAWVNQRPFVSSNLMGATTLAQLKENIESVEVTLSDEVLQGIEAIHARQPNPAP
>NZ_CP017404.1|WP_010930320.1|1005863_1006880_-|IS110-like-element-IS1663-family-transposase
MADSSLLSAGGQVHVFIGIDVSKAKLDCTLLTAEADKRKTKAVVNTAAGVQALLAWCAKHGAQPAQLHAILEPTGLYHEQAATALPQVRVSLVNPAQARDFAKALALRSKNDALDSYVLARYGQTLSPALWHPAPLHARQLRALLTRREALSKDLLRELNRKEKSQFSPSAPLVDGSIDKAIAFLREQIKQIERAIDQHIDNHPDLKQDCELLNSIPAIGPQAGNAILAVMHNRHIDSAQSLAAYLGVVPVQRQSGSSLNSCARLSKAGPSQVRATLYMAALVGTRHNPHIRALYQRLLKAGKSKKAALGAAMRKLVHLCFGVLKNRIPYQPNYAMNG
>NZ_CP017404.1|WP_010926548.1|1008388_1008961_-|chorismate-lyase
MTTPIPLARGWLPAAPSTLDPLRKYWLFRPGALTAGLRQLGHVRLRVLAEYPTGAPRDEADGMRIAAQSPVWVREVLMSIDGVDSVVARSLTPLRASHGVWQGMRRLLTRPLADMLYHDPGIHRSVFVCRRLAAGVPFHATAIARAPAGGPEPALWARRSAFWRAGQPLLVAECFLPAFWSLARAPVAPR
>NZ_CP017404.1|WP_010930119.1|1009020_1009752_+|rRNA-pseudouridine-synthase
MEKVRISKLMSERGLCSRREADSYIERGWVRVDGVVVSELGARALPDQVITLERAAAARQTARVTILLHKPVGYVSGQAEKGYTPAVALIDARSRYAGDRAPQRFERGQLQGLAVAGRLDIDSQGLLVLTQDGRIAKKLIGEDSEVDKEYLVRVQGRLSEAGLALLNHGLSLDGKPLRPAQVRWQNADQLRFVLREGKKRQIRRMCELVGLRVVGLKRVRIGRVSLGDLPAGQWRYLRADERF
>NZ_CP017404.1|WP_029443805.1|1009803_1010721_-|LysR-family-transcriptional-regulator
MELFVEVARTLSFGRAAENLAIPKSTLSRQVAELERSVGLRLLSRTTRRVELTEAGQLYFERCQRIVAEARIAHEELQNLVETPSGPLRVNMPADFGTDFLSEAFTEFSRRYPEVTFYLDLASPEHAERVFQTCDVSIEIGDLPDSTHIARLLGVLPAHLYASPDYLARHGEPQHPDDLPRHECIQFRAGTGRVTRWPLNSGERHVEITPGNRFSVNSVSMVRNLATLGAGIAILAPMGNVREDIESGRLKRILPDWLAGPFPVYAVTDTRMLPAKTRIFVEFLMERLSNKTLAGQNNPAFLNLR
>NZ_CP017404.1|WP_010930121.1|1011528_1014708_+|efflux-RND-transporter-permease-subunit
MAKFFIDRPVFAWVIAIVLMMAGALSILSLPVAQYPNIAPPAISINVTYPGASAQTVQDTVVQVIEQQMNGIDNLQYISSESNSDGSMSITLTFSQGTNPDTAQVQVQNKLAVAQPLLPLEVQQQGIRVTKATKNFLIVAGFVSTDGTMDKSDLADYVASYIQDPISRTPGVGNFQLFGAPYAMRIWISPEKLVNFGLTASDVTTAIREQNVQVSSGQLGGQPAVRGQQLNATVIGPSRLQTPEAFGRILLKVNRDGSQVRLKDVASIELGAQTYAIDSYYNGKPASGLAIKLASGANALDTAQAVRETINGLKPYFPPGMDVVYPYDTTPFVSLSIEGVVKTLFEAVLLVFLVMYLFLQNVRATLIPTLAVPVVLLGTFGVLAAFGYSINTLTMFGMVLAIGLLVDDAIVVVENVERVMAEEGLSPRQATRKSMGQITGALIGIAMVLAAVFVPMAFFGGSTGVIYRQFSITIVSSMVLSVVVAIVFTPALCATMLKPIPKGHHGSKKGFFGWFNRTFERSSQAYANNVARSMGRTKRLLLIYVVILLGMAWMFMRIPTAFLPDEDQGILFAQVQAPAGATSERTQATIDAAVKYLLEDEKESVASVFAVNGFSFGGRGQNAAILFIKLRDWNERKGAEHRAAAVAARANAKFRAELRDAQAAVFAPPAVMELGNATGFDFQLQDRAGVGHEKLLAARNQLLQEAGASPMLVAVRPNGIEDAPQYQLDIDREKARALGVSITEINNTLATAWGSSYVNDFIDRGRVKKVFVQGEASSRMLPQDLDKWYVRNNAGDMVPFSAFSSAQWTFGPQKLNRYNGVPSYNIQGQAAPGYSSGDAMAEMERLADKLPLGIGYDWTGLSFEERLSGAQAPALYAISLIVVFLCLAALYESWSIPTAVMLVVPLGVVGALLATMTRGLSNDVYFQVGLLTTIGLAAKNAILIVEFAKEHYEEGASLTEAAVHAARQRLRPILMTSLAFILGVVPLAISTGAGSGSQNAIGTGVIGGMLTGTFLAIFFVPLFFVLTLRLFKVKRASENREDDDPHGGAQPATHGGQPQ
>NZ_CP017404.1|WP_070797681.1|1014704_1015919_+|efflux-transporter-outer-membrane-subunit
MKPVVMRTLLSLAVATALAGCSLANNRDLRVAALNVEAARLNPSGQAGISRSYQVGASLSTWELDLFGRIRSLSEQALQLYLAQDETRLATQLTLVAETANAYLTLRADQELLALTRQTLAAQQESYKLTRQSYDLGVATELDLSQAEISLRTAERNLSQYTRMAAQDRNALVLLVGQPLPAGIGAQLDQAVALPDGVVLADLPAGLPSDLLARRPDIRAAEHQLQAANASIGAARAAFFPRISLTGSAGTASASLGGLFDAGSGAWSFAPQISVPIFAGGALRASLDLAKIQKDIGIARYEQAIQSGFREVSDALAGRGTLQEQIRSQELLVQANQRAYDLSQQRYQQGIDNYLSVLDSQRSLYTAQQTLVETRLARLSNLIQLYKALGGGWSERTVAAAQAG
>NZ_CP017404.1|WP_010930123.1|1015988_1016240_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MNIIIMIIVGFVVGLITRAIMPGDQNMGYIMTTILGIIGSVVAGFLGQQLGWYAPGEPAGWIGSVVGAIIVLFVVGLVAKKRA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP017404_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017404_4

3582457-3582566

Orphan

Consensus_repeat	Method
TTGACTGCCAAGACGGTATCTGTCCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP017404_4

>merge|NZ_CP017404|4|3582457-3582566|CRISPRCasFinder
TTGACTGCCAAGACGGTATCTGTCCCCGCAGGGAGGGTGCCTGTCCCCGCCGGGACAGGCACACTGCTGTACGCCATCGACGCTTGACGGCCAAGACGGTATCTGTCCCC

>NZ_CP017404|4|4|3582457-3582566|CRISPRCasFinder
TTGACTGCCAAGACGGTATCTGTCCCC	GCAGGGAGGGTGCCTGTCCCCGCCGGGACAGGCACACTGCTGTACGCCATCGACGC
TTGACGGCCAAGACGGTATCTGTCCCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017404.1\|WP_010930179.1\|3584849_3585800_-\|IS481-like-element-IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP017404.1\|WP_023994844.1\|3583782_3584754_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP017404.1\|WP_010931354.1\|3576802_3577270_-\|ribonuclease-HI	unknown	unknown	gnl\|CDD\|178927
NZ_CP017404.1\|WP_010931355.1\|3577312_3578083_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|369777
NZ_CP017404.1\|WP_010931360.1\|3589446_3590502_-\|cytochrome-d-ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|376764
NZ_CP017404.1\|WP_010931357.1\|3583097_3583778_+\|tellurite-resistance-TerB-family-protein	unknown	unknown	gnl\|CDD\|377342
NZ_CP017404.1\|WP_003814742.1\|3582567_3582960_-\|OsmC-family-protein	unknown	unknown	gnl\|CDD\|224679
NZ_CP017404.1\|WP_010931361.1\|3590498_3591839_-\|cytochrome-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|376587
NZ_CP017404.1\|WP_019247959.1\|3568074_3571053_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375438
NZ_CP017404.1\|WP_010931356.1\|3578914_3580324_+\|transglycosylase-SLT-domain-containing-protein	unknown	unknown	gnl\|CDD\|182727
NZ_CP017404.1\|WP_005013747.1\|3566770_3567721_-\|IS481-like-element-IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP017404.1\|WP_010927010.1\|3588005_3589430_+\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|236531
NZ_CP017404.1\|WP_005013747.1\|3575855_3576806_+\|IS481-like-element-IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP017404.1\|WP_010927090.1\|3578103_3578904_+\|hydroxyacylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|274569
NZ_CP017404.1\|WP_003820957.1\|3591954_3593718_+\|glutamine--tRNA-ligase/YqeY-domain-fusion-protein	unknown	unknown	gnl\|CDD\|235424
NZ_CP017404.1\|WP_003814239.1\|3587304_3588006_+\|response-regulator	unknown	unknown	gnl\|CDD\|181883
NZ_CP017404.1\|WP_010931362.1\|3593829_3594708_+\|septum-site-determining-protein-MinC	unknown	unknown	gnl\|CDD\|178806
NZ_CP017404.1\|WP_003814739.1\|3580418_3581204_+\|enoyl-ACP-reductase-FabI	unknown	unknown	gnl\|CDD\|180789
NZ_CP017404.1\|WP_005013747.1\|3573924_3574875_+\|IS481-like-element-IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP017404.1\|WP_003818344.1\|3571979_3572858_+\|fatty-acid-desaturase	unknown	unknown	gnl\|CDD\|366126

Protein	Function_ID	Function_description	E-value
NZ_CP017404.1\|WP_010930179.1\|3584849_3585800_-\|IS481-like-element-IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	7.3142e-23
NZ_CP017404.1\|WP_023994844.1\|3583782_3584754_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	2.71001e-129
NZ_CP017404.1\|WP_010931354.1\|3576802_3577270_-\|ribonuclease-HI	gnl\|CDD\|178927	PRK00203, rnhA, ribonuclease H; Reviewed.	4.07937e-102
NZ_CP017404.1\|WP_010931355.1\|3577312_3578083_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	9.0439e-10
NZ_CP017404.1\|WP_010931360.1\|3589446_3590502_-\|cytochrome-d-ubiquinol-oxidase-subunit-II	gnl\|CDD\|376764	pfam02322, Cyt_bd_oxida_II, Cytochrome bd terminal oxidase subunit II. This family consists of cytochrome bd type terminal oxidases that catalyze quinol-dependent, Na+-independent oxygen uptake. Members of this family are integral membrane proteins and contain a protohaem IX centre B558. One member of the family, Klebsiella pneumoniae CydB, is implicated in having an important role in micro-aerobic nitrogen fixation in the enteric bacterium Klebsiella pneumoniae. The family forms an integral functional unit with subunit I, family Bac_Ubq_Cox, pfam01654.	1.57809e-49
NZ_CP017404.1\|WP_010931357.1\|3583097_3583778_+\|tellurite-resistance-TerB-family-protein	gnl\|CDD\|377342	pfam04391, DUF533, Protein of unknown function (DUF533). Some family members may be secreted or integral membrane proteins.	5.6465e-62
NZ_CP017404.1\|WP_003814742.1\|3582567_3582960_-\|OsmC-family-protein	gnl\|CDD\|224679	COG1765, COG1765, Predicted redox protein, regulator of disulfide bond formation [Posttranslational modification, protein turnover, chaperones].	4.86152e-16
NZ_CP017404.1\|WP_010931361.1\|3590498_3591839_-\|cytochrome-ubiquinol-oxidase-subunit-I	gnl\|CDD\|376587	pfam01654, Cyt_bd_oxida_I, Cytochrome bd terminal oxidase subunit I. This family are the alternative oxidases found in many bacteria which oxidize ubiquinol and reduce oxygen as part of the electron transport chain. This family is the subunit I of the oxidase E. coli has two copies of the oxidase, bo and bd', both of which are represented here In some nitrogen fixing bacteria, e.g. Klebsiella pneumoniae this oxidase is responsible for removing oxygen in microaerobic conditions, making the oxidase required for nitrogen fixation. This subunit binds a single b-haem, through ligands at His186 and Met393 (using SW:P11026 numbering). In addition His19 is a ligand for the haem b found in subunit II.	2.21087e-123
NZ_CP017404.1\|WP_019247959.1\|3568074_3571053_+\|hypothetical-protein	gnl\|CDD\|375438	pfam17936, Big_6, Bacterial Ig domain. This domain is found in a wide variety of extracellular bacterial proteins often in multiple tandem copies.	1.32844e-07
NZ_CP017404.1\|WP_010931356.1\|3578914_3580324_+\|transglycosylase-SLT-domain-containing-protein	gnl\|CDD\|182727	PRK10783, mltD, membrane-bound lytic murein transglycosylase D; Provisional.	5.28635e-76
NZ_CP017404.1\|WP_005013747.1\|3566770_3567721_-\|IS481-like-element-IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.05216e-23
NZ_CP017404.1\|WP_010927010.1\|3588005_3589430_+\|HAMP-domain-containing-protein	gnl\|CDD\|236531	PRK09467, envZ, osmolarity sensor protein; Provisional.	3.78414e-42
NZ_CP017404.1\|WP_005013747.1\|3575855_3576806_+\|IS481-like-element-IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.05216e-23
NZ_CP017404.1\|WP_010927090.1\|3578103_3578904_+\|hydroxyacylglutathione-hydrolase	gnl\|CDD\|274569	TIGR03413, GSH_gloB, hydroxyacylglutathione hydrolase. Members of this protein family are hydroxyacylglutathione hydrolase, a detoxification enzyme known as glyoxalase II. It follows lactoylglutathione lyase, or glyoxalase I, and acts to remove the toxic metabolite methylglyoxal and related compounds. This protein belongs to the broader metallo-beta-lactamase family (pfam00753). [Cellular processes, Detoxification].	2.85848e-146
NZ_CP017404.1\|WP_003820957.1\|3591954_3593718_+\|glutamine--tRNA-ligase/YqeY-domain-fusion-protein	gnl\|CDD\|235424	PRK05347, PRK05347, glutaminyl-tRNA synthetase; Provisional.	0
NZ_CP017404.1\|WP_003814239.1\|3587304_3588006_+\|response-regulator	gnl\|CDD\|181883	PRK09468, ompR, osmolarity response regulator; Provisional.	4.05363e-90
NZ_CP017404.1\|WP_010931362.1\|3593829_3594708_+\|septum-site-determining-protein-MinC	gnl\|CDD\|178806	PRK00030, minC, septum site-determining protein MinC.	3.47756e-166
NZ_CP017404.1\|WP_003814739.1\|3580418_3581204_+\|enoyl-ACP-reductase-FabI	gnl\|CDD\|180789	PRK06997, PRK06997, enoyl-[acyl-carrier-protein] reductase FabI.	1.22848e-177
NZ_CP017404.1\|WP_005013747.1\|3573924_3574875_+\|IS481-like-element-IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.05216e-23
NZ_CP017404.1\|WP_003818344.1\|3571979_3572858_+\|fatty-acid-desaturase	gnl\|CDD\|366126	pfam00487, FA_desaturase, Fatty acid desaturase.	2.20669e-12

>NZ_CP017404.1|WP_003814739.1|3580418_3581204_+|enoyl-ACP-reductase-FabI
MGFLAGKRILMTGVLSNRSIAYGIARACRDQGADLAFTYVGDRFKERITEFAASFGSDIVLPCDVAEDSQIDAAFAELGKRWDGLDGLVHAIGFAPREAIAGDFLDGLSRENFRIAHDISAYSFPAMAKAALPLMEGRKGSVLTLSYLGSERVVANYNTMGLAKASLEASVRYLATALGPRGIRANAISAGPIKTLAASGIKDFSSILKFVEANAPLRRNVTIEDVGNVAAFMLSDLAAGITGEITHVDAGFSTVVPGMEN
>NZ_CP017404.1|WP_010931356.1|3578914_3580324_+|transglycosylase-SLT-domain-containing-protein
MRFLRLLLPLFLAVLAGCAGTAKQNQAAGPSSNRYIAQDTSRTVDLTSPPSDAWDRIRRGFAIPNLNTDLAQEWTDYYASHPESVQRMAERAGKYLYFIVDEINRRGLPTELALLPFVESAYNPTALSRSQASGLWQFIPTTGQHFNLKQDWWRDERRDPIASTYAALDYLEKLFEMQGDWYLALASYNWGEGSVQRAMAKNEAAGLSTDYLSLNMPDETRNYVPKLQAIKNIIANPRKFAVVLPPVENTPYFVAVQKNRDIDIELAARLAEMPLDEFKALNPAFNRPLIRGEHAPTLLLPADRADRFNANLQNYKGDLSSWKVYHTRRGESYAAIAKRFGISEAKLRASNDIGSKRKVAADQALLIPGVPSGDGAANIQLASLSPPVGALDNVGEPRAAAAPRGKAPARVASARPNVRTHKVSSGDTLFGLARKYGTSVGALRALNNLKGNNLKLGSQLRIPGTGTRG
>NZ_CP017404.1|WP_010927090.1|3578103_3578904_+|hydroxyacylglutathione-hydrolase
MQTAPPLSAVVPLPAFSDNYIWALAHEGQAAVVDPGDAAPVLRWLRATGATLRAILLTHHHPDHVGGVLELVQATGATVYGPAGETLPHCDVRLAEGDRVTLPELALALEVLDVPGHTAGHIAYTGRAAGVERVLFCGDTLFAGGCGRLFEGTPAQMLDSLEKLSALPADTQVCCAHEYTLANLRWALAVEPANRTLQQWYQRAQELRNEGTPTLPSTIGQERETNPFLRTPHAAVAHAAAVWSGRSLATPVEVFAALRQWKNNFK
>NZ_CP017404.1|WP_010931355.1|3577312_3578083_-|methyltransferase-domain-containing-protein
MAEETPPIVELAEWFQTPPGQYVLAWEQAQFDEAVADIFGYYAWQVGLAEPNLLRANRMPFKAWVGAGVPPPELAQGWQACVAAAPEALPFESQSVDLLVLPHAFECAEAPHLVLREVERVLVPEGRVVISGFNPWSLWGARNLMPGMEAWLPLPLSAQVALPRLKDWFKLLSFEVERGRFGCYAPACRTDKWLRRWRFMERYGQRWWGLGGAVYVVTATKKVAAMRLIGPAWKTRRKRAQAASVVVNRQADDPGR
>NZ_CP017404.1|WP_010931354.1|3576802_3577270_-|ribonuclease-HI
MQNLEGSGDGQQVEMWTDGACKGNPGPGGWGVLMRAGQHEKTMHGGERQTTNNRMELMAVIEGLRALKRPCRVTIHTDSQYVMKGMTEWLANWKRRGWRTADKKPVKNVELWQALDEQVGRHQVQWRWVRGHAGDPGNERADALANQGMEAARGR
>NZ_CP017404.1|WP_005013747.1|3575855_3576806_+|IS481-like-element-IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT
>NZ_CP017404.1|WP_005013747.1|3573924_3574875_+|IS481-like-element-IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT
>NZ_CP017404.1|WP_003818344.1|3571979_3572858_+|fatty-acid-desaturase
MVRPAEWLRHRRDWQSVLYLAALPALAAWQWVHGWHWALYAPMLFLTLGVGVIHHNHAHRRMWRPRWLNRLTDFWLTLLQGHPTFVFHAAHNANHHRYKHGPRDVARTYRFGGDTNHLAGYLLHPLQAVVVLYPLFLASLRRLRSRRPGVWRYCLRQYAAWLGLWGGLLALDPGKAFWLVIVPQLHGLHWLLATNYLQHAHADGGPGRHAALSYARNFEGWVNPLLFNIGLHTAHHENPRAHWSELRALHWQHYRDRVPSRLNERGLAPYMARVFVLGLFSRRCRTHTLMRP
>NZ_CP017404.1|WP_019247959.1|3568074_3571053_+|hypothetical-protein
MQLWLPDGTATSVRANAAGGFEASSAGDMTSGLIRARATDRYGDTSQEVTYAYTDTVDKTAPVLSIAGVATDEATGRVTVTGRSEPDAQVTIRFPGGGRKTVRADANGAYRVRSDGDLPAGVIVVQAADAAGNSTQAQQAYQDTVDRTAPEPVQIALDTDAATGRLTVSGQAEPGGSVTVTWPDGTTQTVRVDADGGFRVTSAGDAAQGDVVVVVADQAGNRAAPVRAHYADPVDRTAPMTPTVRHATDAQTGRVTVMGRTEAGALVTVQFPDGSSKTVRAQNDGGYAATSDTDMVSGPIVVSAGDADGNRTPAQQVMYTDTLDKTAPASPSLTVREDAASGRATVTGQAEPGAAVRVVFPNGEAQTVTAGSDGAYSVTSTADMVAGEITVVAADASGNQSAPARTVFADAVDKTAPAAPTLALSEAADSGRLTVSGRTEPGASVRVTFPDGETVTVTAKADGTYTATSRADMIGGNVTVVATDTAGNAAAPVRAAYADTVDRTPPVLDTPVLNVASDSGRVTVTGVTEPGARVQVAIPGESLQTVTADSAGRYRAVSPGDVLQSGTVRVIATDAHGNASAPRDVPYQDAVDRTAPPLTIEAAVEQARTGVVNVSGKTEPNLMVSATFPDGQTAQARADGQGRYQLASPADVARSGRIAVSASDAAGNRAAARAEFTDQVDKTAPAVTIRAVTEQAGTGVATVSGATEPGATVSVTFPDGQVARATADRSGAYTVHSARDVTARGNISVIATDAAGNASPSVSRQFSNTVADTVPPSLTIAMVTTDPGNGRITVSGVTEAGARVHVVFPGGASDTVTADSKGGYRATSAGDVGSGAVTAQATDASANRSPLKTYAYTDAWQPRQLSAKDFSQSRYFVPLTTRGGTDNEPLLRITTNQQIPTAELRVALKPYKTEDRAGRLVREAITLKWGNAPGVGGDARALHFYVPDSAKAKLRKELTEVERSNDYKFWIEFTDTRFGGVARLYIKVISTL
>NZ_CP017404.1|WP_005013747.1|3566770_3567721_-|IS481-like-element-IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT
>NZ_CP017404.1|WP_003814742.1|3582567_3582960_-|OsmC-family-protein
MTIQVRANTPGGLQYTATAEGHELPLAMPQPQGEGPDPHDYFDTALGGCKALTLMVYAQRKGLPLQAVDVDVVRDASEERKGIYRLTAKLKLHGDLDDAQIDELLKVADKCPLHKLMTATDIQVSTIVVE
>NZ_CP017404.1|WP_010931357.1|3583097_3583778_+|tellurite-resistance-TerB-family-protein
MSARQLLDQLLQSGQSLMQGAGAQAQQATQGGKGTFLAGLGGGALGAGALGLLLGSKKARKIGGKVAMYGGMAALGALAYRAYDQYQRNQAGGAAAPAPQTLDRLPPAPAEQHSNAVLVAMIGAAKADGHIGPDERQLLETELAKLSGDAGDRAWLEAELARPLDPAVIAQQARTPEMGAEMYLASLLVADEQSFMERAYLDELARQLKLPAELKQQLEAQVPAAA
>NZ_CP017404.1|WP_023994844.1|3583782_3584754_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKSQVSILLAGCLLGAGAAAAQAPATYPDHAITIVVTFPPGGGTDLLARKLGAAMQQRLGQPVVVENRPGASGNIGARAVAEARPDGYTLLMVNSSFAVNPGVFRNLDFSPTRDFTAVINVAYVPSVIVTAEPAGDAGLPERLRQADTQSRTLAFASCGNGTPQHLAGEMLRQASGAWLQHVPYRGCGPALTDVLSRQVPLGIVTASSAAPFIHAGKLRALAVTSAQRSPLLPDVPTVAEQGAPGYELDQWHGLLAPAGTPPAVIQRLYEALSAIVAEPAMRRELESLGFNPVSEGPERFEALVQADIARFAALTARMGLRAD
>NZ_CP017404.1|WP_010930179.1|3584849_3585800_-|IS481-like-element-IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWQRPHQGIGRAVPISRLNLDEYNLLTVHS
>NZ_CP017404.1|WP_003814239.1|3587304_3588006_+|response-regulator
MDNPHTKLLVVDDDPALRQLLADYLNRHGYDTLLAPDASDLAARITRYAPDLLVLDRMLPGGDGADACRRLRDQGEDIPVILLTARDEAVDRIIGLEAGADDYLGKPFDPRELLARIEAVLRRKRGPSALTKDAPVSFGPFVFDPATRQLLRDDTPVKLTGGEINLLEALVRNAGKPLSRERLLALARDDDGGERNDRAIDIAILRLRRAIEEDPKQPRWIQTVWGIGYRFSP
>NZ_CP017404.1|WP_010927010.1|3588005_3589430_+|HAMP-domain-containing-protein
MKLLRLPAPRSLRMRLILLVLGSVLLAQAATLATVSYFRHKFMEDVAIDYIATTIRTLRASLSQVPTDERAEFVRQASGNQWRLWSRSLPADARLQRWHRGPQEDEAERERMRREYERRHPPPDDIRRDLRGLVSELNERLSDGTRVALSRGPRPEIFISLAPSPSPDDAPPLREWLVIPLERLDPPVATPLIAFWVGGIGLVLLLAAWFSWHITRPLTRLADAADQLAAGQPQRVEPSGPHETRVLGERFNAMLDALAESDSVRRTLLSGLPHDLKGPLSRMWLRIEMADDPTLKEGLRKDLQDMQHMVDQFIGFVRGTDPAAYRYAPLALGEWLAERVGAWQGAGTDIRLQAPDNGALGIQADAVALGRLLDNLIGNALHHGAPPVEVSLRRDADMAVLEVSDHGPGIAPERRTEALRPFARLDDARTRTGNVGLGLALAEAIARAHGGGLELRQAPSGGLLVRITLPLAKA
>NZ_CP017404.1|WP_010931360.1|3589446_3590502_-|cytochrome-d-ubiquinol-oxidase-subunit-II
MIATLAASLGLSPDDPSFWMPLVFVGLLLLLMAAGIVLDGFDIGVGLLLQLAPSEERGRMMGLLSPWRDANEFWPLLGLGLFVSAFPFAWGGVLGKLFGPLTVMALGMVLRSVSFEFRIRARTEIKPRWIFGFWVGSLLTALGQGMVLGRIATDYQADSGYGWFAFFVGLCVMAAYALLGACWLVMRVDGELQRRAAGWARHSIRWTAAGMVAIAVTLGLANAGIFYKWSNTAHLGVAAMVWALMLLGFVAAEMLLARLPGKADGFSWLPFVLCVMLFVLMLCGLAYSFFPYLILDDMTIWDGSGALDSMRLVLAGTVIGVPVVLVFNILAYRSVFGKERRPVPLLPPPGA
>NZ_CP017404.1|WP_010931361.1|3590498_3591839_-|cytochrome-ubiquinol-oxidase-subunit-I
MNIPPLLLARAQFTASLGFLALFLAISLALAWLLLFFKLRARWSGQSGWTAAYRFWVRIFALAFVLALACAVPVLIQLGSLWSGLMDKIGNLAGPLLGYGVLSIFIVKSCFLGVMLFGQRRVSDAAHTLAVLMVAIGQLVAVGWVLALFSWLQTPDGAVLIDGRYQVYDWRAVVLNPSFGWRLGLTVLGAFLTAGFLMLGVTAMQALRRPLDDGERHAFRAGLTVALLASLLLGPVAAGMGEVTARLQPAKAAAAAGFWHSGAEPELVVFGWPSARAQANLAAVSLAGAGGRWLHRDASLGYLGLDKFSGMQPPVAFTFWSLRLALGLGLLMLAASCATLALTCRRGFDPVALPRWWLRVLSLLMFAGALGVVATWCYDLAGMQPYAVNRAVTQSEVLGPVTTPALLYSLAGHIALYAVLLAAFVGMLFHAARYGVVPVRKTGGSS
>NZ_CP017404.1|WP_003820957.1|3591954_3593718_+|glutamine--tRNA-ligase/YqeY-domain-fusion-protein
MTHAPTPPAASNFLRPIIEDDLQANRFQGKLWAGKPGPAALQAQGQPDPARIRTRFPPEPNGYLHIGHAKSICVNFGLARDYGGVCHLRFDDTNPEKEEQEYVDAIIEAVHWLGFDWQADGNDNLYFASDYFEFMYEFAEALVQAGHAYVDEQSAEEIRASRGTLTEPGTDSPWRDRPADESLLRLREMRDGKHPDGSLVLRARIDMASPNINLRDPVMYRVRHATHHRTGNAWCIYPMYSWAHPVEDALEGITHSICTLEFEDQRPFYDWILARLAELGKLARPLPHQYEFARLNLTYVVTSKRKLLQLVREGYVDGWDDPRMPTLFGLRRRGYTPSSIRLFCDRTAVSKSDSRIDYSLLEQAVRDDLDPVAPRSVAVLDPLKLVITNYPEGRSETCSAPRNPHDPQAGVREFPFTRELWIEQDDFREEPPKKYFRLFPGNTVRLKYGYVVRCTGFTKDESGKVVEVQAEYLPDTKSGTPGADSVKVKGNITWVSAAHAVPAQVHLYDRLFADAHPDGGDKDFLACLNPNSKQTVQAWLEPGIEAVPGATWQFERLGYFTVDSKDSRPEAPVLNRIVTLRDSWQAA
>NZ_CP017404.1|WP_010931362.1|3593829_3594708_+|septum-site-determining-protein-MinC
MNTESLALDFKSATLYAIRVVLHDADTTRLRAALDKRMADAGSFFENEPVVIDATRVDAPVDWPALLQALADHNLPPIGVVAEGANLQGARDAGLVPVELSTSVARAPQVIDTAPPNDVATPVPSVPEATAEATAKAGPQDDEADGEQADEAPAHNPESVPTRAARETTEANRPTATPPQSSSALVITKPLRSGQRVYARHTDLIVIGMVSQGAEVIADGNVHVYGPLRGKAMAGARGDTSARIFTTQLDAELLAVAGVYRVVEDKLDRALHNQPALVRLDGDTLRIEALKG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 59497

Natrialba_phage(12.5%)

transposase,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010929569.1\|0_1920_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
WP_003806878.1\|1916_2609_+	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
WP_003806879.1\|2605_3403_+	ParA family protein	Q8JL10	Natrialba_phage	5.6e-20	34.9
WP_010929570.1\|3409_4171_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_010929571.1\|4214_5132_+	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	1.9e-16	38.1
WP_019247667.1\|5124_5910_+	asparaginase	NA	NA	NA	NA
WP_019247666.1\|5943_6126_+	hypothetical protein	NA	NA	NA	NA
WP_003806883.1\|6721_7912_+	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	3.1e-14	29.2
WP_003806884.1\|8150_8531_+	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_003806885.1\|8540_9074_+	transcription termination/antitermination protein NusG	G3MAW2	Bacillus_virus	1.4e-11	30.5
WP_010929572.1\|9137_9569_+	50S ribosomal protein L11	NA	NA	NA	NA
WP_003806887.1\|9571_10270_+	50S ribosomal protein L1	NA	NA	NA	NA
WP_003806888.1\|10512_11037_+	50S ribosomal protein L10	NA	NA	NA	NA
WP_003806889.1\|11118_11502_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_010929573.1\|11661_15774_+	DNA-directed RNA polymerase subunit beta	A0A0N9R0J7	Chrysochromulina_ericina_virus	2.4e-21	28.8
WP_003818292.1\|15773_20018_+	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	3.5e-68	24.7
WP_010929574.1\|20126_20531_-	TssQ family T6SS-associated lipoprotein	NA	NA	NA	NA
WP_010929575.1\|20771_21947_+	membrane protein	NA	NA	NA	NA
WP_010929576.1\|24352_25459_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_003818297.1\|26470_27286_+	response regulator transcription factor	NA	NA	NA	NA
WP_010930363.1\|27282_28233_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_023995007.1\|28314_28650_-	CoA transferase	NA	NA	NA	NA
WP_010929578.1\|28674_29109_-	hypothetical protein	NA	NA	NA	NA
WP_019247164.1\|29141_30359_-	thiolase family protein	NA	NA	NA	NA
WP_010929580.1\|30364_30862_-	MaoC family dehydratase	NA	NA	NA	NA
WP_019247165.1\|31069_32005_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010929582.1\|32214_33006_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_010929583.1\|33048_34470_+	MmgE/PrpD family protein	NA	NA	NA	NA
WP_010929584.1\|34625_35576_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_005012808.1\|35674_36625_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003814398.1\|36621_37812_-	MFS transporter	NA	NA	NA	NA
WP_010929585.1\|38061_38973_+\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
WP_010929586.1\|38974_41113_+\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_003814404.1\|41109_41649_+	D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase	NA	NA	NA	NA
WP_003814405.1\|41652_42381_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_010929587.1\|42367_43261_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_019247766.1\|43331_43727_+	lactoylglutathione lyase	NA	NA	NA	NA
WP_003814412.1\|43736_44267_+	peptide deformylase	E3SLL2	Synechococcus_phage	3.7e-12	35.4
WP_023852754.1\|44395_44695_-	DUF1974 domain-containing protein	NA	NA	NA	NA
WP_010930208.1\|44712_45663_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929589.1\|46249_46798_+	hypothetical protein	NA	NA	NA	NA
WP_003815265.1\|46769_47006_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003815255.1\|47133_48027_+	membrane protein	NA	NA	NA	NA
WP_010929590.1\|49196_50444_+	homoserine O-acetyltransferase	NA	NA	NA	NA
WP_003817748.1\|50440_51055_+	methionine biosynthesis protein MetW	NA	NA	NA	NA
WP_005012067.1\|51190_52141_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_029443813.1\|52183_53440_+	muropeptide transporter	NA	NA	NA	NA
WP_010929592.1\|54671_55406_-	aspartate/glutamate racemase family protein	NA	NA	NA	NA
WP_019247224.1\|55411_56002_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-20	33.6
WP_003817737.1\|56026_56716_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_023852650.1\|56712_57474_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_010929594.1\|57553_58453_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_005012808.1\|58546_59497_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

70134 : 123122

Planktothrix_phage(20.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012808.1\|70134_71085_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003816713.1\|71178_71493_+	DUF1153 domain-containing protein	NA	NA	NA	NA
WP_010929604.1\|72685_74593_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	1.1e-117	37.2
WP_010929605.1\|74754_75375_-	glutathione S-transferase	NA	NA	NA	NA
WP_003807804.1\|75406_75988_-	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	A0A1W6DX33	Sphingobium_phage	1.7e-05	54.3
WP_003807805.1\|76076_76328_-	hypothetical protein	NA	NA	NA	NA
WP_010929606.1\|76329_77172_-	cytochrome c biogenesis protein CcsA	NA	NA	NA	NA
WP_010929607.1\|77277_78687_+	signal recognition particle protein	NA	NA	NA	NA
WP_005012067.1\|78683_79634_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_041166334.1\|79708_80653_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_010929608.1\|80649_82524_-	polysaccharide biosynthesis protein	A0A2P1ELS8	Moumouvirus	2.0e-23	26.9
WP_003807102.1\|83871_84576_-	DUF2837 family protein	NA	NA	NA	NA
WP_003807104.1\|84572_85679_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_010929610.1\|85940_86534_-	sugar transferase	NA	NA	NA	NA
WP_023853419.1\|86530_87718_-	DegT/DnrJ/EryC1/StrS family aminotransferase	NA	NA	NA	NA
WP_010929612.1\|87780_89040_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_010929613.1\|89063_90152_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	4.8e-46	36.3
WP_010929614.1\|90159_91260_-	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A2K9L0G1	Tupanvirus	3.3e-31	29.7
WP_003807114.1\|91263_91839_-	N-acetyltransferase	NA	NA	NA	NA
WP_003807115.1\|91842_92895_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_010929615.1\|93025_94033_+	lipopolysaccharide heptosyltransferase I	NA	NA	NA	NA
WP_010929616.1\|94034_95321_+	3-deoxy-D-manno-octulosonic acid transferase	NA	NA	NA	NA
WP_003807124.1\|95337_95493_-	hypothetical protein	NA	NA	NA	NA
WP_010929617.1\|95517_96321_-	type III pantothenate kinase	NA	NA	NA	NA
WP_010929618.1\|96317_97184_-	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
WP_010929619.1\|97258_98389_+	ABC transporter permease	NA	NA	NA	NA
WP_003807131.1\|98388_99228_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	9.1e-21	32.4
WP_010929620.1\|100160_100763_+	hypothetical protein	NA	NA	NA	NA
WP_010929621.1\|100792_101446_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003807138.1\|101578_102835_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	6.2e-66	40.5
WP_023853421.1\|102915_103782_+	D-amino acid aminotransferase	NA	NA	NA	NA
WP_003818417.1\|103857_104133_+	YbeD family protein	NA	NA	NA	NA
WP_010929623.1\|104140_104803_+	lipoyl(octanoyl) transferase LipB	NA	NA	NA	NA
WP_003807146.1\|104864_105866_+	lipoyl synthase	NA	NA	NA	NA
WP_003807148.1\|105880_106429_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	3.7e-47	53.4
WP_010929624.1\|106486_107383_-	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
WP_010929625.1\|107379_108441_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	1.6e-78	44.8
WP_010929626.1\|108476_109427_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_010929627.1\|110326_111520_+	cystathionine beta-lyase	NA	NA	NA	NA
WP_010929628.1\|111601_112231_-	thiol:disulfide interchange protein DsbA/DsbL	NA	NA	NA	NA
WP_010927242.1\|112292_112976_-	SPOR domain-containing protein	NA	NA	NA	NA
WP_023853376.1\|112985_114668_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_003815933.1\|114955_115303_+	DUF1840 domain-containing protein	NA	NA	NA	NA
WP_003815930.1\|115393_115711_+	hypothetical protein	NA	NA	NA	NA
WP_010929632.1\|115993_117010_+\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_003815929.1\|117085_117886_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_003815927.1\|117882_118758_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_010929633.1\|118768_120061_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010929634.1\|120103_121144_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.0e-22	33.7
WP_010929635.1\|121249_122071_-	phosphodiesterase	NA	NA	NA	NA
WP_005012067.1\|122171_123122_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

136206 : 208682

Bacillus_phage(16.67%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012067.1\|136206_137157_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003815155.1\|137575_139084_-	threonine ammonia-lyase, biosynthetic	NA	NA	NA	NA
WP_019247146.1\|139830_143793_+	FAD/FMN-binding oxidoreductase	NA	NA	NA	NA
WP_010929644.1\|143845_144628_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_010929645.1\|144715_145939_-	CoA transferase	NA	NA	NA	NA
WP_010929646.1\|145922_146855_-	alpha/beta hydrolase fold domain-containing protein	NA	NA	NA	NA
WP_003817676.1\|146860_147673_-	enoyl-CoA hydratase	NA	NA	NA	NA
WP_010929647.1\|148985_149957_-	hypothetical protein	NA	NA	NA	NA
WP_003815135.1\|150075_150858_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_010929648.1\|151624_152605_-	biotin-dependent carboxyltransferase	NA	NA	NA	NA
WP_010929649.1\|152601_153330_-	5-oxoprolinase subunit PxpB	NA	NA	NA	NA
WP_003815126.1\|153354_153786_-	VOC family protein	NA	NA	NA	NA
WP_010929650.1\|153887_154763_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_023853237.1\|154813_156013_-	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	3.1e-91	42.6
WP_010929652.1\|156116_156578_-	DUF411 domain-containing protein	NA	NA	NA	NA
WP_010929653.1\|156683_158081_-	heavy metal sensor histidine kinase	NA	NA	NA	NA
WP_010929654.1\|158077_158755_-	heavy metal response regulator transcription factor	W8CYM9	Bacillus_phage	1.5e-29	35.2
WP_010929655.1\|158810_160121_-	phosphate regulon sensor histidine kinase PhoR	A0A1V0SGX0	Hokovirus	6.2e-16	25.5
WP_003815113.1\|160132_160831_-	phosphate regulon transcriptional regulator PhoB	W8CYM9	Bacillus_phage	8.6e-33	37.1
WP_003815111.1\|160994_161771_+	bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE	NA	NA	NA	NA
WP_010929656.1\|161936_162959_+	Tim44 domain-containing protein	NA	NA	NA	NA
WP_023853232.1\|163187_163823_+	SCP-2 sterol transfer family protein	NA	NA	NA	NA
WP_070797692.1\|163828_165382_+	ubiquinone biosynthesis regulatory protein kinase UbiB	A0A2N9QVT9	Dishui_lake_phycodnavirus	2.7e-34	28.7
WP_005015810.1\|165940_166891_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929659.1\|168334_169237_-	YgcG family protein	NA	NA	NA	NA
WP_003815889.1\|169214_169844_-	LemA family protein	NA	NA	NA	NA
WP_010929660.1\|170126_171557_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.8e-44	29.8
WP_010929661.1\|171590_172220_+	LysE family transporter	NA	NA	NA	NA
WP_003815895.1\|172268_173876_+	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	9.3e-14	37.8
WP_010929663.1\|173900_174584_+	hypothetical protein	NA	NA	NA	NA
WP_003815898.1\|174665_175142_-	bacterioferritin	NA	NA	NA	NA
WP_010929577.1\|175348_176299_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929591.1\|176397_177348_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929664.1\|178463_178991_+	META domain-containing protein	NA	NA	NA	NA
WP_010929665.1\|179082_179898_+	META and DUF4377 domain-containing protein	NA	NA	NA	NA
WP_003808370.1\|179958_180693_+	sulfurtransferase	NA	NA	NA	NA
WP_010929666.1\|180730_182809_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	1.5e-27	23.6
WP_003808374.1\|183058_183331_-	hypothetical protein	NA	NA	NA	NA
WP_033446322.1\|183432_184518_+	iron-sulfur cluster carrier protein ApbC	NA	NA	NA	NA
WP_010929668.1\|184521_186426_+	BamA/TamA family outer membrane protein	NA	NA	NA	NA
WP_014486044.1\|186422_190097_+	DUF490 domain-containing protein	NA	NA	NA	NA
WP_010929670.1\|190157_190721_+	dCTP deaminase	S5VM63	Pseudomonas_phage	2.6e-72	75.3
WP_003808385.1\|190728_191151_-	glyoxalase	NA	NA	NA	NA
WP_010929671.1\|191178_191598_-	glyoxalase/bleomycin resistance/dioxygenase family protein	NA	NA	NA	NA
WP_077274090.1\|191626_192073_-	GNAT family N-acetyltransferase	Q9AZG4	Lactococcus_phage	1.2e-08	29.4
WP_003808391.1\|192199_192697_+	hypothetical protein	NA	NA	NA	NA
WP_003808393.1\|192851_195122_+	arginine/lysine/ornithine decarboxylase	NA	NA	NA	NA
WP_019249381.1\|195197_196403_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_005012067.1\|196501_197452_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929673.1\|197554_198190_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	2.8e-83	73.8
WP_010929674.1\|198186_199080_+	ZIP family metal transporter	NA	NA	NA	NA
WP_010929675.1\|199474_200575_+	glycine cleavage system aminomethyltransferase GcvT	NA	NA	NA	NA
WP_010929676.1\|200656_201031_+	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_010929677.1\|201090_203955_+	aminomethyl-transferring glycine dehydrogenase	E3SN07	Prochlorococcus_phage	1.2e-261	51.4
WP_010929678.1\|204099_204840_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_010929679.1\|204909_206121_+	CoA transferase	NA	NA	NA	NA
WP_010929680.1\|206149_207118_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_005013747.1\|207731_208682_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

217761 : 333431

101

uncultured_Caudovirales_phage(12.5%)

transposase,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033446404.1\|217761_220557_-\|protease	serine protease autotransporter SphB1	NA	NA	NA	NA
WP_023994893.1\|221150_223994_-	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
WP_010929689.1\|224164_224884_+	7-cyano-7-deazaguanine synthase QueC	A0A0A0RPC6	Escherichia_phage	8.0e-50	43.9
WP_010929688.1\|224922_225471_-	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	1.2e-21	41.7
WP_010929687.1\|225625_226525_+	virginiamycin B lyase	NA	NA	NA	NA
WP_005012808.1\|226549_227500_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003818947.1\|227718_228414_+	FadR family transcriptional regulator	NA	NA	NA	NA
WP_019247308.1\|228430_229843_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_010929684.1\|229955_231386_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_010929683.1\|231427_233341_-	phosphomethylpyrimidine synthase ThiC	NA	NA	NA	NA
WP_010929682.1\|233659_234226_+	preprotein translocase subunit SecD	NA	NA	NA	NA
WP_010929681.1\|234316_235318_+	HindIII family type II restriction endonuclease	NA	NA	NA	NA
WP_005012067.1\|235432_236383_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010927663.1\|236469_237420_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_010930742.1\|237416_238367_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_010929700.1\|238465_239263_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_003814363.1\|240212_240623_+	4-carboxymuconolactone decarboxylase	NA	NA	NA	NA
WP_003814358.1\|241644_242388_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003814356.1\|242431_243475_-	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_003814355.1\|243645_245748_+	TRAP transporter large permease subunit	NA	NA	NA	NA
WP_003814351.1\|247158_248115_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010929701.1\|248133_248625_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_010929702.1\|248621_249977_-	polynucleotide adenylyltransferase PcnB	A0A1B1IVF3	uncultured_Mediterranean_phage	3.4e-25	36.8
WP_010929703.1\|249977_250676_-	HAD-IB family hydrolase	NA	NA	NA	NA
WP_010929704.1\|250672_251374_-	DnaA regulatory inactivator Hda	NA	NA	NA	NA
WP_003814339.1\|251626_252676_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	5.6e-68	43.6
WP_003814337.1\|252781_253723_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_010929705.1\|253719_255609_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	3.3e-79	32.8
WP_033446171.1\|255713_256334_+	membrane protein	NA	NA	NA	NA
WP_019247543.1\|256476_257862_-	N-acetylmuramoyl-L-alanine amidase	A0A2H4JCM7	uncultured_Caudovirales_phage	4.5e-17	30.3
WP_010929706.1\|257792_258329_-\|tRNA	bifunctional alanine racemase/tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_010929707.1\|258480_259872_+	class II fumarate hydratase	NA	NA	NA	NA
WP_010929708.1\|259888_260869_-	AEC family transporter	NA	NA	NA	NA
WP_003814324.1\|261004_261988_+	tripartite tricarboxylate transporter substrate binding protein BugE	NA	NA	NA	NA
WP_010929709.1\|262052_262952_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003814321.1\|263058_264813_+	gamma-glutamyltransferase	NA	NA	NA	NA
WP_010929710.1\|264820_265945_-	CoA transferase	NA	NA	NA	NA
WP_010929711.1\|265958_266939_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_005012067.1\|267669_268620_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929712.1\|269179_269725_+	GbsR/MarR family transcriptional regulator	NA	NA	NA	NA
WP_023852659.1\|269850_271428_+	cytochrome d ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_004567834.1\|271443_272598_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_003817696.1\|272611_272737_+	cytochrome bd-I oxidase subunit CydX	NA	NA	NA	NA
WP_010929714.1\|272733_274485_+	thiol reductant ABC exporter subunit CydD	W8CYL7	Bacillus_phage	3.4e-09	23.8
WP_010929715.1\|274481_276161_+	thiol reductant ABC exporter subunit CydC	W8CYL7	Bacillus_phage	3.6e-16	27.6
WP_010929716.1\|276223_276772_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.3e-28	43.1
WP_010929717.1\|277914_278193_+	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_005012067.1\|279236_280187_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_076879590.1\|280173_280389_-	hypothetical protein	NA	NA	NA	NA
WP_010929718.1\|280464_280626_+	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_010929719.1\|280633_280774_+	hypothetical protein	NA	NA	NA	NA
WP_003815821.1\|281292_281742_-\|protease	ClpXP protease specificity-enhancing factor	NA	NA	NA	NA
WP_003815819.1\|281751_282363_-	stringent starvation protein A	NA	NA	NA	NA
WP_010929720.1\|282521_283370_-	cytochrome c1	NA	NA	NA	NA
WP_003815816.1\|283395_284778_-	cytochrome bc complex cytochrome b subunit	NA	NA	NA	NA
WP_003815815.1\|284842_285484_-	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
WP_010929721.1\|285623_286082_+	large conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
WP_010927226.1\|286106_286883_-	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_014906092.1\|286936_288073_+\|protease	trypsin-like serine protease	W5SAB9	Pithovirus	1.2e-07	31.2
WP_005015810.1\|288069_289020_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003807705.1\|289118_289745_-	FMN-binding negative transcriptional regulator	NA	NA	NA	NA
WP_003807706.1\|289767_290694_-	glyoxylate/hydroxypyruvate reductase A	NA	NA	NA	NA
WP_003819100.1\|290702_292289_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010929723.1\|292285_293290_-	alpha/beta hydrolase	A0A2L2DMU8	Acanthamoeba_polyphaga_mimivirus	7.5e-30	31.5
WP_003807710.1\|293489_294350_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010929724.1\|294381_295383_-	2-isopropylmalate synthase	NA	NA	NA	NA
WP_003819104.1\|295453_296263_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003819105.1\|296340_298200_+	dihydroxy-acid dehydratase	NA	NA	NA	NA
WP_010929725.1\|298328_299531_-	MFS transporter	NA	NA	NA	NA
WP_004566082.1\|299644_300526_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004566083.1\|302028_302589_-	5'-3'-deoxyribonucleotidase	A0A1E1EUN3	Acanthamoeba_castellanii_mimivirus	3.2e-14	30.8
WP_005013747.1\|302648_303599_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_111735998.1\|303790_304078_-	hypothetical protein	NA	NA	NA	NA
WP_010930048.1\|304166_305117_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929727.1\|305113_306112_-	hypothetical protein	NA	NA	NA	NA
WP_003815019.1\|306154_306658_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_010929728.1\|306661_307552_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003815015.1\|307774_308938_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003815013.1\|309034_309955_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_003815011.1\|309958_310924_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_003815010.1\|310920_311715_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.6e-09	23.5
WP_010929729.1\|311708_312413_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-16	32.2
WP_010929730.1\|315776_316640_+	enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_010929731.1\|316642_317812_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_003814996.1\|317852_319502_+	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	2.6e-56	31.2
WP_003814993.1\|319503_319938_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_003814990.1\|319962_320364_+	RidA family protein	NA	NA	NA	NA
WP_010929732.1\|320457_322083_-	DUF342 domain-containing protein	NA	NA	NA	NA
WP_010929733.1\|322322_323606_-	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_003814984.1\|323622_324276_-	thiamine phosphate synthase	NA	NA	NA	NA
WP_010929734.1\|324272_325121_-	hydroxymethylpyrimidine/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_003814980.1\|325237_325402_+	rubredoxin	NA	NA	NA	NA
WP_010927118.1\|325489_326095_+	YqgE/AlgH family protein	NA	NA	NA	NA
WP_010929735.1\|326087_326489_+	Holliday junction resolvase RuvX	NA	NA	NA	NA
WP_003820560.1\|326502_327456_+	aspartate carbamoyltransferase catalytic subunit	A7RB08	Paramecium_bursaria_Chlorella_virus	2.5e-30	35.8
WP_010929736.1\|327452_328628_+	dihydroorotase	NA	NA	NA	NA
WP_010929737.1\|328747_329488_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_010929738.1\|329524_330358_-	symmetrical bis(5'-nucleosyl)-tetraphosphatase	NA	NA	NA	NA
WP_010929739.1\|330354_331533_-	LPS export ABC transporter permease LptG	NA	NA	NA	NA
WP_003814960.1\|331629_332358_-	monofunctional biosynthetic peptidoglycan transglycosylase	NA	NA	NA	NA
WP_005013747.1\|332480_333431_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

357014 : 416482

Streptococcus_phage(50.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012067.1\|357014_357965_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929759.1\|358076_358799_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003815420.1\|358897_359641_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_010929760.1\|359871_361380_+	hypothetical protein	NA	NA	NA	NA
WP_003815418.1\|361499_362231_+	iron-containing redox enzyme family protein	NA	NA	NA	NA
WP_010929761.1\|362275_363736_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_010929762.1\|363760_364240_+	heme-binding protein	NA	NA	NA	NA
WP_003817846.1\|364258_365269_+	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_010929763.1\|365483_366224_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_023997839.1\|366430_367441_+	beta-propeller fold lactonase family protein	NA	NA	NA	NA
WP_010929765.1\|367400_368351_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929766.1\|369399_370038_+	trimeric intracellular cation channel family protein	NA	NA	NA	NA
WP_010929767.1\|370074_371418_-	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_010929768.1\|371840_372629_-	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	1.2e-19	25.7
WP_010929769.1\|372766_373441_+	orotate phosphoribosyltransferase	NA	NA	NA	NA
WP_010929770.1\|373554_375009_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_010929771.1\|375011_376550_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_010929772.1\|376552_376861_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_003815204.1\|377091_378135_+	rod shape-determining protein	NA	NA	NA	NA
WP_010929773.1\|378223_379108_+	rod shape-determining protein MreC	NA	NA	NA	NA
WP_003815202.1\|379094_379658_+	rod shape-determining protein MreD	NA	NA	NA	NA
WP_003815201.1\|379671_381624_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_003815198.1\|381620_382757_+	rod shape-determining protein RodA	NA	NA	NA	NA
WP_010929775.1\|382782_383838_-	Ldh family oxidoreductase	NA	NA	NA	NA
WP_010929776.1\|383848_385342_-	DASS family sodium-coupled anion symporter	NA	NA	NA	NA
WP_010927138.1\|385554_386130_-	nucleoid occlusion factor SlmA	NA	NA	NA	NA
WP_010929777.1\|386179_386926_-	pyrimidine 5'-nucleotidase	NA	NA	NA	NA
WP_010929778.1\|386925_387828_-	acetylglutamate kinase	NA	NA	NA	NA
WP_010929779.1\|388089_388878_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003815191.1\|389018_389510_-	TlpA family protein disulfide reductase	NA	NA	NA	NA
WP_003815190.1\|389506_390250_-	BON domain-containing protein	NA	NA	NA	NA
WP_033446211.1\|390246_390840_-	phosphoheptose isomerase	A0A067XQR2	Caulobacter_phage	5.6e-17	34.8
WP_100208326.1\|390848_391325_-	YraN family protein	NA	NA	NA	NA
WP_010929780.1\|391449_392388_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	NA	NA	NA	NA
WP_010929781.1\|392384_392957_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	3.2e-25	42.5
WP_005012067.1\|392953_393904_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010927231.1\|394040_394958_+	reductase	NA	NA	NA	NA
WP_003815842.1\|394954_395203_+	glutaredoxin family protein	NA	NA	NA	NA
WP_003815840.1\|395199_396405_+	CoA transferase	NA	NA	NA	NA
WP_014486045.1\|396477_397473_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_014486046.1\|397495_398716_-	CoA transferase	NA	NA	NA	NA
WP_014486047.1\|398712_399357_-	hypothetical protein	NA	NA	NA	NA
WP_019248476.1\|401087_401897_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_014486048.1\|402201_403155_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	5.6e-59	42.5
WP_005013747.1\|403253_404204_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014486049.1\|404302_405286_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014486050.1\|405212_405914_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_014486051.1\|405962_406733_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_019247259.1\|406729_407908_-	CoA transferase	NA	NA	NA	NA
WP_014486052.1\|408075_409782_-	thiamine pyrophosphate-requiring protein	NA	NA	NA	NA
WP_014486053.1\|409778_410675_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014486054.1\|410715_412305_-	sulfurtransferase	NA	NA	NA	NA
WP_003807867.1\|412354_413347_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_003807865.1\|413415_414015_-	hypothetical protein	NA	NA	NA	NA
WP_014486055.1\|414475_415456_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010929577.1\|415531_416482_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

424293 : 479267

Bradyrhizobium_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022997984.1\|424293_425271_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929785.1\|425466_426672_+	sodium/glutamate symporter	NA	NA	NA	NA
WP_010929786.1\|426668_428180_+	TAXI family TRAP transporter solute-binding subunit	NA	NA	NA	NA
WP_003814726.1\|428195_429509_-	short-chain fatty acid transporter	NA	NA	NA	NA
WP_003814728.1\|429699_429879_-	hypothetical protein	NA	NA	NA	NA
WP_003814730.1\|430288_431023_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	1.4e-41	43.8
WP_010929577.1\|433467_434418_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_019247421.1\|434549_434948_-	GTP-binding protein	E4ZFJ7	Streptococcus_phage	9.0e-19	44.3
WP_003814701.1\|435358_435829_-	universal stress protein	NA	NA	NA	NA
WP_003820700.1\|435917_436262_-	TIGR01244 family phosphatase	NA	NA	NA	NA
WP_010929788.1\|436361_437762_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_010929789.1\|439550_440069_-	MgtC/SapB family protein	G3MA03	Bacillus_virus	2.1e-12	38.9
WP_003814694.1\|440179_440935_+	TerC family protein	A0A0R6PEZ3	Moraxella_phage	2.9e-42	40.8
WP_003814691.1\|441130_442363_+	CoA transferase	NA	NA	NA	NA
WP_010929791.1\|442355_443141_+	crotonase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_003814685.1\|443207_444179_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_003814681.1\|444189_445167_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_019247419.1\|445292_446465_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_010929793.1\|446491_447520_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_003814674.1\|447585_448779_+	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_005012067.1\|450560_451511_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929577.1\|451609_452560_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929794.1\|452658_453564_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010929795.1\|453739_453943_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	5.8e-14	58.2
WP_010929796.1\|454453_454894_+	hypothetical protein	NA	NA	NA	NA
WP_010929797.1\|454923_455583_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_019248869.1\|455668_457285_-	L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_010929799.1\|457305_458769_-	short-chain fatty acid transporter	NA	NA	NA	NA
WP_010929800.1\|458799_462186_-	molybdopterin-dependent oxidoreductase	NA	NA	NA	NA
WP_010929801.1\|462327_462732_-	RidA family protein	NA	NA	NA	NA
WP_010929802.1\|462875_463862_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_019247316.1\|463848_464130_-	hypothetical protein	NA	NA	NA	NA
WP_010929803.1\|464875_466108_-	dehydratase	NA	NA	NA	NA
WP_010929804.1\|466107_466602_-	MaoC family dehydratase	NA	NA	NA	NA
WP_010929805.1\|466733_467696_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010929806.1\|467673_468927_-	CoA transferase	NA	NA	NA	NA
WP_005013747.1\|469048_469999_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003821340.1\|469995_470658_-	protein-methionine-sulfoxide reductase heme-binding subunit MsrQ	NA	NA	NA	NA
WP_010929831.1\|470665_471625_-	protein-methionine-sulfoxide reductase catalytic subunit MsrP	NA	NA	NA	NA
WP_010929830.1\|471781_472453_-	HAD family hydrolase	NA	NA	NA	NA
WP_033446197.1\|472455_473361_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_019247670.1\|473928_477057_+	Rne/Rng family ribonuclease	NA	NA	NA	NA
WP_010929827.1\|477132_478200_-	linear amide C-N hydrolase	NA	NA	NA	NA
WP_005012067.1\|478316_479267_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

593565 : 654755

uncultured_Mediterranean_phage(40.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005013747.1\|593565_594516_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_033446133.1\|594991_595882_+	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_010931496.1\|595878_596700_+	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_019247235.1\|596898_597390_+	CYTH domain-containing protein	NA	NA	NA	NA
WP_019247236.1\|597408_598482_+	CHAD domain-containing protein	NA	NA	NA	NA
WP_023853086.1\|598528_599632_-	signal recognition particle-docking protein FtsY	NA	NA	NA	NA
WP_003808577.1\|599707_600328_+	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_003808574.1\|600348_600858_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	1.2e-28	42.1
WP_003808570.1\|600912_601164_+	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	1.6e-18	53.4
WP_010931494.1\|601227_602361_+	benzoate/H(+) symporter BenE family transporter	NA	NA	NA	NA
WP_003808567.1\|602368_602755_-	hypothetical protein	NA	NA	NA	NA
WP_010931493.1\|602751_605271_-	AsmA family protein	NA	NA	NA	NA
WP_003808563.1\|605699_606038_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003808562.1\|606034_606541_+	SRPBCC family protein	NA	NA	NA	NA
WP_010931492.1\|606602_607403_-	hypothetical protein	NA	NA	NA	NA
WP_010931491.1\|607513_608455_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010931490.1\|608548_610084_-	M81 family metallopeptidase	NA	NA	NA	NA
WP_010931489.1\|611763_613614_-	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-17	29.2
WP_003808549.1\|613617_614451_-	ABC transporter permease	NA	NA	NA	NA
WP_010931488.1\|614450_615392_-	ABC transporter permease	NA	NA	NA	NA
WP_010931487.1\|615643_616615_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010931486.1\|616756_619045_+	NADP-dependent malic enzyme	NA	NA	NA	NA
WP_003808542.1\|619351_620260_+	TauD/TfdA family dioxygenase	NA	NA	NA	NA
WP_010931485.1\|620314_621280_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010931484.1\|621354_623016_+	thiamine pyrophosphate-binding protein	NA	NA	NA	NA
WP_010931483.1\|623087_623798_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_154698388.1\|623764_623929_-	hypothetical protein	NA	NA	NA	NA
WP_005012067.1\|623946_624897_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003814152.1\|625595_625979_+	membrane protein	NA	NA	NA	NA
WP_010927005.1\|626036_626639_+	DUF2946 family protein	NA	NA	NA	NA
WP_003820995.1\|626656_627058_-	DoxX family protein	NA	NA	NA	NA
WP_010931482.1\|627173_628085_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010931481.1\|628081_628663_+	NUDIX hydrolase	NA	NA	NA	NA
WP_033446151.1\|629466_630192_+	arginyltransferase	NA	NA	NA	NA
WP_010931480.1\|630232_631282_+	quinone-dependent dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_003814172.1\|631429_632008_-	TIGR01841 family phasin	NA	NA	NA	NA
WP_010931479.1\|632394_633372_+	tripartite tricarboxylate transporter substrate binding protein BugD	NA	NA	NA	NA
WP_010931478.1\|633465_637860_-	dermonecrotic toxin	NA	NA	NA	NA
WP_003814178.1\|638060_638909_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_010931477.1\|639067_639880_-	competence/damage-inducible protein A	NA	NA	NA	NA
WP_005015810.1\|639935_640886_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931453.1\|640984_641785_-	EI24 domain-containing protein	NA	NA	NA	NA
WP_003814185.1\|641846_642230_+	thioredoxin family protein	NA	NA	NA	NA
WP_033446148.1\|642241_643594_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.1e-51	34.4
WP_003814188.1\|643881_644211_-	AzlD domain-containing protein	NA	NA	NA	NA
WP_010931455.1\|644213_644963_-	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_010931456.1\|645145_646066_+	branched-chain amino acid transaminase	NA	NA	NA	NA
WP_003814195.1\|646112_646325_+	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_010931457.1\|646347_646770_+	SnoaL-like domain-containing protein	NA	NA	NA	NA
WP_010931458.1\|646786_647887_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_010931459.1\|647983_649501_-\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_003814203.1\|649576_650416_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.1e-66	48.9
WP_033446149.1\|650437_651310_-	cytochrome c oxidase assembly protein	NA	NA	NA	NA
WP_070797680.1\|651400_652495_-	porin	NA	NA	NA	NA
WP_076879617.1\|652788_653739_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_041166340.1\|653813_654755_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_8

660079 : 707319

uncultured_Caudovirales_phage(18.18%)

transposase,terminase,tRNA,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023995141.1\|660079_661105_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_003814221.1\|661145_661385_+	DNA-binding protein	NA	NA	NA	NA
WP_010931464.1\|661454_663044_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	8.7e-65	47.2
WP_010931465.1\|663043_663592_+	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
WP_003814226.1\|663672_664245_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_010927008.1\|664263_665175_-	complex I NDUFA9 subunit family protein	NA	NA	NA	NA
WP_003814230.1\|665248_666217_-	threo-3-hydroxy-L-aspartate ammonia-lyase	NA	NA	NA	NA
WP_010931466.1\|666339_667413_+	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	2.3e-08	25.7
WP_010931467.1\|667417_669238_-	DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	3.1e-74	35.3
WP_005015810.1\|669314_670265_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_033446132.1\|670353_670689_+	ASCH domain-containing protein	NA	NA	NA	NA
WP_003819076.1\|670822_671473_+	carbonic anhydrase	NA	NA	NA	NA
WP_010931468.1\|671494_672913_-	amidase	NA	NA	NA	NA
WP_019248554.1\|672982_673738_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_019247734.1\|673706_674465_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_010931471.1\|674475_675357_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_010931472.1\|675373_676081_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.2e-07	25.4
WP_010931473.1\|676083_676842_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.4e-14	24.4
WP_010931474.1\|677051_678794_+	nitrite/sulfite reductase	NA	NA	NA	NA
WP_010925795.1\|678786_679311_+	DUF934 domain-containing protein	NA	NA	NA	NA
WP_010931475.1\|679350_680145_-	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_019248926.1\|680312_681386_+	hypothetical protein	NA	NA	NA	NA
WP_005012067.1\|681484_682435_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_019247378.1\|682686_682893_-	hypothetical protein	NA	NA	NA	NA
WP_010931451.1\|682964_683576_-	S24 family peptidase	NA	NA	NA	NA
WP_023853179.1\|684130_684382_+	transcriptional regulator	NA	NA	NA	NA
WP_161633094.1\|684374_685064_+	hypothetical protein	NA	NA	NA	NA
WP_023853183.1\|685081_685303_-	hypothetical protein	NA	NA	NA	NA
WP_005012067.1\|685320_686271_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_019247942.1\|686910_687396_+\|transposase	transposase	C7U0W1	Enterobacteria_phage	7.3e-39	61.5
WP_010931447.1\|687382_688660_+\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	2.4e-150	64.7
WP_010931446.1\|688662_690081_+	DUF4055 domain-containing protein	R9TF43	Synechococcus_phage	2.2e-99	42.1
WP_010931445.1\|690109_691165_+	hypothetical protein	A0A0H5BBX3	Pseudomonas_phage	2.6e-97	50.6
WP_010931444.1\|691170_691413_+	hypothetical protein	A0A0H5AUE5	Pseudomonas_phage	5.6e-16	53.2
WP_010931443.1\|691535_692138_+	hypothetical protein	R9TF81	Synechococcus_phage	7.9e-27	43.6
WP_005012808.1\|693615_694566_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931442.1\|695240_695492_+	hypothetical protein	NA	NA	NA	NA
WP_019247789.1\|695554_696037_+	hypothetical protein	A0A2H4JE38	uncultured_Caudovirales_phage	1.8e-13	37.1
WP_010931440.1\|696038_696239_+	hypothetical protein	NA	NA	NA	NA
WP_010931439.1\|696238_696634_+	hypothetical protein	A0A2D2W284	Stenotrophomonas_phage	7.8e-07	35.0
WP_010931438.1\|696630_697029_+	hypothetical protein	I6PCW1	Cronobacter_phage	4.2e-16	38.0
WP_010931437.1\|697025_697448_+	DUF4128 domain-containing protein	NA	NA	NA	NA
WP_010931436.1\|697455_697956_+	HNH endonuclease	A0A1I9SEX5	Klebsiella_phage	4.4e-31	45.1
WP_010931435.1\|698210_698729_+	hypothetical protein	A0A1S5R1H0	Pseudomonas_phage	5.4e-24	38.3
WP_003813412.1\|698738_699068_+	hypothetical protein	A0A2H4J121	uncultured_Caudovirales_phage	2.9e-15	44.0
WP_010931434.1\|699085_699376_+	DUF1799 domain-containing protein	A0A2H4JBP7	uncultured_Caudovirales_phage	3.7e-14	45.2
WP_010931433.1\|699401_702014_+\|tail	phage tail tape measure protein	A0A2H4J107	uncultured_Caudovirales_phage	4.9e-105	38.6
WP_010931432.1\|702023_702383_+	hypothetical protein	NA	NA	NA	NA
WP_010931431.1\|702450_702984_+	DUF1833 family protein	A5A3Q9	Burkholderia_phage	1.1e-40	46.9
WP_010931430.1\|702980_703370_+	C40 family peptidase	A0A0G3EYJ9	Achromobacter_phage	3.0e-35	50.0
WP_010931429.1\|703362_707319_+	DUF1983 domain-containing protein	A0A0B5A1N2	Achromobacter_phage	3.9e-215	40.8

DBSCAN-SWA_9

713485 : 767415

Planktothrix_phage(50.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003814636.1\|713485_715216_+\|tRNA	proline--tRNA ligase	A0A2K9L3R9	Tupanvirus	4.6e-11	29.4
WP_010931419.1\|715268_715697_+	tol-pal system-associated acyl-CoA thioesterase	NA	NA	NA	NA
WP_003814641.1\|715699_716380_+	protein TolQ	NA	NA	NA	NA
WP_003814643.1\|716379_716838_+	protein TolR	NA	NA	NA	NA
WP_010931418.1\|716874_717849_+	cell envelope integrity protein TolA	NA	NA	NA	NA
WP_010931417.1\|717865_719182_+	Tol-Pal system protein TolB	NA	NA	NA	NA
WP_003814650.1\|719213_719711_+	peptidoglycan-associated lipoprotein Pal	NA	NA	NA	NA
WP_003814652.1\|719797_720487_+	tol-pal system protein YbgF	NA	NA	NA	NA
WP_010931416.1\|720486_721536_+	iron ABC transporter permease	NA	NA	NA	NA
WP_003814657.1\|721532_722327_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-15	30.6
WP_019247923.1\|722495_722846_+	hypothetical protein	NA	NA	NA	NA
WP_019247922.1\|722821_723379_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_005012808.1\|724508_725459_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929184.1\|727596_728826_+	spore maturation protein	NA	NA	NA	NA
WP_003814419.1\|728828_730271_-	pyruvate kinase	NA	NA	NA	NA
WP_010931414.1\|730375_731521_+	glycerate kinase	W6LM47	Streptococcus_phage	1.7e-41	42.2
WP_010931413.1\|731552_732350_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_010931412.1\|732374_733934_-	chaperone SurA	NA	NA	NA	NA
WP_033446130.1\|733930_736297_-	LPS-assembly protein LptD	NA	NA	NA	NA
WP_023852735.1\|736475_737516_+	phosphotransferase	NA	NA	NA	NA
WP_010931409.1\|737515_738208_+	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_003814436.1\|738351_739053_+	membrane protein	NA	NA	NA	NA
WP_003814437.1\|739037_739415_-	4a-hydroxytetrahydrobiopterin dehydratase	NA	NA	NA	NA
WP_005012067.1\|740146_741097_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003814441.1\|741256_742129_-	oxaloacetate decarboxylase	NA	NA	NA	NA
WP_003814443.1\|742469_742688_+	DUF1059 domain-containing protein	NA	NA	NA	NA
WP_019247242.1\|742727_744107_-	aminotransferase class III-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_010929976.1\|744148_745546_-	amidase family protein	NA	NA	NA	NA
WP_010927038.1\|745585_747238_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.0e-16	30.8
WP_010929977.1\|747241_748126_-	ABC transporter permease	NA	NA	NA	NA
WP_010929978.1\|748125_749067_-	ABC transporter permease	NA	NA	NA	NA
WP_010929979.1\|749145_750765_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010929980.1\|750931_751747_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_003814459.1\|751814_752384_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_005013747.1\|752384_753335_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003814461.1\|753989_755087_+	carboxynorspermidine decarboxylase	NA	NA	NA	NA
WP_003814462.1\|755120_756386_+	saccharopine dehydrogenase family protein	NA	NA	NA	NA
WP_010929591.1\|756543_757494_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929982.1\|757737_758328_+	polyisoprenoid-binding protein	NA	NA	NA	NA
WP_010929983.1\|758343_760788_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_003814467.1\|760907_761879_-	FecR family protein	NA	NA	NA	NA
WP_023852739.1\|762010_762535_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_005012067.1\|762494_763445_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929984.1\|763666_765862_-	DUF1156 domain-containing protein	NA	NA	NA	NA
WP_010929985.1\|765934_766363_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_005012808.1\|766464_767415_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_10

1030516 : 1085608

uncultured_Mediterranean_phage(37.5%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010929584.1\|1030516_1031467_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_010930130.1\|1031565_1032306_-	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
WP_010930131.1\|1032500_1034537_+	transketolase	NA	NA	NA	NA
WP_010930132.1\|1034554_1035565_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_010930133.1\|1035682_1036876_+	phosphoglycerate kinase	NA	NA	NA	NA
WP_010930134.1\|1036905_1037679_-	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_010930135.1\|1037675_1038866_-	acetate kinase	NA	NA	NA	NA
WP_003809454.1\|1038891_1039830_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_010930136.1\|1039826_1042175_-	DUF3141 domain-containing protein	NA	NA	NA	NA
WP_010930137.1\|1042329_1042971_-	glutathione transferase	NA	NA	NA	NA
WP_023853531.1\|1043074_1044208_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_023994624.1\|1044300_1044453_-	hypothetical protein	NA	NA	NA	NA
WP_010930138.1\|1044484_1045033_-	diguanylate cyclase	NA	NA	NA	NA
WP_003819814.1\|1045051_1045537_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_010930139.1\|1045714_1046653_+	DnaJ domain-containing protein	A0A0P0YMJ9	Yellowstone_lake_phycodnavirus	5.6e-11	24.1
WP_003809467.1\|1046655_1046973_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_019247197.1\|1047018_1047963_+	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_010930141.1\|1049643_1050294_+	molybdopterin adenylyltransferase	NA	NA	NA	NA
WP_003809479.1\|1050347_1050683_+	hypothetical protein	NA	NA	NA	NA
WP_010930142.1\|1050679_1051540_+	M23 family metallopeptidase	A0A292GJG6	Xanthomonas_phage	2.6e-15	36.1
WP_003819817.1\|1051556_1051838_-	hypothetical protein	NA	NA	NA	NA
WP_003809486.1\|1051911_1052175_-	translation initiation factor IF-1	NA	NA	NA	NA
WP_005012067.1\|1052418_1053369_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003811933.1\|1053667_1054405_-	RNA polymerase sigma factor FliA	NA	NA	NA	NA
WP_010930143.1\|1054840_1055164_+	flagellar transcriptional regulator FlhD	NA	NA	NA	NA
WP_003811929.1\|1055198_1055759_+	flagellar transcriptional regulator FlhC	NA	NA	NA	NA
WP_003811927.1\|1055879_1056755_+	flagellar motor stator protein MotA	NA	NA	NA	NA
WP_003817154.1\|1056767_1057715_+	flagellar motor protein MotB	NA	NA	NA	NA
WP_019247393.1\|1057816_1058110_+	response regulator	NA	NA	NA	NA
WP_010930144.1\|1058136_1060194_+	chemotaxis protein CheA	NA	NA	NA	NA
WP_003811919.1\|1060208_1060709_+	chemotaxis protein CheW	NA	NA	NA	NA
WP_010930145.1\|1060782_1062489_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-12	41.7
WP_010930146.1\|1063352_1064405_+	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
WP_003811911.1\|1064457_1064847_+	chemotaxis protein CheY	Q56AR1	Bacillus_thuringiensis_phage	5.7e-10	33.3
WP_003817162.1\|1064855_1065488_+	protein phosphatase CheZ	NA	NA	NA	NA
WP_010930147.1\|1065587_1066604_-\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_003819773.1\|1067434_1068442_+	aldo/keto reductase	NA	NA	NA	NA
WP_014486064.1\|1068438_1070082_-	apolipoprotein N-acyltransferase	NA	NA	NA	NA
WP_010930149.1\|1070078_1070966_-	CBS domain-containing protein	NA	NA	NA	NA
WP_003809396.1\|1071106_1071580_-	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_010930151.1\|1071569_1072592_-	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	8.7e-50	45.4
WP_015041211.1\|1072588_1074016_-\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
WP_010931363.1\|1074953_1075970_-\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_003809411.1\|1076302_1077238_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	3.0e-41	35.5
WP_010930154.1\|1077287_1079168_-	protein translocase subunit SecD	NA	NA	NA	NA
WP_003809416.1\|1079234_1079579_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.0e-10	40.4
WP_010930155.1\|1079723_1080860_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.9e-85	44.4
WP_023853534.1\|1080856_1081930_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_003809423.1\|1082087_1083524_+	D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase	NA	NA	NA	NA
WP_010930157.1\|1083614_1084256_+	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_010930320.1\|1084591_1085608_+\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA

DBSCAN-SWA_11

1091583 : 1163603

Planktothrix_phage(18.18%)

transposase,holin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003819794.1\|1091583_1091997_+\|holin	phage holin family protein	NA	NA	NA	NA
WP_010930161.1\|1091998_1092358_+	hypothetical protein	NA	NA	NA	NA
WP_023853525.1\|1092400_1093945_-	4-hydroxy-3-polyprenylbenzoate decarboxylase	NA	NA	NA	NA
WP_010930163.1\|1094028_1094859_+	lytic transglycosylase domain-containing protein	NA	NA	NA	NA
WP_010930164.1\|1094893_1096048_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_010930165.1\|1096090_1096963_+	hypothetical protein	NA	NA	NA	NA
WP_014486065.1\|1097079_1099368_+	NADP-dependent malic enzyme	NA	NA	NA	NA
WP_003809441.1\|1100574_1101039_+	barstar family protein	NA	NA	NA	NA
WP_005013747.1\|1101065_1102016_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_157734659.1\|1102033_1102171_+	hypothetical protein	NA	NA	NA	NA
WP_010930167.1\|1102383_1103160_-	phosphate ABC transporter ATP-binding protein PstB	G9BWD6	Planktothrix_phage	4.3e-17	28.7
WP_003809638.1\|1103204_1104062_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_010930169.1\|1104083_1105100_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_014486066.1\|1105234_1106275_-	phosphate ABC transporter substrate-binding protein PstS	M4QHS4	Cyanophage	2.1e-51	40.2
WP_010930171.1\|1106469_1108551_-	polyphosphate kinase 1	NA	NA	NA	NA
WP_010930172.1\|1108786_1110280_+	exopolyphosphatase	NA	NA	NA	NA
WP_003809629.1\|1110510_1111305_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003819875.1\|1111525_1112884_-	phosphoglucosamine mutase	NA	NA	NA	NA
WP_010930173.1\|1112880_1113723_-	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	3.2e-26	32.5
WP_010930174.1\|1113741_1115628_-	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	M4QMW8	Micromonas_pusilla_virus	1.4e-109	41.5
WP_162096758.1\|1115569_1115821_+	hypothetical protein	NA	NA	NA	NA
WP_010930175.1\|1115865_1116498_-	RlmE family RNA methyltransferase	NA	NA	NA	NA
WP_003809618.1\|1116516_1117119_+	YhbY family RNA-binding protein	NA	NA	NA	NA
WP_005012067.1\|1117270_1118221_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_161633091.1\|1118801_1119509_+	DUF192 domain-containing protein	NA	NA	NA	NA
WP_003812707.1\|1119867_1120854_-	homoserine kinase	NA	NA	NA	NA
WP_010930178.1\|1120993_1122007_+\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_005012067.1\|1122003_1122954_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_155120815.1\|1122971_1123112_+	hypothetical protein	NA	NA	NA	NA
WP_003812703.1\|1123066_1123525_-	CBS domain-containing protein	NA	NA	NA	NA
WP_003812701.1\|1123561_1124875_-	YihY family inner membrane protein	NA	NA	NA	NA
WP_010930180.1\|1124892_1125264_+	DUF2069 domain-containing protein	NA	NA	NA	NA
WP_010930181.1\|1125260_1126724_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	1.7e-43	32.5
WP_010930182.1\|1126864_1127593_+	response regulator transcription factor	NA	NA	NA	NA
WP_010930183.1\|1127574_1130424_-	EAL domain-containing protein	NA	NA	NA	NA
WP_010930184.1\|1131753_1132578_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.0e-08	22.7
WP_010930185.1\|1132577_1133456_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_010930186.1\|1134360_1135476_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_020699602.1\|1135504_1136299_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.2e-11	23.3
WP_010930188.1\|1136295_1138161_+	long-chain fatty acid--CoA ligase	A0A1V0SBX8	Catovirus	9.3e-50	23.3
WP_003812436.1\|1138239_1138872_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_010930189.1\|1138868_1139171_-	membrane protein	NA	NA	NA	NA
WP_010930190.1\|1139213_1140734_-\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	1.2e-82	36.0
WP_010926447.1\|1140740_1141496_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_010926448.1\|1141525_1142630_-	peptide chain release factor 2	NA	NA	NA	NA
WP_010930191.1\|1142732_1144433_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.3e-50	28.3
WP_023853218.1\|1144414_1145356_-	hypothetical protein	NA	NA	NA	NA
WP_019247537.1\|1145401_1146682_+	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_003812422.1\|1146674_1147370_+	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	7.0e-35	38.6
WP_010928340.1\|1147403_1148231_+	TatD family hydrolase	NA	NA	NA	NA
WP_010930194.1\|1148512_1151743_+	autotransporter SphB3	NA	NA	NA	NA
WP_010930196.1\|1152478_1156405_+	inverse autotransporter beta-barrel domain-containing protein	NA	NA	NA	NA
WP_023853221.1\|1158304_1160101_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_019248398.1\|1160100_1161069_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003816844.1\|1161138_1161984_+	PHP domain-containing protein	NA	NA	NA	NA
WP_003812405.1\|1162051_1162606_+	transcription elongation factor GreB	NA	NA	NA	NA
WP_010930198.1\|1162652_1163603_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_12

1323054 : 1391541

Planktothrix_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012808.1\|1323054_1324005_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930283.1\|1324773_1325412_-	glutathione S-transferase	NA	NA	NA	NA
WP_019247793.1\|1326301_1326748_+	glutamate racemase	NA	NA	NA	NA
WP_010930284.1\|1326829_1327531_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-17	30.4
WP_003811277.1\|1327531_1328299_-	high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG	A0A2H4PQG7	Staphylococcus_phage	1.2e-14	26.4
WP_010930285.1\|1328295_1329534_-	high-affinity branched-chain amino acid ABC transporter permease LivM	NA	NA	NA	NA
WP_003811272.1\|1329533_1330460_-	high-affinity branched-chain amino acid ABC transporter permease LivH	NA	NA	NA	NA
WP_010930286.1\|1330562_1331678_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_005015810.1\|1331693_1332644_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930287.1\|1332997_1333579_-	queuosine precursor transporter	A0A2I7SAW6	Vibrio_phage	9.4e-17	37.3
WP_003811267.1\|1333575_1334409_-	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
WP_010930288.1\|1334619_1335933_+	sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB	NA	NA	NA	NA
WP_070797684.1\|1336109_1336991_+	sn-glycerol-3-phosphate ABC transporter permease UgpA	NA	NA	NA	NA
WP_003811259.1\|1337010_1337862_+	sn-glycerol-3-phosphate ABC transporter permease UgpE	NA	NA	NA	NA
WP_010930289.1\|1337914_1339003_+	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	2.2e-19	31.2
WP_010930290.1\|1339113_1340241_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003811244.1\|1340475_1341087_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_010929584.1\|1341185_1342136_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_003811293.1\|1342357_1342735_-	DUF423 domain-containing protein	NA	NA	NA	NA
WP_003811295.1\|1342882_1343380_+	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_010930291.1\|1343376_1343904_+	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_003811298.1\|1344037_1344853_+	exported protein	NA	NA	NA	NA
WP_010930292.1\|1344865_1346047_-	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_003811301.1\|1346094_1346988_-	phosphatidylserine decarboxylase	NA	NA	NA	NA
WP_010930293.1\|1347114_1347585_-	hypothetical protein	NA	NA	NA	NA
WP_010930294.1\|1347710_1348538_-	DUF3298 domain-containing protein	NA	NA	NA	NA
WP_010930295.1\|1349629_1350094_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_010930296.1\|1350105_1350807_-	thiol:disulfide oxidoreductase	NA	NA	NA	NA
WP_003811310.1\|1350916_1351417_-	glutathione peroxidase	Q6VZR0	Canarypox_virus	4.7e-25	38.4
WP_010930297.1\|1351499_1352678_-	DUF1501 domain-containing protein	NA	NA	NA	NA
WP_003811313.1\|1354305_1354641_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_010930298.1\|1354828_1356277_+	CoA transferase	NA	NA	NA	NA
WP_023852799.1\|1356334_1356679_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	3.0e-31	58.4
WP_003811316.1\|1356785_1357325_-	peroxiredoxin	NA	NA	NA	NA
WP_005012067.1\|1357417_1358368_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_023999972.1\|1358385_1358625_+	hypothetical protein	NA	NA	NA	NA
WP_019247530.1\|1359106_1359538_-	BcpO-related WXXGXW repeat protein	NA	NA	NA	NA
WP_010930300.1\|1359719_1360124_-	DoxX family protein	NA	NA	NA	NA
WP_010930301.1\|1361360_1361684_+	hypothetical protein	NA	NA	NA	NA
WP_019247533.1\|1361686_1362574_-	aldo/keto reductase	NA	NA	NA	NA
WP_003811322.1\|1362606_1363032_-	universal stress protein	NA	NA	NA	NA
WP_019247534.1\|1363103_1363457_-	hypothetical protein	NA	NA	NA	NA
WP_003811324.1\|1363696_1364203_-	hypothetical protein	NA	NA	NA	NA
WP_010930302.1\|1364241_1365573_-	transcriptional regulator PtsJ	NA	NA	NA	NA
WP_003811326.1\|1365632_1366448_+	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_010930303.1\|1366444_1367299_+	pyridoxine/pyridoxal/pyridoxamine kinase	NA	NA	NA	NA
WP_010930304.1\|1370361_1372905_-	malto-oligosyltrehalose synthase	NA	NA	NA	NA
WP_010930305.1\|1374271_1376026_-	malto-oligosyltrehalose trehalohydrolase	NA	NA	NA	NA
WP_010930306.1\|1376022_1378143_-	glycogen debranching protein GlgX	NA	NA	NA	NA
WP_010930307.1\|1378147_1380343_-	1,4-alpha-glucan branching protein GlgB	NA	NA	NA	NA
WP_010930308.1\|1380339_1383681_-	maltose alpha-D-glucosyltransferase	NA	NA	NA	NA
WP_010930208.1\|1386483_1387434_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003811361.1\|1387499_1387679_-	hypothetical protein	NA	NA	NA	NA
WP_019247449.1\|1387795_1388551_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_010930310.1\|1388537_1389683_-	DUF3182 family protein	NA	NA	NA	NA
WP_010930208.1\|1390590_1391541_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_13

1417544 : 1471114

Planktothrix_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010930208.1\|1417544_1418495_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003812022.1\|1418593_1419364_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.8e-30	39.1
WP_003812020.1\|1419360_1420041_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_010930319.1\|1420107_1420896_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010931363.1\|1421142_1422159_-\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_010930321.1\|1422464_1423619_+	flagellar type III secretion system protein FlhB	NA	NA	NA	NA
WP_003817170.1\|1428124_1428607_-	flagellar protein FlgN	NA	NA	NA	NA
WP_003817172.1\|1428624_1428915_-	flagellar biosynthesis anti-sigma factor FlgM	NA	NA	NA	NA
WP_010930322.1\|1429041_1429752_-	flagellar basal body P-ring formation protein FlgA	NA	NA	NA	NA
WP_010930323.1\|1429935_1430343_+	flagellar basal body rod protein FlgB	NA	NA	NA	NA
WP_003817176.1\|1430355_1430775_+	flagellar basal body rod protein FlgC	NA	NA	NA	NA
WP_010930324.1\|1430822_1431527_+	flagellar basal body rod modification protein FlgD	NA	NA	NA	NA
WP_003817180.1\|1431592_1433014_+	flagellar hook-basal body complex protein	NA	NA	NA	NA
WP_003817181.1\|1433052_1433817_+	flagellar basal body rod protein FlgF	NA	NA	NA	NA
WP_010930325.1\|1433860_1434646_+	flagellar basal-body rod protein FlgG	NA	NA	NA	NA
WP_010930326.1\|1434645_1435335_+	flagellar basal body L-ring protein FlgH	NA	NA	NA	NA
WP_010930327.1\|1435337_1436471_+	flagellar basal body P-ring protein FlgI	NA	NA	NA	NA
WP_010930328.1\|1436488_1437511_+	flagellar assembly peptidoglycan hydrolase FlgJ	A0A088F6W1	Sulfitobacter_phage	1.9e-12	31.4
WP_010930329.1\|1437580_1439227_+	flagellar hook-associated protein FlgK	NA	NA	NA	NA
WP_010930330.1\|1439260_1440793_+	flagellar hook-associated protein FlgL	NA	NA	NA	NA
WP_010930331.1\|1440871_1442692_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	6.4e-11	52.6
WP_010930332.1\|1442812_1444432_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.5e-08	45.3
WP_014486070.1\|1444610_1446053_+	PAS domain-containing protein	A0A1B0V854	Salmonella_phage	1.0e-35	41.8
WP_010929632.1\|1446269_1447286_+\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_010930333.1\|1447332_1448121_-	flagellar biosynthetic protein FliR	NA	NA	NA	NA
WP_003811859.1\|1448143_1448413_-	flagellar biosynthesis protein FliQ	NA	NA	NA	NA
WP_010930334.1\|1448429_1449164_-	flagellar type III secretion system pore protein FliP	NA	NA	NA	NA
WP_003811855.1\|1449232_1449574_-	flagellar biosynthetic protein FliO	NA	NA	NA	NA
WP_010930335.1\|1449584_1450085_-	flagellar motor switch protein FliN	NA	NA	NA	NA
WP_003811852.1\|1450077_1451088_-	flagellar motor switch protein FliM	NA	NA	NA	NA
WP_003811850.1\|1451090_1451663_-	flagellar basal body-associated protein FliL	NA	NA	NA	NA
WP_005012067.1\|1452032_1452983_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930283.1\|1453751_1454390_-	glutathione S-transferase	NA	NA	NA	NA
WP_019247793.1\|1455279_1455726_+	glutamate racemase	NA	NA	NA	NA
WP_010930284.1\|1455807_1456509_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-17	30.4
WP_003811277.1\|1456509_1457277_-	high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG	A0A2H4PQG7	Staphylococcus_phage	1.2e-14	26.4
WP_010930285.1\|1457273_1458512_-	high-affinity branched-chain amino acid ABC transporter permease LivM	NA	NA	NA	NA
WP_003811272.1\|1458511_1459438_-	high-affinity branched-chain amino acid ABC transporter permease LivH	NA	NA	NA	NA
WP_010930286.1\|1459540_1460656_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_005015810.1\|1460671_1461622_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930287.1\|1461975_1462557_-	queuosine precursor transporter	A0A2I7SAW6	Vibrio_phage	9.4e-17	37.3
WP_003811267.1\|1462553_1463387_-	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
WP_010930288.1\|1463597_1464911_+	sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB	NA	NA	NA	NA
WP_070797684.1\|1465087_1465969_+	sn-glycerol-3-phosphate ABC transporter permease UgpA	NA	NA	NA	NA
WP_003811259.1\|1465988_1466840_+	sn-glycerol-3-phosphate ABC transporter permease UgpE	NA	NA	NA	NA
WP_010930289.1\|1466892_1467981_+	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	2.2e-19	31.2
WP_010930290.1\|1468091_1469219_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003811244.1\|1469453_1470065_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_010929584.1\|1470163_1471114_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_14

1515461 : 1581961

uncultured_Caudovirales_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010930208.1\|1515461_1516412_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003811361.1\|1516477_1516657_-	hypothetical protein	NA	NA	NA	NA
WP_019247449.1\|1516773_1517529_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_010930310.1\|1517515_1518661_-	DUF3182 family protein	NA	NA	NA	NA
WP_010930208.1\|1519568_1520519_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003811370.1\|1520706_1521909_-	cardiolipin synthase ClsB	NA	NA	NA	NA
WP_003811372.1\|1521905_1522664_-	hypothetical protein	NA	NA	NA	NA
WP_003811375.1\|1523057_1523690_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010930311.1\|1524645_1527246_+	BP1344/BB2830 family autotransporter	NA	NA	NA	NA
WP_010930312.1\|1527233_1530653_-	TM0106 family RecB-like putative nuclease	NA	NA	NA	NA
WP_010930313.1\|1530660_1531566_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003811381.1\|1531704_1532283_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_010930314.1\|1532279_1533191_+	CoA ester lyase	NA	NA	NA	NA
WP_010930315.1\|1533204_1533885_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_010930316.1\|1534086_1536126_+	acetyl-CoA synthetase	NA	NA	NA	NA
WP_014486069.1\|1536144_1537131_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010930317.1\|1537156_1537954_+	citryl-CoA lyase	NA	NA	NA	NA
WP_003811389.1\|1537950_1539144_+	CoA transferase	NA	NA	NA	NA
WP_003811391.1\|1539140_1540103_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_003811393.1\|1540120_1541161_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_003811396.1\|1541148_1541757_-	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
WP_010930318.1\|1543345_1544341_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_003811400.1\|1544360_1545539_+	mandelate racemase/muconate lactonizing enzyme family protein	NA	NA	NA	NA
WP_003811401.1\|1545549_1546467_+	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_010930208.1\|1546522_1547473_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003812022.1\|1547571_1548342_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.8e-30	39.1
WP_003812020.1\|1548338_1549019_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_010930319.1\|1549085_1549874_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010931363.1\|1550120_1551137_-\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_010930321.1\|1551442_1552597_+	flagellar type III secretion system protein FlhB	NA	NA	NA	NA
WP_003817170.1\|1557102_1557585_-	flagellar protein FlgN	NA	NA	NA	NA
WP_003817172.1\|1557602_1557893_-	flagellar biosynthesis anti-sigma factor FlgM	NA	NA	NA	NA
WP_010930322.1\|1558019_1558730_-	flagellar basal body P-ring formation protein FlgA	NA	NA	NA	NA
WP_010930323.1\|1558913_1559321_+	flagellar basal body rod protein FlgB	NA	NA	NA	NA
WP_003817176.1\|1559333_1559753_+	flagellar basal body rod protein FlgC	NA	NA	NA	NA
WP_010930324.1\|1559800_1560505_+	flagellar basal body rod modification protein FlgD	NA	NA	NA	NA
WP_003817180.1\|1560570_1561992_+	flagellar hook-basal body complex protein	NA	NA	NA	NA
WP_003817181.1\|1562030_1562795_+	flagellar basal body rod protein FlgF	NA	NA	NA	NA
WP_010930325.1\|1562838_1563624_+	flagellar basal-body rod protein FlgG	NA	NA	NA	NA
WP_010930326.1\|1563623_1564313_+	flagellar basal body L-ring protein FlgH	NA	NA	NA	NA
WP_010930327.1\|1564315_1565449_+	flagellar basal body P-ring protein FlgI	NA	NA	NA	NA
WP_010930328.1\|1565466_1566489_+	flagellar assembly peptidoglycan hydrolase FlgJ	A0A088F6W1	Sulfitobacter_phage	1.9e-12	31.4
WP_010930329.1\|1566558_1568205_+	flagellar hook-associated protein FlgK	NA	NA	NA	NA
WP_010930330.1\|1568238_1569771_+	flagellar hook-associated protein FlgL	NA	NA	NA	NA
WP_010930331.1\|1569849_1571670_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	6.4e-11	52.6
WP_010930332.1\|1571790_1573410_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.5e-08	45.3
WP_014486070.1\|1573588_1575031_+	PAS domain-containing protein	A0A1B0V854	Salmonella_phage	1.0e-35	41.8
WP_010929632.1\|1575247_1576264_+\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_010930333.1\|1576310_1577099_-	flagellar biosynthetic protein FliR	NA	NA	NA	NA
WP_003811859.1\|1577121_1577391_-	flagellar biosynthesis protein FliQ	NA	NA	NA	NA
WP_010930334.1\|1577407_1578142_-	flagellar type III secretion system pore protein FliP	NA	NA	NA	NA
WP_003811855.1\|1578210_1578552_-	flagellar biosynthetic protein FliO	NA	NA	NA	NA
WP_010930335.1\|1578562_1579063_-	flagellar motor switch protein FliN	NA	NA	NA	NA
WP_003811852.1\|1579055_1580066_-	flagellar motor switch protein FliM	NA	NA	NA	NA
WP_003811850.1\|1580068_1580641_-	flagellar basal body-associated protein FliL	NA	NA	NA	NA
WP_005012067.1\|1581010_1581961_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_15

1610132 : 1648722

Emiliania_huxleyi_virus(14.29%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010930352.1\|1610132_1611467_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_010930353.1\|1611519_1613856_+	outer membrane protein assembly factor BamA	NA	NA	NA	NA
WP_003811782.1\|1613981_1614545_+	OmpH family outer membrane protein	NA	NA	NA	NA
WP_010930354.1\|1614553_1615645_+	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
WP_003811776.1\|1615716_1616172_+	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_010930355.1\|1616172_1616967_+	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
WP_010930356.1\|1616963_1618145_+	lipid-A-disaccharide synthase	NA	NA	NA	NA
WP_003811770.1\|1618131_1618737_+	ribonuclease HII	G9E3X7	Emiliania_huxleyi_virus	8.8e-26	40.2
WP_003811768.1\|1618733_1619507_+	RNA methyltransferase	NA	NA	NA	NA
WP_010930357.1\|1619518_1620346_-	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_010930358.1\|1620507_1622871_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	2.2e-165	35.9
WP_010930359.1\|1622938_1623658_-	glutamine amidotransferase	NA	NA	NA	NA
WP_003811761.1\|1623781_1624207_+	membrane protein	NA	NA	NA	NA
WP_005012067.1\|1624241_1625192_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003811759.1\|1625309_1626236_+	paraslipin	NA	NA	NA	NA
WP_010930360.1\|1626301_1627459_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.3e-14	36.2
WP_003811754.1\|1627439_1627907_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	6.2e-27	45.1
WP_005015810.1\|1628054_1629005_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003811752.1\|1629021_1629456_+	type II toxin-antitoxin system RatA family toxin	NA	NA	NA	NA
WP_003811750.1\|1629445_1629796_+	RnfH family protein	NA	NA	NA	NA
WP_003811748.1\|1629992_1631147_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_003811746.1\|1631143_1632316_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_003811743.1\|1632363_1633257_+	3-hydroxyisobutyrate dehydrogenase	NA	NA	NA	NA
WP_003811741.1\|1633302_1633740_+	PaaI family thioesterase	NA	NA	NA	NA
WP_010930362.1\|1633799_1634489_+	VIT family protein	NA	NA	NA	NA
WP_010930363.1\|1634498_1635449_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_076879624.1\|1635547_1636498_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_010930364.1\|1636596_1637559_-	transaldolase	H6WFR1	Cyanophage	7.5e-11	29.2
WP_023852833.1\|1637785_1638940_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	3.3e-53	35.4
WP_010930366.1\|1638950_1642193_+	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_003809593.1\|1643214_1643859_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_070797685.1\|1643869_1644769_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003809599.1\|1644816_1645902_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.4e-27	37.7
WP_010930368.1\|1645898_1647593_-	iron ABC transporter permease	NA	NA	NA	NA
WP_162268680.1\|1647589_1647754_-	hypothetical protein	NA	NA	NA	NA
WP_005012808.1\|1647771_1648722_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_16

2023848 : 2098708

Bacillus_virus(33.33%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023997643.1\|2023848_2024799_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_029443761.1\|2024859_2025894_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_010930633.1\|2025993_2027259_+	aspartate kinase	NA	NA	NA	NA
WP_010929632.1\|2027652_2028669_-\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_010930634.1\|2029012_2029513_+	cupin domain-containing protein	NA	NA	NA	NA
WP_003810016.1\|2029554_2029869_+	NIPSNAP family protein	NA	NA	NA	NA
WP_010930635.1\|2029878_2030820_+	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
WP_003810020.1\|2030816_2031341_+	TRAP transporter small permease	NA	NA	NA	NA
WP_003820128.1\|2031343_2032612_+	TRAP transporter large permease	NA	NA	NA	NA
WP_004568037.1\|2032640_2033624_+	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_010930636.1\|2033620_2034430_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_003820133.1\|2034426_2035230_+	aspartate dehydrogenase	NA	NA	NA	NA
WP_010930638.1\|2035244_2036012_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_003820136.1\|2036099_2036738_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_010930639.1\|2036742_2037696_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010930640.1\|2037807_2038932_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003810039.1\|2040569_2041397_+	ABC transporter permease	NA	NA	NA	NA
WP_010930641.1\|2041393_2042197_+	ABC transporter permease	NA	NA	NA	NA
WP_010930642.1\|2042193_2043285_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.3e-26	35.6
WP_010930643.1\|2043691_2044720_-	NADH:flavin oxidoreductase	NA	NA	NA	NA
WP_019247348.1\|2044878_2045583_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010930644.1\|2045591_2047712_-	acetate--CoA ligase family protein	NA	NA	NA	NA
WP_010930645.1\|2047712_2048669_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_003820147.1\|2048737_2049130_-	RidA family protein	NA	NA	NA	NA
WP_010930646.1\|2049133_2049610_-	MaoC family dehydratase	NA	NA	NA	NA
WP_003820150.1\|2049623_2049959_-	MaoC family dehydratase	NA	NA	NA	NA
WP_010930647.1\|2049965_2050415_-	hypothetical protein	NA	NA	NA	NA
WP_033446196.1\|2050628_2050922_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010930648.1\|2050974_2052087_+	alkene reductase	NA	NA	NA	NA
WP_015041299.1\|2052091_2052730_-	hypothetical protein	NA	NA	NA	NA
WP_003820153.1\|2052710_2053970_-	poly-beta-1,6 N-acetyl-D-glucosamine synthase	NA	NA	NA	NA
WP_010930650.1\|2053973_2056079_-	poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB	NA	NA	NA	NA
WP_010930651.1\|2056084_2058070_-	poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA	NA	NA	NA	NA
WP_010930652.1\|2058278_2058515_+	membrane protein	NA	NA	NA	NA
WP_003820159.1\|2058859_2059345_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010929591.1\|2059712_2060663_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930653.1\|2060709_2061918_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010930654.1\|2062009_2063959_+	ABC transporter permease	NA	NA	NA	NA
WP_010930655.1\|2063955_2064732_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.3e-13	29.5
WP_010930656.1\|2064728_2065499_+	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	3.3e-09	29.2
WP_029443796.1\|2067942_2068431_-	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_010930658.1\|2068540_2069692_-	NAD(P)-binding protein	NA	NA	NA	NA
WP_010929891.1\|2069992_2070745_+	maleate isomerase	NA	NA	NA	NA
WP_010929892.1\|2071611_2072643_+	hypothetical protein	NA	NA	NA	NA
WP_010929893.1\|2072658_2073276_+	isochorismatase family protein	NA	NA	NA	NA
WP_010930525.1\|2073467_2074484_+\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_061363663.1\|2076556_2077963_+	ferric reductase	NA	NA	NA	NA
WP_010930660.1\|2077973_2080082_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_010930661.1\|2080836_2081802_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_023853569.1\|2083507_2084776_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_023853578.1\|2085085_2085742_+	response regulator transcription factor	NA	NA	NA	NA
WP_010930663.1\|2085843_2087271_+	phosphomannomutase/phosphoglucomutase	NA	NA	NA	NA
WP_010930664.1\|2087280_2088852_+	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_010930665.1\|2089034_2089988_+	serine O-acetyltransferase	NA	NA	NA	NA
WP_010930666.1\|2090049_2091276_+	MFS transporter	NA	NA	NA	NA
WP_010930667.1\|2091288_2092113_+	NAD-dependent protein deacetylase	NA	NA	NA	NA
WP_010930668.1\|2092181_2093033_-	inositol monophosphatase	NA	NA	NA	NA
WP_010930669.1\|2093210_2094680_-	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_010930670.1\|2094759_2096025_-	4-aminobutyrate--2-oxoglutarate transaminase	NA	NA	NA	NA
WP_005013747.1\|2097757_2098708_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_17

2185645 : 2258858

Bacillus_virus(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010929591.1\|2185645_2186596_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003818523.1\|2187047_2188049_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003810306.1\|2188221_2189079_+	proline/glycine betaine ABC transporter permease	NA	NA	NA	NA
WP_003810308.1\|2189075_2190338_+	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.8e-28	36.6
WP_003818524.1\|2190438_2190813_+	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_010930713.1\|2190885_2192073_+	acetyl-CoA C-acyltransferase family protein	NA	NA	NA	NA
WP_010930714.1\|2192157_2192928_+	spermidine synthase	NA	NA	NA	NA
WP_010930715.1\|2193041_2193806_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_010930716.1\|2193756_2195058_+	malonyl-CoA decarboxylase	NA	NA	NA	NA
WP_023853104.1\|2195066_2195861_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_003818532.1\|2197605_2198577_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_003818533.1\|2198733_2199246_+	superoxide dismutase family protein	Q9MC02	Salmonella_phage	1.8e-43	52.3
WP_010930718.1\|2199404_2200379_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010930719.1\|2201379_2202174_+	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	5.1e-05	25.7
WP_003818535.1\|2202199_2203006_-	TOBE domain-containing protein	NA	NA	NA	NA
WP_003810329.1\|2203116_2203707_+	DUF4136 domain-containing protein	NA	NA	NA	NA
WP_010930720.1\|2203717_2204896_+	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_010930721.1\|2204998_2205373_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_019248531.1\|2205625_2206957_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_019247651.1\|2207023_2210254_+	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
WP_003810344.1\|2211744_2212491_+	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
WP_010930724.1\|2212575_2213037_+	holo-ACP synthase	NA	NA	NA	NA
WP_010930725.1\|2213074_2214133_+	beta-N-acetylhexosaminidase	NA	NA	NA	NA
WP_010930726.1\|2214095_2215925_+	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_003810356.1\|2215964_2216537_+	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_010930727.1\|2217961_2218783_-	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A2I7SAX1	Vibrio_phage	4.1e-42	37.6
WP_010930728.1\|2219101_2220424_+	isocitrate lyase	NA	NA	NA	NA
WP_010930729.1\|2220783_2221419_+	membrane protein	NA	NA	NA	NA
WP_010930730.1\|2221378_2222329_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_010930731.1\|2223199_2224072_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_010930732.1\|2224149_2225289_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010930733.1\|2225647_2226904_+	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_003816691.1\|2226909_2227437_+	aromatic-ring-hydroxylating dioxygenase subunit beta	NA	NA	NA	NA
WP_003816690.1\|2227441_2228260_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_003816687.1\|2228259_2228982_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_010930735.1\|2229003_2229318_+	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_010930736.1\|2229335_2230484_+	CoA transferase	NA	NA	NA	NA
WP_010930737.1\|2230514_2231390_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003816680.1\|2231386_2232706_-	AMP-binding protein	NA	NA	NA	NA
WP_014486081.1\|2232778_2233975_-	acetyl-CoA acetyltransferase	NA	NA	NA	NA
WP_010930739.1\|2233985_2235473_-	hydroxymethylglutaryl-CoA synthase family protein	NA	NA	NA	NA
WP_010930740.1\|2238067_2238967_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_023852887.1\|2239104_2240070_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_005015810.1\|2240168_2241119_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_005013747.1\|2241340_2242291_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003812024.1\|2242287_2242590_-	SelT/SelW/SelH family protein	NA	NA	NA	NA
WP_003812026.1\|2242749_2243154_+	group III truncated hemoglobin	NA	NA	NA	NA
WP_010930743.1\|2243146_2244373_+	NnrS family protein	NA	NA	NA	NA
WP_003812030.1\|2244369_2244816_+	membrane protein	NA	NA	NA	NA
WP_003812032.1\|2244885_2245668_+	exodeoxyribonuclease III	NA	NA	NA	NA
WP_010930744.1\|2245709_2247215_+	M81 family metallopeptidase	NA	NA	NA	NA
WP_019247851.1\|2247500_2248334_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_010930745.1\|2249771_2250593_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_010930746.1\|2250611_2251466_-	polysaccharide deacetylase	NA	NA	NA	NA
WP_003812044.1\|2251469_2252441_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_019247855.1\|2253125_2253302_+	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_005013747.1\|2253787_2254738_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003812172.1\|2255875_2256172_-	hypothetical protein	NA	NA	NA	NA
WP_019247707.1\|2256346_2257699_+	glutathione-disulfide reductase	A0A2K5B2C5	Erysipelothrix_phage	2.9e-45	27.6
WP_010930153.1\|2257841_2258858_-\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA

DBSCAN-SWA_18

2272064 : 2316387

Bacillus_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010929577.1\|2272064_2273015_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_005012067.1\|2273667_2274618_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_023997035.1\|2274701_2276519_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.3e-37	27.4
WP_019247659.1\|2276592_2277240_+	hypothetical protein	NA	NA	NA	NA
WP_010930758.1\|2277252_2278182_-	ZIP family metal transporter	NA	NA	NA	NA
WP_014905663.1\|2278351_2278816_+	hypothetical protein	NA	NA	NA	NA
WP_003816977.1\|2279063_2279744_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003816975.1\|2279792_2281484_+	STAS domain-containing protein	A0A2H4J153	uncultured_Caudovirales_phage	5.0e-42	27.3
WP_010930760.1\|2281499_2282051_-	SRPBCC family protein	NA	NA	NA	NA
WP_003816971.1\|2282047_2282419_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010930761.1\|2282531_2283368_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_029443822.1\|2283378_2283903_-	DUF302 domain-containing protein	NA	NA	NA	NA
WP_003812228.1\|2284000_2284180_+	DUF3008 family protein	NA	NA	NA	NA
WP_010930763.1\|2284309_2285284_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003816964.1\|2285414_2285771_+	DUF1428 domain-containing protein	NA	NA	NA	NA
WP_010930764.1\|2285760_2286636_-	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
WP_010930765.1\|2286734_2287619_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010930766.1\|2287640_2288936_-	DUF445 domain-containing protein	NA	NA	NA	NA
WP_003816959.1\|2289884_2290535_+	flavodoxin family protein	NA	NA	NA	NA
WP_010930767.1\|2290622_2292143_-	aldehyde dehydrogenase	NA	NA	NA	NA
WP_010930768.1\|2292400_2294266_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_005012067.1\|2295311_2296262_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_162268681.1\|2296279_2296420_+	hypothetical protein	NA	NA	NA	NA
WP_010930769.1\|2297234_2297594_-	CidA/LrgA family protein	NA	NA	NA	NA
WP_010930770.1\|2297581_2299018_-	dethiobiotin synthase	NA	NA	NA	NA
WP_010930771.1\|2299014_2299668_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_010930772.1\|2299664_2300858_-	8-amino-7-oxononanoate synthase	NA	NA	NA	NA
WP_010930773.1\|2300961_2302236_+	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	9.6e-14	28.9
WP_005012067.1\|2302232_2303183_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_162268682.1\|2303200_2303455_+	hypothetical protein	NA	NA	NA	NA
WP_010930774.1\|2303349_2304324_+	membrane protein	NA	NA	NA	NA
WP_003810379.1\|2304320_2304464_+	cbb3-type cytochrome oxidase assembly protein CcoS	NA	NA	NA	NA
WP_003810383.1\|2306085_2306748_+	cytochrome-c oxidase, cbb3-type subunit II	NA	NA	NA	NA
WP_003818560.1\|2306750_2306927_+	cytochrome oxidase	NA	NA	NA	NA
WP_010930775.1\|2306923_2307862_+	cytochrome-c oxidase, cbb3-type subunit III	NA	NA	NA	NA
WP_010930776.1\|2307953_2309444_+	cytochrome c oxidase accessory protein CcoG	NA	NA	NA	NA
WP_010930777.1\|2309529_2309682_+	lipoprotein	NA	NA	NA	NA
WP_010930778.1\|2309695_2309935_+	membrane protein	NA	NA	NA	NA
WP_010930779.1\|2310030_2310774_+	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_010930780.1\|2310806_2311307_+	N-acetyltransferase	NA	NA	NA	NA
WP_010930781.1\|2311405_2312329_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-23	33.6
WP_003810400.1\|2312325_2313087_+	ABC transporter permease	NA	NA	NA	NA
WP_010930782.1\|2313102_2314188_-	AI-2E family transporter	NA	NA	NA	NA
WP_005013747.1\|2314387_2315338_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_005013747.1\|2315436_2316387_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_19

2326627 : 2385897

Klosneuvirus(40.0%)

transposase,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010930787.1\|2326627_2327527_-\|protease	protease modulator HflC	NA	NA	NA	NA
WP_010930788.1\|2327545_2328850_-\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
WP_010930789.1\|2328815_2329922_-	GTPase HflX	NA	NA	NA	NA
WP_003810707.1\|2330009_2330246_-	RNA chaperone Hfq	NA	NA	NA	NA
WP_010930790.1\|2330384_2331455_-	histidinol-phosphate transaminase	A0A1X6WGT4	Pacmanvirus	2.5e-15	25.7
WP_003810703.1\|2331458_2332814_-	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_023852925.1\|2332840_2333998_-	outer membrane protein assembly factor BamB	NA	NA	NA	NA
WP_010930791.1\|2334003_2334642_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_033446258.1\|2334643_2335939_-\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
WP_033446257.1\|2335988_2337275_-	flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase	NA	NA	NA	NA
WP_003810693.1\|2337290_2337797_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004568542.1\|2337793_2338942_-	23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN	NA	NA	NA	NA
WP_003810689.1\|2338969_2339395_-	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	2.1e-21	43.2
WP_010930794.1\|2339717_2342600_+\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	3.7e-138	37.1
WP_023852900.1\|2342692_2343448_-	MipA/OmpV family protein	NA	NA	NA	NA
WP_010930796.1\|2344213_2345563_+	two-component sensor histidine kinase	NA	NA	NA	NA
WP_076879566.1\|2345661_2346612_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930048.1\|2346710_2347661_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930594.1\|2347734_2348208_+	RidA family protein	NA	NA	NA	NA
WP_010930593.1\|2348233_2349442_+	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
WP_003816734.1\|2349438_2350212_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_014905757.1\|2350211_2350835_-	ribosome maturation factor RimM	NA	NA	NA	NA
WP_010926757.1\|2351000_2351261_-	30S ribosomal protein S16	NA	NA	NA	NA
WP_010930591.1\|2351564_2352146_+	hypothetical protein	NA	NA	NA	NA
WP_004568544.1\|2352212_2352467_-	sulfurtransferase TusA family protein	NA	NA	NA	NA
WP_010930590.1\|2352453_2355078_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.7e-81	39.4
WP_010930589.1\|2355149_2355968_-	hypothetical protein	NA	NA	NA	NA
WP_003810661.1\|2355964_2356570_-	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_010930588.1\|2356607_2357741_-	general secretion pathway protein	NA	NA	NA	NA
WP_010930587.1\|2359456_2359831_-	hypothetical protein	NA	NA	NA	NA
WP_010930586.1\|2359928_2361203_-	type 4b pilus protein PilO2	NA	NA	NA	NA
WP_010930585.1\|2361206_2362784_-	lipoprotein	NA	NA	NA	NA
WP_010930584.1\|2363690_2365046_-	amidase	NA	NA	NA	NA
WP_010930583.1\|2365042_2366677_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.2e-18	32.7
WP_010930582.1\|2366669_2367500_-	ABC transporter permease	NA	NA	NA	NA
WP_003810637.1\|2367517_2368462_-	ABC transporter permease	NA	NA	NA	NA
WP_010930581.1\|2368514_2370089_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_033446181.1\|2370136_2370502_-	hypothetical protein	NA	NA	NA	NA
WP_019247554.1\|2370488_2370809_-	hypothetical protein	NA	NA	NA	NA
WP_019247555.1\|2370924_2371857_+	acyclic terpene utilization AtuA family protein	NA	NA	NA	NA
WP_003818676.1\|2371959_2372916_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003810623.1\|2373065_2374403_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_010930578.1\|2374407_2375664_-	D-amino acid dehydrogenase	NA	NA	NA	NA
WP_010930577.1\|2375859_2376906_-	CDP-6-deoxy-delta-3,4-glucoseen reductase	NA	NA	NA	NA
WP_003818672.1\|2376963_2377332_-	aspartate 1-decarboxylase	NA	NA	NA	NA
WP_010930576.1\|2377462_2378335_-	MOSC domain-containing protein	NA	NA	NA	NA
WP_003818670.1\|2378411_2379314_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_010930574.1\|2380370_2381588_-	four-carbon acid sugar kinase family protein	NA	NA	NA	NA
WP_010929577.1\|2382861_2383812_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930573.1\|2384012_2384822_+	enoyl-CoA hydratase	NA	NA	NA	NA
WP_005013747.1\|2384946_2385897_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_20

2437145 : 2500111

Synechococcus_phage(12.5%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010929591.1\|2437145_2438096_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_023853004.1\|2438194_2440198_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	4.4e-21	33.3
WP_010930543.1\|2440248_2441214_+	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_010930542.1\|2441203_2444065_+\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	1.0e-71	25.5
WP_010930541.1\|2444067_2444574_+	lipoprotein signal peptidase	NA	NA	NA	NA
WP_010930540.1\|2444678_2445887_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	3.8e-36	30.0
WP_033446178.1\|2445888_2446827_-	membrane protein	NA	NA	NA	NA
WP_010930538.1\|2446988_2447462_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_005012808.1\|2447458_2448409_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_004566334.1\|2448519_2448960_-	DUF937 domain-containing protein	NA	NA	NA	NA
WP_010930537.1\|2449088_2450318_-	lytic murein transglycosylase	NA	NA	NA	NA
WP_004566336.1\|2450356_2451178_-	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_029443743.1\|2451231_2452383_+	N-acetyltransferase	NA	NA	NA	NA
WP_023852690.1\|2452474_2452945_-	DUF1854 domain-containing protein	NA	NA	NA	NA
WP_019247811.1\|2455513_2458063_+	cyanophycin synthetase	NA	NA	NA	NA
WP_010930533.1\|2458133_2460707_+	cyanophycin synthetase	NA	NA	NA	NA
WP_003813568.1\|2460972_2461173_+	CsbD family protein	NA	NA	NA	NA
WP_003813570.1\|2461204_2461366_+	DUF1328 domain-containing protein	NA	NA	NA	NA
WP_003813572.1\|2461423_2461762_+	BON domain-containing protein	NA	NA	NA	NA
WP_005012067.1\|2461910_2462861_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_019247882.1\|2463635_2464304_+	arylesterase	NA	NA	NA	NA
WP_010930531.1\|2464285_2466241_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_004568486.1\|2466483_2467233_+	glycerophosphodiester phosphodiesterase	A0A2H4PGQ5	Escherichia_phage	1.5e-14	27.8
WP_003816518.1\|2467245_2468109_+	23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ	NA	NA	NA	NA
WP_003816520.1\|2468112_2469528_-	dihydrolipoyl dehydrogenase	NA	NA	NA	NA
WP_010930530.1\|2469661_2470390_-	redoxin family protein	A0A1D8KSL1	Synechococcus_phage	9.6e-43	56.8
WP_003811035.1\|2470528_2470729_-	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_003816523.1\|2470904_2471303_+	Cu(I)-responsive transcriptional regulator	NA	NA	NA	NA
WP_003816525.1\|2471326_2472727_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	7.3e-31	26.5
WP_010930529.1\|2472845_2473598_-	hypothetical protein	NA	NA	NA	NA
WP_003816527.1\|2473886_2474564_-	hypothetical protein	NA	NA	NA	NA
WP_019248494.1\|2474590_2475370_-	3'-5' exonuclease	NA	NA	NA	NA
WP_003811022.1\|2475366_2476251_-	peptidoglycan DD-metalloendopeptidase family protein	A0A292GJG6	Xanthomonas_phage	4.6e-15	49.5
WP_019247478.1\|2476268_2477048_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	4.8e-32	46.9
WP_010930526.1\|2477032_2477791_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.4e-68	51.2
WP_023852762.1\|2477928_2478564_+	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_010929632.1\|2478831_2479848_+\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_010930524.1\|2479945_2480986_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	6.1e-91	51.3
WP_003811011.1\|2481120_2482413_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	1.7e-66	36.0
WP_003811007.1\|2483772_2484156_+	thioredoxin family protein	V9SJ74	Achromobacter_phage	8.1e-09	25.8
WP_010930523.1\|2484173_2484761_-	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	4.7e-16	35.8
WP_005012067.1\|2484798_2485749_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930521.1\|2486733_2487507_-	ABC transporter permease	NA	NA	NA	NA
WP_010930520.1\|2487503_2488502_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010930519.1\|2488586_2489363_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-30	34.2
WP_010930518.1\|2489518_2491123_-	ABC-F family ATPase	A0A1V0SKJ1	Klosneuvirus	1.2e-53	28.9
WP_003816541.1\|2491503_2492628_+	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_003810992.1\|2492754_2493378_+	TRAP transporter small permease subunit	NA	NA	NA	NA
WP_010930517.1\|2493374_2495276_+	TRAP transporter large permease subunit	NA	NA	NA	NA
WP_010930516.1\|2495324_2496119_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_010930515.1\|2496131_2497133_-	muramoyltetrapeptide carboxypeptidase	NA	NA	NA	NA
WP_010930514.1\|2497129_2497579_-\|tRNA	tRNA adenosine(34) deaminase TadA	S4VYT2	Pandoravirus	2.0e-06	38.2
WP_010930513.1\|2497628_2498477_-	hydrolase	NA	NA	NA	NA
WP_019247780.1\|2498574_2499117_-	hypothetical protein	NA	NA	NA	NA
WP_005013747.1\|2499160_2500111_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_21

2507407 : 2562998

uncultured_Caudovirales_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010929588.1\|2507407_2508358_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003811452.1\|2508456_2508753_-	hypothetical protein	NA	NA	NA	NA
WP_010930508.1\|2508859_2509777_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010930507.1\|2509781_2510495_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_010930506.1\|2510508_2511480_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010930505.1\|2513229_2513580_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010930504.1\|2513583_2514771_+	MFS transporter	NA	NA	NA	NA
WP_010930503.1\|2515209_2515932_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.3e-87	68.2
WP_005013747.1\|2516225_2517176_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_019249376.1\|2517172_2517601_-	hypothetical protein	NA	NA	NA	NA
WP_003811538.1\|2519002_2519965_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010930502.1\|2520080_2521034_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010930501.1\|2521043_2522036_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010930500.1\|2522087_2522843_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_010930499.1\|2522907_2523597_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_010930498.1\|2523818_2524769_+	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_010930497.1\|2524799_2525996_+	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_019247910.1\|2525986_2526766_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_019247909.1\|2526878_2527805_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010930494.1\|2527890_2528835_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010930493.1\|2528812_2529682_-	TauD/TfdA family dioxygenase	NA	NA	NA	NA
WP_010930492.1\|2529925_2530549_+	glutathione S-transferase	NA	NA	NA	NA
WP_019247905.1\|2530863_2531163_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_023995112.1\|2531176_2534251_-	autotransporter SphB2	NA	NA	NA	NA
WP_010930489.1\|2534380_2535055_+	response regulator transcription factor	NA	NA	NA	NA
WP_019247865.1\|2535047_2536862_+	sensor histidine kinase	NA	NA	NA	NA
WP_010930487.1\|2536915_2537863_-	hypothetical protein	NA	NA	NA	NA
WP_010929591.1\|2537967_2538918_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_070797687.1\|2539470_2541096_-	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	3.3e-136	49.4
WP_010930475.1\|2541145_2542180_-	haloacid dehalogenase-like hydrolase	NA	NA	NA	NA
WP_010930476.1\|2542182_2543529_-	hypothetical protein	NA	NA	NA	NA
WP_010930477.1\|2543525_2545040_-	VWA domain-containing protein	NA	NA	NA	NA
WP_010930478.1\|2545030_2546041_-	VWA domain-containing protein	NA	NA	NA	NA
WP_010930479.1\|2546514_2547456_-	DUF58 domain-containing protein	NA	NA	NA	NA
WP_010930480.1\|2547464_2548433_-	AAA family ATPase	NA	NA	NA	NA
WP_010930481.1\|2549972_2550941_+	transporter	NA	NA	NA	NA
WP_010930482.1\|2551118_2552108_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010926609.1\|2552154_2552913_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_010930483.1\|2553102_2553840_+	TerC family protein	A0A0S4KZH7	Pseudomonas_phage	4.1e-41	46.6
WP_005012808.1\|2553938_2554889_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003816696.1\|2555073_2555856_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.0e-09	25.8
WP_003810743.1\|2555849_2556551_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_003810741.1\|2556790_2557393_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_005013747.1\|2558719_2559670_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_070797688.1\|2559666_2561223_-	LTA synthase family protein	NA	NA	NA	NA
WP_010930486.1\|2561215_2561989_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_005013747.1\|2562047_2562998_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_22

2598947 : 2665274

Ectocarpus_siliculosus_virus(11.11%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012067.1\|2598947_2599898_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930453.1\|2599917_2600823_-	pirin family protein	NA	NA	NA	NA
WP_003811176.1\|2600900_2601599_-	pirin family protein	NA	NA	NA	NA
WP_010930452.1\|2601758_2602703_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010930451.1\|2602712_2604200_-	nitrogen regulation protein NR(I)	NA	NA	NA	NA
WP_003811167.1\|2604199_2605267_-	PAS domain-containing protein	Q8QKV7	Ectocarpus_siliculosus_virus	1.1e-05	23.5
WP_003811164.1\|2605330_2606743_-	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_010930450.1\|2606928_2608149_-	oxygen-independent coproporphyrinogen III oxidase-like protein	NA	NA	NA	NA
WP_005012808.1\|2608170_2609121_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930449.1\|2609219_2609861_-	RdgB/HAM1 family non-canonical purine NTP pyrophosphatase	NA	NA	NA	NA
WP_010930448.1\|2609987_2611790_+	EAL domain-containing protein	NA	NA	NA	NA
WP_003811152.1\|2613441_2614347_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010930446.1\|2614528_2615905_+	MmgE/PrpD family protein	NA	NA	NA	NA
WP_003811149.1\|2616071_2616812_-	ribonuclease PH	NA	NA	NA	NA
WP_003811148.1\|2616948_2617875_+	YicC family protein	NA	NA	NA	NA
WP_010930445.1\|2618147_2618303_+	hypothetical protein	NA	NA	NA	NA
WP_010926696.1\|2618440_2618725_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003811138.1\|2618783_2620274_-	AMP nucleosidase	NA	NA	NA	NA
WP_003811137.1\|2620518_2621118_+	C40 family peptidase	A0A0A8WF62	Clostridium_phage	1.4e-20	41.6
WP_003811135.1\|2621122_2621893_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_010930444.1\|2622130_2622844_+	c-type cytochrome	NA	NA	NA	NA
WP_010930443.1\|2622840_2623758_+	c-type cytochrome	NA	NA	NA	NA
WP_010930442.1\|2623893_2624526_+	guanylate kinase	A0A218KC48	Bacillus_phage	2.4e-13	33.9
WP_010930441.1\|2624567_2624771_+	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_010930440.1\|2624795_2627075_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A1B1IUF0	uncultured_Mediterranean_phage	5.9e-06	32.1
WP_003811113.1\|2627087_2627816_-	glutamine ABC transporter ATP-binding protein GlnQ	G9BWD6	Planktothrix_phage	3.3e-35	39.3
WP_003811112.1\|2627812_2628472_-	glutamine ABC transporter permease GlnP	NA	NA	NA	NA
WP_010930439.1\|2628540_2629293_-	glutamine ABC transporter substrate-binding protein GlnH	NA	NA	NA	NA
WP_005012067.1\|2629474_2630425_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_033446216.1\|2631317_2632223_+	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_023994740.1\|2632240_2633362_+	outer membrane protein assembly factor BamC	NA	NA	NA	NA
WP_010930436.1\|2633450_2634065_-	serotype 3 fimbrial subunit	NA	NA	NA	NA
WP_010930435.1\|2634722_2635910_-	cupin	NA	NA	NA	NA
WP_033446228.1\|2635906_2638504_-	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	1.5e-21	22.6
WP_010930433.1\|2638758_2638974_+	dodecin domain-containing protein	NA	NA	NA	NA
WP_010930432.1\|2639429_2639984_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	1.7e-15	32.0
WP_033446227.1\|2640254_2640812_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_023853587.1\|2640923_2642228_+	imelysin	NA	NA	NA	NA
WP_019247498.1\|2642224_2643736_+	c-type cytochrome	NA	NA	NA	NA
WP_019248041.1\|2643841_2644843_+	imelysin family protein	NA	NA	NA	NA
WP_019249265.1\|2644832_2645945_+	DUF1513 domain-containing protein	NA	NA	NA	NA
WP_010929591.1\|2646043_2646994_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010928449.1\|2646990_2647617_-	threonylcarbamoyl-AMP synthase	NA	NA	NA	NA
WP_010930427.1\|2647676_2648528_+	membrane protein	A0A1I9SA48	Rhodococcus_phage	7.0e-37	35.3
WP_033446226.1\|2648694_2649231_+	hypothetical protein	NA	NA	NA	NA
WP_010930425.1\|2649227_2649992_+	hypothetical protein	NA	NA	NA	NA
WP_005013747.1\|2650061_2651012_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930424.1\|2651110_2651719_-	recombination protein RecR	NA	NA	NA	NA
WP_010930423.1\|2651769_2652096_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_023995689.1\|2652142_2654368_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	1.2e-43	38.5
WP_010930421.1\|2655034_2658439_-	UvrD-helicase domain-containing protein	NA	NA	NA	NA
WP_010930420.1\|2658451_2661112_-	hypothetical protein	NA	NA	NA	NA
WP_004568212.1\|2661133_2661280_-	hypothetical protein	NA	NA	NA	NA
WP_010930419.1\|2661315_2662518_-	MFS transporter	NA	NA	NA	NA
WP_023994932.1\|2663204_2664317_+	D-alanyl-D-alanine endopeptidase	NA	NA	NA	NA
WP_005012067.1\|2664323_2665274_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_23

2693319 : 2757275

Salmonella_phage(16.67%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012067.1\|2693319_2694270_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003812577.1\|2694368_2695139_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.3e-29	39.5
WP_010930397.1\|2695135_2695807_-	ectoine/hydroxyectoine ABC transporter permease subunit EhuD	NA	NA	NA	NA
WP_003812581.1\|2695803_2696445_-	ectoine/hydroxyectoine ABC transporter permease subunit EhuC	NA	NA	NA	NA
WP_010930396.1\|2696457_2697378_-	ectoine/hydroxyectoine ABC transporter substrate-binding protein EhuB	NA	NA	NA	NA
WP_010930395.1\|2697538_2698699_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010930394.1\|2698740_2699691_-	ornithine cyclodeaminase family protein	NA	NA	NA	NA
WP_010930393.1\|2700289_2700514_+	hypothetical protein	NA	NA	NA	NA
WP_162832303.1\|2700678_2702412_-	phosphoenolpyruvate--protein phosphotransferase	NA	NA	NA	NA
WP_003812598.1\|2702494_2702764_-	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_003812601.1\|2702879_2703278_-	PTS mannose transporter subunit IIA	NA	NA	NA	NA
WP_010930391.1\|2703288_2704245_-	glutathione synthase	NA	NA	NA	NA
WP_033446215.1\|2704381_2704927_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	9.1e-14	29.9
WP_003812608.1\|2704947_2706897_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	4.1e-125	36.0
WP_019248759.1\|2707284_2708061_+	response regulator transcription factor	NA	NA	NA	NA
WP_003812612.1\|2708066_2708459_+	hypothetical protein	NA	NA	NA	NA
WP_005013747.1\|2708880_2709831_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930389.1\|2709827_2710925_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.5e-20	37.3
WP_005012067.1\|2710956_2711907_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003814011.1\|2712005_2712788_-	3-hydroxybutyrate dehydrogenase	NA	NA	NA	NA
WP_003814012.1\|2712876_2714103_-	transporter	NA	NA	NA	NA
WP_003814013.1\|2714828_2716214_+	alcaligin siderophore biosynthesis protein AlcA	NA	NA	NA	NA
WP_003814014.1\|2716232_2716838_+	alcaligin siderophore biosynthesis protein AlcB	NA	NA	NA	NA
WP_010930939.1\|2716834_2718691_+	alcaligin siderophore biosynthesis protein AlcC	NA	NA	NA	NA
WP_003814016.1\|2718687_2719488_+	alcaligin siderophore biosynthesis protein AlcD	NA	NA	NA	NA
WP_005013753.1\|2719502_2720696_+	alcaligin siderophore biosynthesis protein AlcE	NA	NA	NA	NA
WP_003814017.1\|2720763_2721738_+	alcaligin siderophore biosynthesis transcriptional regulator AlcR	NA	NA	NA	NA
WP_010930940.1\|2721860_2723084_+	alcaligin siderophore export MFS transporter Bcr	S4TR35	Salmonella_phage	9.8e-24	29.4
WP_010930941.1\|2723194_2725399_+	TonB-dependent alcaligin siderophore receptor FauA	NA	NA	NA	NA
WP_003814020.1\|2725693_2726353_+	NAAT family transporter	NA	NA	NA	NA
WP_019247690.1\|2726360_2726567_-	hypothetical protein	NA	NA	NA	NA
WP_003814021.1\|2726905_2727661_+	GGDEF domain-containing protein	NA	NA	NA	NA
WP_003814022.1\|2727676_2727838_-	hypothetical protein	NA	NA	NA	NA
WP_003814023.1\|2727931_2728447_+	hypothetical protein	T1SAR8	Salmonella_phage	5.1e-06	44.6
WP_003814024.1\|2728719_2729037_+	virulence factor	NA	NA	NA	NA
WP_005014990.1\|2729224_2729461_-	hypothetical protein	NA	NA	NA	NA
WP_010930944.1\|2729751_2731107_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.6e-83	47.5
WP_010930945.1\|2731153_2732494_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.6e-75	38.9
WP_010930946.1\|2732595_2733228_-	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_010930947.1\|2733227_2735597_-	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	7.6e-81	48.0
WP_010930948.1\|2735629_2736589_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	3.1e-57	40.2
WP_010929073.1\|2736575_2737262_+	hypothetical protein	NA	NA	NA	NA
WP_005015014.1\|2737258_2737591_+	multidrug transporter	NA	NA	NA	NA
WP_010929577.1\|2737706_2738657_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003814040.1\|2738653_2740720_-	cation acetate symporter	NA	NA	NA	NA
WP_003814042.1\|2740719_2740992_-	DUF4212 domain-containing protein	NA	NA	NA	NA
WP_017685545.1\|2741686_2741776_+	K(+)-transporting ATPase subunit F	NA	NA	NA	NA
WP_010930949.1\|2741775_2743560_+	potassium-transporting ATPase subunit KdpA	NA	NA	NA	NA
WP_010930950.1\|2743583_2745749_+	potassium-transporting ATPase subunit KdpB	M1HBF8	Paramecium_bursaria_Chlorella_virus	1.2e-24	27.1
WP_003814050.1\|2745759_2746359_+	potassium-transporting ATPase subunit KdpC	NA	NA	NA	NA
WP_003814052.1\|2749180_2749876_+	two-component system response regulator KdpE	NA	NA	NA	NA
WP_005013747.1\|2749884_2750835_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_005015028.1\|2750933_2752175_-	O-antigen ligase family protein	NA	NA	NA	NA
WP_003814057.1\|2752324_2753305_-	hypothetical protein	NA	NA	NA	NA
WP_003814059.1\|2753503_2754760_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	1.2e-11	64.8
WP_003814061.1\|2754962_2755388_+	DUF1841 family protein	NA	NA	NA	NA
WP_003814063.1\|2755429_2755792_-	cytochrome c	NA	NA	NA	NA
WP_003814065.1\|2755804_2756158_-	cytochrome c	NA	NA	NA	NA
WP_162497923.1\|2756154_2756307_-	hypothetical protein	NA	NA	NA	NA
WP_005013747.1\|2756324_2757275_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_24

2836952 : 2877620

Salmonella_phage(33.33%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010929591.1\|2836952_2837903_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_004567479.1\|2838013_2838196_+	hypothetical protein	NA	NA	NA	NA
WP_010931004.1\|2838295_2838892_-	lipoprotein	NA	NA	NA	NA
WP_010931005.1\|2839075_2840167_+	hypothetical protein	NA	NA	NA	NA
WP_003812822.1\|2840666_2841077_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_023852697.1\|2841135_2841465_-	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	2.7e-13	42.2
WP_010931007.1\|2841482_2843900_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_010926359.1\|2843912_2844935_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	1.0e-26	38.6
WP_003812832.1\|2845009_2845369_-	50S ribosomal protein L20	NA	NA	NA	NA
WP_003812834.1\|2845384_2845582_-	50S ribosomal protein L35	NA	NA	NA	NA
WP_010929584.1\|2845917_2846868_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_003816756.1\|2847062_2847512_+	dUTP diphosphatase	S4TNT3	Salmonella_phage	3.7e-45	67.2
WP_010929584.1\|2847508_2848459_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_010931008.1\|2848569_2850018_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_023853496.1\|2850132_2850378_-	hypothetical protein	NA	NA	NA	NA
WP_005013747.1\|2850517_2851468_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003820420.1\|2851712_2852426_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_019247724.1\|2852548_2852776_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003816758.1\|2853070_2853709_-	DedA family protein	NA	NA	NA	NA
WP_010931011.1\|2853817_2854852_+	metal-dependent hydrolase	NA	NA	NA	NA
WP_010929591.1\|2854848_2855799_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931012.1\|2856214_2856739_-	DNA-binding protein	J9Q7G7	Salmonella_phage	6.5e-09	32.9
WP_004567322.1\|2856742_2857012_-	hypothetical protein	NA	NA	NA	NA
WP_010931013.1\|2857210_2858272_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_010931014.1\|2858355_2859990_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.9e-15	31.1
WP_010931015.1\|2859991_2860795_-	ABC transporter permease	NA	NA	NA	NA
WP_010931016.1\|2860823_2861783_-	ABC transporter permease	NA	NA	NA	NA
WP_010931017.1\|2861786_2863301_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_019248147.1\|2863337_2864342_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_033456131.1\|2864349_2864583_-	hypothetical protein	NA	NA	NA	NA
WP_010931018.1\|2864772_2865243_-	DUF1801 domain-containing protein	NA	NA	NA	NA
WP_010931019.1\|2865278_2865890_-	LysE family translocator	NA	NA	NA	NA
WP_010931020.1\|2865920_2866544_-	FMN-binding negative transcriptional regulator	NA	NA	NA	NA
WP_010931021.1\|2866624_2868157_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_023853282.1\|2868191_2869409_-	MFS transporter	NA	NA	NA	NA
WP_010931023.1\|2869476_2870508_-	alcohol dehydrogenase catalytic domain-containing protein	A0A2K9L339	Tupanvirus	1.8e-26	27.8
WP_010931024.1\|2870504_2871674_-	NAD(P)-binding protein	NA	NA	NA	NA
WP_010931025.1\|2871667_2872348_-	hypothetical protein	NA	NA	NA	NA
WP_010931026.1\|2872509_2873352_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010931027.1\|2873514_2874486_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010931028.1\|2874657_2875536_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_010931029.1\|2875558_2876629_-	FUSC family protein	NA	NA	NA	NA
WP_005013747.1\|2876669_2877620_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_25

2933085 : 3005956

Moraxella_phage(14.29%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003810909.1\|2933085_2933502_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_010931061.1\|2933612_2934245_+	7-carboxy-7-deazaguanine synthase	NA	NA	NA	NA
WP_010931062.1\|2934273_2934717_+	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_003810897.1\|2934738_2935830_-	TRAP transporter substrate-binding protein DctP	NA	NA	NA	NA
WP_162832304.1\|2935884_2936676_-	aldolase	NA	NA	NA	NA
WP_010931064.1\|2936820_2937441_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_010931065.1\|2937580_2938054_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_005012067.1\|2939193_2940144_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931066.1\|2940140_2947802_-	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	7.3e-24	30.9
WP_010931067.1\|2948042_2952089_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	6.3e-160	67.4
WP_023853219.1\|2952446_2952983_+	TRAP transporter small permease	NA	NA	NA	NA
WP_010931068.1\|2952979_2954278_+	TRAP transporter large permease	NA	NA	NA	NA
WP_010931069.1\|2954357_2955386_+	DctP family TRAP transporter solute-binding subunit	NA	NA	NA	NA
WP_005013747.1\|2955646_2956597_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010927663.1\|2956593_2957544_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_010931071.1\|2957861_2958467_+	fimbrial protein	NA	NA	NA	NA
WP_010931072.1\|2958520_2959834_-	phenylacetate--CoA ligase	NA	NA	NA	NA
WP_003813284.1\|2959908_2960379_-	hydroxyphenylacetyl-CoA thioesterase PaaI	NA	NA	NA	NA
WP_010931073.1\|2960378_2961167_-	2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase	NA	NA	NA	NA
WP_010931074.1\|2961177_2962830_-	phenylacetic acid degradation protein PaaN	NA	NA	NA	NA
WP_010929591.1\|2962917_2963868_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_023853125.1\|2963854_2965018_-	phenylacetate-CoA oxygenase/reductase subunit PaaK	V5UTY8	Synechococcus_phage	5.9e-10	46.7
WP_010931075.1\|2965029_2965536_-	phenylacetate-CoA oxygenase subunit PaaJ	NA	NA	NA	NA
WP_003813293.1\|2965532_2966297_-	phenylacetate-CoA oxygenase subunit PaaC	NA	NA	NA	NA
WP_010931076.1\|2966312_2966597_-	1,2-phenylacetyl-CoA epoxidase subunit B	NA	NA	NA	NA
WP_003813298.1\|2966661_2967651_-	1,2-phenylacetyl-CoA epoxidase subunit A	NA	NA	NA	NA
WP_010931077.1\|2967822_2968752_+	phenylacetic acid degradation operon negative regulatory protein PaaX	NA	NA	NA	NA
WP_003813302.1\|2968723_2969410_-	NAD(P)H-hydrate epimerase	NA	NA	NA	NA
WP_003813303.1\|2969443_2969989_-	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	2.1e-26	37.7
WP_003813306.1\|2970033_2971299_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_003813309.1\|2971295_2972198_+	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
WP_019247679.1\|2973379_2974324_-	ABC transporter permease	NA	NA	NA	NA
WP_010931079.1\|2974418_2975936_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010931080.1\|2975977_2977606_-	gamma-glutamyltransferase	NA	NA	NA	NA
WP_003811986.1\|2977713_2978595_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010931081.1\|2981707_2982082_+	endonuclease	F4YXR7	Roseobacter_phage	2.1e-25	54.4
WP_003812004.1\|2982106_2982445_-	P-II family nitrogen regulator	NA	NA	NA	NA
WP_010931082.1\|2982488_2984123_-	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	8.3e-87	36.6
WP_010931083.1\|2984161_2985508_-	mechanosensitive ion channel	NA	NA	NA	NA
WP_003812010.1\|2985615_2987037_+	argininosuccinate lyase	NA	NA	NA	NA
WP_010931084.1\|2987106_2987691_-	nitroreductase	NA	NA	NA	NA
WP_005012067.1\|2987793_2988744_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931085.1\|2988878_2989985_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010931086.1\|2989995_2991093_+	GTP 3',8-cyclase MoaA	NA	NA	NA	NA
WP_010931087.1\|2991237_2992443_-	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_010931088.1\|2992449_2992971_-	molybdenum cofactor biosynthesis protein B	NA	NA	NA	NA
WP_023853551.1\|2992967_2993450_-	molybdenum cofactor biosynthesis protein MoaE	NA	NA	NA	NA
WP_003819740.1\|2993455_2993707_-	MoaD/ThiS family protein	NA	NA	NA	NA
WP_003819741.1\|2993687_2994173_-	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
WP_010931090.1\|2994308_2997770_+	DUF748 domain-containing protein	NA	NA	NA	NA
WP_010931091.1\|2997787_2998672_+	dienelactone hydrolase family protein	NA	NA	NA	NA
WP_010931092.1\|2998681_2999113_-	lipoprotein	NA	NA	NA	NA
WP_003809348.1\|2999359_2999863_+	peroxiredoxin	M1I839	Pelagibacter_phage	1.8e-24	44.1
WP_010931094.1\|2999940_3001341_+	MFS transporter	NA	NA	NA	NA
WP_010931095.1\|3001415_3002291_-	membrane protein	NA	NA	NA	NA
WP_023853546.1\|3002287_3003295_-	biotin synthase BioB	NA	NA	NA	NA
WP_010931097.1\|3003762_3004068_+	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_003819753.1\|3004158_3004749_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_010930525.1\|3004939_3005956_-\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA

DBSCAN-SWA_26

3009099 : 3075909

uncultured_Mediterranean_phage(28.57%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010929956.1\|3009099_3010050_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_005013747.1\|3010148_3011099_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931099.1\|3011095_3011890_-	N-formylglutamate deformylase	NA	NA	NA	NA
WP_010931100.1\|3011921_3012626_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_010931101.1\|3012700_3013501_-	SURF1 family protein	NA	NA	NA	NA
WP_003809276.1\|3013497_3013905_-	cytochrome o ubiquinol oxidase subunit IV	NA	NA	NA	NA
WP_003819722.1\|3013901_3014543_-	cytochrome o ubiquinol oxidase subunit III	NA	NA	NA	NA
WP_010931102.1\|3014535_3016536_-	cytochrome o ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_010931103.1\|3017796_3019128_+	MFS transporter	NA	NA	NA	NA
WP_005012067.1\|3019124_3020075_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931105.1\|3021781_3022048_-	accessory factor UbiK family protein	NA	NA	NA	NA
WP_003812839.1\|3022755_3023094_+	P-II family nitrogen regulator	NA	NA	NA	NA
WP_010931107.1\|3027646_3028249_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_010931108.1\|3028345_3029635_+	MFS transporter	NA	NA	NA	NA
WP_003812846.1\|3029692_3030424_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-12	31.0
WP_010931109.1\|3030420_3031224_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.9e-14	23.5
WP_003812851.1\|3031220_3032309_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_003820410.1\|3032305_3033235_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_003812857.1\|3033383_3034529_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010930800.1\|3034550_3035501_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_154698391.1\|3035518_3035677_+	hypothetical protein	NA	NA	NA	NA
WP_010931110.1\|3035831_3039653_-	trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_010931111.1\|3039809_3040478_-	membrane integrity-associated transporter subunit PqiC	NA	NA	NA	NA
WP_014905522.1\|3040482_3042156_-	MCE family protein	NA	NA	NA	NA
WP_003820402.1\|3042174_3043494_-	PqiA/YebS family transporter subunit	NA	NA	NA	NA
WP_010931114.1\|3043498_3045814_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	4.1e-164	41.9
WP_010931115.1\|3045869_3048038_-	penicillin-binding protein 1C	NA	NA	NA	NA
WP_023853340.1\|3048034_3053215_-	alpha-2-macroglobulin family protein	NA	NA	NA	NA
WP_003820400.1\|3053313_3053628_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	1.2e-10	43.8
WP_003812875.1\|3053855_3054101_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-20	76.6
WP_003820399.1\|3054195_3054714_+	hypothetical protein	A0A1B1IUW8	uncultured_Mediterranean_phage	5.1e-14	42.2
WP_010931117.1\|3054813_3056019_-	3-oxoadipyl-CoA thiolase	NA	NA	NA	NA
WP_019247560.1\|3056134_3057532_-	chloride channel protein	NA	NA	NA	NA
WP_010931119.1\|3057648_3058227_-	superoxide dismutase [Fe]	NA	NA	NA	NA
WP_010931120.1\|3058299_3059691_-	exodeoxyribonuclease VII large subunit	A0A1V0SD82	Indivirus	1.4e-29	32.0
WP_005012067.1\|3059858_3060809_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003812889.1\|3061089_3061710_+	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
WP_010931122.1\|3061706_3062120_+	biopolymer transporter ExbD	NA	NA	NA	NA
WP_010931123.1\|3062116_3063160_+	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
WP_003812895.1\|3063215_3063404_+	Trm112 family protein	NA	NA	NA	NA
WP_010931124.1\|3063413_3064178_+	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
WP_010931125.1\|3064268_3064925_+	adenylate kinase	NA	NA	NA	NA
WP_010931126.1\|3065016_3065775_+	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
WP_010931127.1\|3065800_3067402_+	murein biosynthesis integral membrane protein MurJ	NA	NA	NA	NA
WP_010931128.1\|3067602_3068607_+	DUF4880 domain-containing protein	NA	NA	NA	NA
WP_003812908.1\|3068707_3068971_+	30S ribosomal protein S20	NA	NA	NA	NA
WP_023853341.1\|3069088_3069856_-	2-dehydro-3-deoxyglucarate aldolase	NA	NA	NA	NA
WP_005012067.1\|3070455_3071406_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_151243721.1\|3073789_3074887_-	Ldh family oxidoreductase	NA	NA	NA	NA
WP_010929584.1\|3074958_3075909_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_27

3106295 : 3145484

Planktothrix_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012067.1\|3106295_3107246_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_162268686.1\|3107263_3107413_+	hypothetical protein	NA	NA	NA	NA
WP_023852715.1\|3107366_3108263_-	inositol monophosphatase	NA	NA	NA	NA
WP_003814547.1\|3110540_3112766_+	glycoside hydrolase family 31 protein	NA	NA	NA	NA
WP_003814544.1\|3112930_3114019_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	8.7e-32	36.4
WP_019247918.1\|3113975_3114629_+	ABC transporter permease	NA	NA	NA	NA
WP_010931144.1\|3114676_3115474_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010930176.1\|3116005_3116956_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_023994659.1\|3117036_3118185_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_005012067.1\|3118241_3119192_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003814535.1\|3119290_3119596_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_003820797.1\|3119624_3120059_-	DUF126 domain-containing protein	NA	NA	NA	NA
WP_010931147.1\|3120060_3121305_-	DUF521 domain-containing protein	NA	NA	NA	NA
WP_003820799.1\|3121301_3122012_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_033446288.1\|3122026_3122938_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010931149.1\|3123300_3123705_+	hypothetical protein	NA	NA	NA	NA
WP_019247890.1\|3123701_3124160_+	hypothetical protein	NA	NA	NA	NA
WP_019247891.1\|3124166_3125075_+	hypothetical protein	NA	NA	NA	NA
WP_010931150.1\|3125071_3125938_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_003814524.1\|3125924_3126752_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_003820806.1\|3126762_3127890_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-23	32.3
WP_023852748.1\|3128967_3130206_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_010931152.1\|3130247_3131510_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_010931153.1\|3131516_3132269_+	DNA-binding protein	NA	NA	NA	NA
WP_019248355.1\|3132320_3132506_-	hypothetical protein	NA	NA	NA	NA
WP_003820813.1\|3132781_3133246_+	redox-sensitive transcriptional activator SoxR	NA	NA	NA	NA
WP_023996698.1\|3133325_3133937_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_010931154.1\|3134081_3136190_+	AsmA family protein	NA	NA	NA	NA
WP_023852714.1\|3136186_3137137_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_010931155.1\|3137240_3137861_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003820818.1\|3137964_3138705_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_019248356.1\|3139839_3140964_-	hypothetical protein	NA	NA	NA	NA
WP_019247402.1\|3141009_3141378_-	hypothetical protein	NA	NA	NA	NA
WP_005012067.1\|3141619_3142570_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_019247492.1\|3143605_3144148_-	hypothetical protein	NA	NA	NA	NA
WP_023998107.1\|3144345_3144516_-	hypothetical protein	NA	NA	NA	NA
WP_010930176.1\|3144533_3145484_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_28

3334434 : 3407422

Xanthomonas_phage(14.29%)

holin,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012067.1\|3334434_3335385_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931248.1\|3335393_3335942_+	lipid IV(A) palmitoyltransferase PagP	NA	NA	NA	NA
WP_003814557.1\|3335938_3336547_-	gamma-glutamylcyclotransferase	NA	NA	NA	NA
WP_023852720.1\|3336729_3337188_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_010931250.1\|3337206_3338466_-	D-amino acid dehydrogenase	NA	NA	NA	NA
WP_010931251.1\|3338518_3339331_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_003814561.1\|3339445_3340000_+	cysteine dioxygenase	NA	NA	NA	NA
WP_023998380.1\|3340009_3340999_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_003814563.1\|3341178_3341898_-	VOC family protein	NA	NA	NA	NA
WP_003814564.1\|3341914_3344650_-	preprotein translocase subunit SecA	NA	NA	NA	NA
WP_003814565.1\|3344829_3345816_-	M23 family metallopeptidase	A0A292GJG6	Xanthomonas_phage	3.4e-27	51.8
WP_010931255.1\|3345944_3346352_+	flagellar hook-length control protein FliK	NA	NA	NA	NA
WP_003814567.1\|3346463_3347387_-	UDP-3-O-acyl-N-acetylglucosamine deacetylase	NA	NA	NA	NA
WP_003814568.1\|3347615_3348800_-	cell division protein FtsZ	NA	NA	NA	NA
WP_003814569.1\|3348988_3350215_-	cell division protein FtsA	NA	NA	NA	NA
WP_003814570.1\|3350219_3351041_-	cell division protein FtsQ/DivIB	NA	NA	NA	NA
WP_003814571.1\|3351053_3352004_-	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_010931256.1\|3352000_3353407_-	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
WP_010931257.1\|3353403_3354477_-	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_010931258.1\|3354473_3355667_-	putative lipid II flippase FtsW	NA	NA	NA	NA
WP_010931259.1\|3355663_3357196_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_019247664.1\|3357192_3358362_-	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
WP_010931260.1\|3358351_3361189_-	bifunctional UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase MurE/UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase MurF	NA	NA	NA	NA
WP_010931261.1\|3361185_3362916_-	penicillin-binding protein 2	NA	NA	NA	NA
WP_010931262.1\|3362912_3363191_-	cell division protein FtsL	NA	NA	NA	NA
WP_003814582.1\|3363190_3364285_-	16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH	NA	NA	NA	NA
WP_010931263.1\|3364293_3364722_-	division/cell wall cluster transcriptional repressor MraZ	NA	NA	NA	NA
WP_010931264.1\|3365524_3367333_+	ATP-binding cassette domain-containing protein	A0A1B0RXA0	Streptococcus_phage	1.6e-43	28.6
WP_010931265.1\|3367372_3368452_-	dihydroorotase	NA	NA	NA	NA
WP_003820761.1\|3368448_3369642_-	amidohydrolase	NA	NA	NA	NA
WP_003814592.1\|3369791_3370070_+	hypothetical protein	NA	NA	NA	NA
WP_023995307.1\|3370399_3370765_-	hypothetical protein	NA	NA	NA	NA
WP_003820758.1\|3377516_3377993_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_010931267.1\|3378145_3379258_+	4-hydroxyphenylpyruvate dioxygenase	NA	NA	NA	NA
WP_010931268.1\|3379325_3379886_-	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_010929235.1\|3379909_3380242_-	c-type cytochrome	NA	NA	NA	NA
WP_010931269.1\|3380225_3381914_-	dihydroxy-acid dehydratase	NA	NA	NA	NA
WP_003820749.1\|3382033_3382822_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_005012808.1\|3383529_3384480_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003814611.1\|3384924_3385236_-	cell division protein ZapA	NA	NA	NA	NA
WP_003820745.1\|3385235_3385766_-	hypothetical protein	NA	NA	NA	NA
WP_162268687.1\|3385722_3385911_-	hypothetical protein	NA	NA	NA	NA
WP_005012067.1\|3385928_3386879_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003820744.1\|3387168_3387633_+	tripartite tricarboxylate transporter TctB family protein	NA	NA	NA	NA
WP_010931270.1\|3387647_3389153_+	tripartite tricarboxylate transporter permease	NA	NA	NA	NA
WP_010931271.1\|3389406_3391014_+	gamma-glutamyltransferase family protein	NA	NA	NA	NA
WP_003814620.1\|3391069_3391975_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_005013747.1\|3392415_3393366_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003818450.1\|3393504_3394257_+	uracil-DNA glycosylase	A0A1Y0B680	Bovine_alphaherpesvirus	2.5e-46	47.5
WP_023853440.1\|3394531_3396220_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.6e-48	32.9
WP_023995245.1\|3396308_3397499_+	hypothetical protein	NA	NA	NA	NA
WP_010931274.1\|3397513_3398608_-\|tRNA	CCA tRNA nucleotidyltransferase	A0A0F6YPT7	Sinorhizobium_phage	2.4e-50	50.5
WP_010931275.1\|3398604_3400668_-	lytic transglycosylase domain-containing protein	A0A0S2SXL7	Bacillus_phage	5.3e-14	36.6
WP_010931276.1\|3400743_3401424_+	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_003807204.1\|3401701_3403075_+	MHS family MFS transporter	NA	NA	NA	NA
WP_003818444.1\|3403076_3404096_+	histone deacetylase family protein	A0A2K9L473	Tupanvirus	3.4e-22	31.7
WP_003818443.1\|3404159_3405131_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010931070.1\|3405195_3406146_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_003807199.1\|3406244_3407087_-	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
WP_010931277.1\|3407086_3407422_-\|holin	phage holin family protein	NA	NA	NA	NA

DBSCAN-SWA_29

3425845 : 3479253

Erwinia_phage(25.0%)

transposase,protease,integrase

attL 3464919:3464937|attR 3484807:3484825

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010931291.1\|3425845_3426385_+\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_003807162.1\|3426406_3427741_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A191ZC11	Erwinia_phage	3.5e-43	29.6
WP_003807161.1\|3427754_3428060_-	copper-binding protein	NA	NA	NA	NA
WP_023853416.1\|3428484_3429066_+	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_005012808.1\|3429147_3430098_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_005012808.1\|3430196_3431147_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_029443788.1\|3431459_3432938_+	phospholipase D family protein	NA	NA	NA	NA
WP_010931293.1\|3432944_3434054_-	molybdenum ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.5e-23	34.5
WP_003808339.1\|3434065_3434746_-	molybdate ABC transporter permease subunit	NA	NA	NA	NA
WP_003808340.1\|3434767_3435523_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010925959.1\|3435658_3436543_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_010931294.1\|3436630_3437212_+	CGNR zinc finger domain-containing protein	NA	NA	NA	NA
WP_004566249.1\|3437472_3437772_-	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_010931296.1\|3437923_3438403_-	membrane protein	NA	NA	NA	NA
WP_023853362.1\|3439122_3440559_-	TonB-dependent receptor	NA	NA	NA	NA
WP_010931297.1\|3440555_3440984_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_005012067.1\|3441074_3442025_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003814148.1\|3442552_3443326_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003814146.1\|3443458_3444469_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010931298.1\|3444620_3446276_-	gamma-glutamyltransferase family protein	NA	NA	NA	NA
WP_003814142.1\|3446330_3446672_-	cupin domain-containing protein	NA	NA	NA	NA
WP_010931299.1\|3446685_3448125_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003814139.1\|3448257_3449073_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_023994811.1\|3449036_3449249_-	hypothetical protein	NA	NA	NA	NA
WP_010929591.1\|3449266_3450217_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_019247274.1\|3451610_3452552_+	hypothetical protein	NA	NA	NA	NA
WP_014905961.1\|3452778_3453519_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_005012067.1\|3453604_3454555_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_162291319.1\|3454572_3454728_+	hypothetical protein	NA	NA	NA	NA
WP_014905963.1\|3455996_3457568_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_019247178.1\|3459797_3462362_+	autotransporter domain-containing protein	NA	NA	NA	NA
WP_005012067.1\|3462780_3463731_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_005012067.1\|3463829_3464780_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
3464919:3464937	attL	NA	NA	NA	NA
WP_077274087.1\|3467645_3468140_-	DUF4276 family protein	NA	NA	NA	NA
WP_005013747.1\|3468156_3469107_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_076879586.1\|3469093_3469294_-	hypothetical protein	NA	NA	NA	NA
WP_010931301.1\|3469290_3470502_-	AAA family ATPase	NA	NA	NA	NA
WP_010931302.1\|3470517_3473469_-	restriction endonuclease subunit M	G8I4P9	Mycobacterium_phage	2.9e-21	25.1
WP_019247951.1\|3473470_3476227_-	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_010931304.1\|3476737_3477784_-	Fic family protein	NA	NA	NA	NA
WP_010931305.1\|3478125_3479253_-\|integrase	site-specific integrase	A0A1B0VMI6	Pseudomonas_phage	1.4e-48	33.6
3484807:3484825	attR	NA	NA	NA	NA

DBSCAN-SWA_30

3531010 : 3651254

101

Acinetobacter_phage(20.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023995489.1\|3531010_3531961_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_010931336.1\|3532365_3533010_-	urease accessory protein UreG	NA	NA	NA	NA
WP_019247677.1\|3533034_3533619_-	urease accessory protein UreF	NA	NA	NA	NA
WP_014905506.1\|3533719_3534337_-	urease accessory protein UreE	NA	NA	NA	NA
WP_010931337.1\|3534339_3536055_-	urease subunit alpha	NA	NA	NA	NA
WP_010931338.1\|3536051_3536360_-	urease subunit beta	NA	NA	NA	NA
WP_003814828.1\|3536376_3536994_-	HupE/UreJ family protein	NA	NA	NA	NA
WP_010931340.1\|3537038_3537341_-	urease subunit gamma	NA	NA	NA	NA
WP_003814832.1\|3537441_3538296_-	urease accessory protein UreD	NA	NA	NA	NA
WP_124740609.1\|3538483_3538708_-	hypothetical protein	NA	NA	NA	NA
WP_010929281.1\|3538877_3539150_+	MerR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_010929282.1\|3539567_3539975_-	GFA family protein	NA	NA	NA	NA
WP_010931341.1\|3540344_3541139_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_010927102.1\|3541239_3542475_+	methylaspartate ammonia-lyase	NA	NA	NA	NA
WP_003814852.1\|3542543_3543560_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010931342.1\|3543571_3544948_+	MmgE/PrpD family protein	NA	NA	NA	NA
WP_003814856.1\|3544944_3546141_+	MFS transporter	NA	NA	NA	NA
WP_003814858.1\|3546137_3547676_-	SpoVR family protein	NA	NA	NA	NA
WP_010931343.1\|3547672_3548932_-	YeaH/YhbH family protein	NA	NA	NA	NA
WP_005012067.1\|3550872_3551823_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931344.1\|3552589_3553684_-	CoA transferase	NA	NA	NA	NA
WP_019247312.1\|3553676_3555011_-	AMP-binding protein	NA	NA	NA	NA
WP_003808193.1\|3554964_3555648_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003808195.1\|3555673_3556837_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_004566224.1\|3556833_3557835_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_010931346.1\|3557834_3558707_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_010931347.1\|3558703_3559453_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.9e-09	27.8
WP_010931348.1\|3559449_3560241_-	ATP-binding cassette domain-containing protein	A0A1M7XV31	Cedratvirus	1.7e-08	29.4
WP_010931349.1\|3560237_3561377_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_047122778.1\|3561652_3562438_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_014486103.1\|3562471_3563254_+	crotonase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_010931351.1\|3563257_3563647_+	hypothetical protein	NA	NA	NA	NA
WP_010931352.1\|3564786_3565650_+	3-alpha,7-alpha, 12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase	NA	NA	NA	NA
WP_010931353.1\|3565685_3566774_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_005013747.1\|3566770_3567721_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_019247959.1\|3568074_3571053_+	hypothetical protein	NA	NA	NA	NA
WP_003818344.1\|3571979_3572858_+	fatty acid desaturase	NA	NA	NA	NA
WP_005013747.1\|3573924_3574875_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_005013747.1\|3575855_3576806_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931354.1\|3576802_3577270_-	ribonuclease HI	J9Q745	Salmonella_phage	5.6e-36	50.7
WP_010931355.1\|3577312_3578083_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_010927090.1\|3578103_3578904_+	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_010931356.1\|3578914_3580324_+	transglycosylase SLT domain-containing protein	NA	NA	NA	NA
WP_003814739.1\|3580418_3581204_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_023994644.1\|3581443_3582460_+\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_003814742.1\|3582567_3582960_-	OsmC family protein	NA	NA	NA	NA
WP_010931357.1\|3583097_3583778_+	tellurite resistance TerB family protein	NA	NA	NA	NA
WP_023994844.1\|3583782_3584754_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010930179.1\|3584849_3585800_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003814239.1\|3587304_3588006_+	response regulator	W8CYM9	Bacillus_phage	5.6e-32	36.6
WP_010927010.1\|3588005_3589430_+	HAMP domain-containing protein	NA	NA	NA	NA
WP_010931360.1\|3589446_3590502_-	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_010931361.1\|3590498_3591839_-	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_003820957.1\|3591954_3593718_+\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	5.0e-162	50.0
WP_010931362.1\|3593829_3594708_+	septum site-determining protein MinC	NA	NA	NA	NA
WP_003814250.1\|3594820_3595636_+	septum site-determining protein MinD	NA	NA	NA	NA
WP_003814252.1\|3595639_3595891_+	cell division topological specificity factor MinE	NA	NA	NA	NA
WP_010929632.1\|3595975_3596992_-\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_003814254.1\|3597322_3597544_-	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_010931364.1\|3599904_3600771_-	DMT family transporter	NA	NA	NA	NA
WP_019247692.1\|3601319_3602528_-	ABC transporter permease	NA	NA	NA	NA
WP_010931365.1\|3602607_3604179_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003814275.1\|3604296_3605232_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_003814277.1\|3605420_3606365_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	8.4e-07	23.2
WP_003814283.1\|3606932_3612650_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.0e-195	39.5
WP_010931367.1\|3612655_3613783_+	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	3.8e-38	37.8
WP_003814287.1\|3613838_3614465_+	hypothetical protein	NA	NA	NA	NA
WP_010931363.1\|3614736_3615753_+\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_010927020.1\|3615848_3616559_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_010931368.1\|3616555_3617545_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010931369.1\|3617640_3619272_+	AMP-binding protein	NA	NA	NA	NA
WP_010931370.1\|3619274_3620012_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_019247745.1\|3620167_3621040_-\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	NA	NA	NA	NA
WP_023852703.1\|3621389_3622529_+	MFS transporter	NA	NA	NA	NA
WP_003814300.1\|3622525_3623185_+	gamma-glutamylcyclotransferase	NA	NA	NA	NA
WP_003814302.1\|3623256_3623889_+	pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
WP_010931372.1\|3623918_3624437_+	flavin reductase family protein	NA	NA	NA	NA
WP_010931373.1\|3624447_3625557_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003814312.1\|3625603_3626458_+	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_010931374.1\|3626459_3627362_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_005012067.1\|3628584_3629535_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905441.1\|3631291_3632281_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_019247413.1\|3632277_3632436_+	hypothetical protein	NA	NA	NA	NA
WP_010931375.1\|3632456_3633245_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	5.1e-66	53.0
WP_003817833.1\|3633241_3634273_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	7.4e-73	42.7
WP_003815390.1\|3634291_3634855_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.1e-65	62.1
WP_010931376.1\|3634910_3636431_-	anthranilate synthase component I	S4VT78	Pandoravirus	9.0e-43	32.1
WP_010931377.1\|3636694_3637399_-	phosphoglycolate phosphatase	NA	NA	NA	NA
WP_023852620.1\|3637406_3638135_-	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_003815381.1\|3638249_3638624_+	Co2+/Mg2+ efflux protein ApaG	NA	NA	NA	NA
WP_003815379.1\|3638666_3639956_+	murein transglycosylase A	NA	NA	NA	NA
WP_010931378.1\|3639952_3641122_+	UbiH/UbiF family hydroxylase	NA	NA	NA	NA
WP_010931379.1\|3641118_3641958_+	thiol:disulfide interchange protein DsbC	NA	NA	NA	NA
WP_010931380.1\|3642017_3642953_+	D-2-hydroxyacid dehydrogenase family protein	A0A1J0F959	Only_Syngen_Nebraska_virus	6.4e-15	27.7
WP_005012067.1\|3642965_3643916_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931381.1\|3644014_3644977_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	4.6e-93	64.5
WP_003817821.1\|3645008_3645368_-	dihydroneopterin aldolase	NA	NA	NA	NA
WP_010931382.1\|3645492_3646395_+	NAD(P)/FAD-dependent oxidoreductase	G3MA85	Bacillus_virus	1.9e-08	24.0
WP_010931383.1\|3646396_3648169_-	M61 family metallopeptidase	NA	NA	NA	NA
WP_003815367.1\|3648203_3648980_+	enoyl-CoA hydratase	NA	NA	NA	NA
WP_080485501.1\|3650303_3651254_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_31

3666192 : 3724264

Planktothrix_phage(12.5%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010929584.1\|3666192_3667143_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_010931392.1\|3667271_3668405_-	M20 family metallopeptidase	NA	NA	NA	NA
WP_010931393.1\|3668448_3669354_-	hydrolase	NA	NA	NA	NA
WP_023852622.1\|3669356_3671057_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-15	32.7
WP_010931394.1\|3671053_3671974_-	ABC transporter permease	NA	NA	NA	NA
WP_003817805.1\|3671981_3672959_-	ABC transporter permease	NA	NA	NA	NA
WP_023852626.1\|3673017_3673977_-	succinylglutamate desuccinylase/aspartoacylase	NA	NA	NA	NA
WP_003815317.1\|3676026_3676263_-	hypothetical protein	NA	NA	NA	NA
WP_010931396.1\|3676389_3677253_-	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
WP_003815315.1\|3677341_3678163_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_003815313.1\|3678242_3678980_-	enoyl-CoA hydratase	NA	NA	NA	NA
WP_010931397.1\|3678976_3679969_-	nitronate monooxygenase	NA	NA	NA	NA
WP_010931398.1\|3680121_3680745_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_010931399.1\|3680789_3681938_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_010931400.1\|3684261_3685212_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_014486105.1\|3685552_3686503_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_005013747.1\|3686601_3687552_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_029443756.1\|3687848_3688346_+	cupredoxin family protein	NA	NA	NA	NA
WP_010931403.1\|3688388_3690164_+	copper resistance system multicopper oxidase	NA	NA	NA	NA
WP_010931404.1\|3690171_3691038_+	copper resistance protein B	NA	NA	NA	NA
WP_010931405.1\|3691044_3691770_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_003815296.1\|3694031_3694622_+	cysteine dioxygenase	NA	NA	NA	NA
WP_010931407.1\|3694655_3695984_-	amidase	NA	NA	NA	NA
WP_010931408.1\|3696058_3697204_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_014905478.1\|3697315_3698314_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_033446233.1\|3698276_3698711_+	carbon monoxide dehydrogenase	NA	NA	NA	NA
WP_010929974.1\|3700227_3701112_+	DMT family transporter	NA	NA	NA	NA
WP_010929973.1\|3701108_3702314_-	cardiolipin synthase ClsB	NA	NA	NA	NA
WP_010929972.1\|3702310_3703171_-	endonuclease	NA	NA	NA	NA
WP_003807038.1\|3703283_3705074_-\|tRNA	aspartate--tRNA ligase	A0A1V0SAC0	Catovirus	6.5e-08	25.5
WP_023852857.1\|3705114_3705765_-	DUF502 domain-containing protein	A0A2I7S9X1	Vibrio_phage	8.6e-11	28.4
WP_010929971.1\|3705780_3706089_-	FmdB family transcriptional regulator	NA	NA	NA	NA
WP_010929970.1\|3706254_3707541_-	membrane protein	NA	NA	NA	NA
WP_010929969.1\|3708974_3709925_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929968.1\|3711876_3713091_-	formate-dependent phosphoribosylglycinamide formyltransferase	NA	NA	NA	NA
WP_003815171.1\|3713196_3714186_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	4.3e-38	37.7
WP_003815172.1\|3714182_3714791_+	HAD-IIIA family hydrolase	E3T535	Cafeteria_roenbergensis_virus	5.2e-10	26.1
WP_010929967.1\|3714803_3715433_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_003815175.1\|3715429_3716050_+	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_003815177.1\|3716081_3716873_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.5e-20	27.4
WP_010929966.1\|3717724_3718180_+	PTS transporter subunit EIIA	NA	NA	NA	NA
WP_010929965.1\|3718198_3719125_+	HPr kinase/phosphorylase	NA	NA	NA	NA
WP_010929964.1\|3719178_3720465_-	cytochrome c	NA	NA	NA	NA
WP_003815183.1\|3721395_3722268_+	RNase adapter RapZ	A0A1P8D5W0	Corynebacterium_phage	2.4e-08	34.5
WP_010929963.1\|3722264_3723215_+	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	6.9e-17	47.2
WP_005012067.1\|3723313_3724264_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_32

4156475 : 4221387

Planktothrix_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039249574.1\|4156475_4156961_+\|transposase	transposase	NA	NA	NA	NA
WP_153302797.1\|4157049_4157187_-	hypothetical protein	NA	NA	NA	NA
WP_010931647.1\|4157179_4158160_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_019248461.1\|4158426_4159236_+	pertussis toxin ADP-ribosyltransferase subunit PtxA	NA	NA	NA	NA
WP_014906114.1\|4159275_4159956_+	pertussis toxin binding subunit PtxB	NA	NA	NA	NA
WP_010929491.1\|4159949_4160408_+	pertussis toxin subunit 4	NA	NA	NA	NA
WP_023853616.1\|4160419_4160782_+	pertussis toxin binding subunit PtxD	NA	NA	NA	NA
WP_010931651.1\|4160864_4161548_+	pertussis toxin binding subunit PtxE	NA	NA	NA	NA
WP_010929493.1\|4161603_4161912_+	type IV secretion system protein PtlA	NA	NA	NA	NA
WP_010929494.1\|4161930_4162245_+	type IV secretion system protein PtlB	NA	NA	NA	NA
WP_010931652.1\|4162241_4164716_+	type IV secretion system protein PtlC	NA	NA	NA	NA
WP_010931653.1\|4164723_4166115_+	type IV secretion system protein PtlD	NA	NA	NA	NA
WP_010929497.1\|4166111_4166297_+	type IV secretion system protein PtlI	NA	NA	NA	NA
WP_010929498.1\|4166275_4166977_+	type IV secretion system peptidoglycanase PtlE	NA	NA	NA	NA
WP_010931654.1\|4166973_4167795_+	type IV secretion system protein PtlF	NA	NA	NA	NA
WP_010931655.1\|4167775_4168900_+	type IV secretion system protein PtlG	NA	NA	NA	NA
WP_010929500.1\|4168892_4169912_+	type IV secretion system protein PtlH	NA	NA	NA	NA
WP_010931656.1\|4170117_4171008_-	DMT family transporter	NA	NA	NA	NA
WP_010931657.1\|4171150_4172044_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003815873.1\|4172126_4172501_+	DUF1232 domain-containing protein	NA	NA	NA	NA
WP_010931658.1\|4172478_4173888_+	DUF2868 domain-containing protein	NA	NA	NA	NA
WP_003815876.1\|4173880_4175263_+	GTPase/DUF3482 domain-containing protein	A0A0R6PHS5	Moraxella_phage	9.9e-57	38.9
WP_003815878.1\|4175597_4177202_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010931659.1\|4177279_4178251_+	ABC transporter permease	NA	NA	NA	NA
WP_010931660.1\|4178261_4179188_+	ABC transporter permease	NA	NA	NA	NA
WP_077069022.1\|4179578_4180529_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931662.1\|4180698_4181925_+	bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ	NA	NA	NA	NA
WP_010931663.1\|4182124_4182991_+	ATP-binding protein	NA	NA	NA	NA
WP_003815027.1\|4182983_4183946_+	Nudix family hydrolase	A0A221LFJ1	Barns_Ness_breadcrumb_sponge_sobemo-like_virus	1.9e-06	53.4
WP_010927663.1\|4184046_4184997_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_010929969.1\|4185095_4186046_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929577.1\|4186144_4187095_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_023994937.1\|4187091_4188585_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_003815032.1\|4188581_4191689_-	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
WP_010931665.1\|4191685_4194754_-	MdtB/MuxB family multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
WP_010931666.1\|4194750_4196001_-	MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_023853184.1\|4196181_4196934_-	cell division protein ZapD	NA	NA	NA	NA
WP_010931667.1\|4196975_4197620_-	dephospho-CoA kinase	NA	NA	NA	NA
WP_003820519.1\|4197628_4198468_-	prepilin peptidase	NA	NA	NA	NA
WP_003815047.1\|4198708_4199452_+	hypothetical protein	NA	NA	NA	NA
WP_003815049.1\|4199534_4199882_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003815051.1\|4199979_4200822_-	pantoate--beta-alanine ligase	NA	NA	NA	NA
WP_003815053.1\|4200866_4201754_-	segregation/condensation protein A	NA	NA	NA	NA
WP_003815055.1\|4201780_4201969_-	DUF3460 family protein	NA	NA	NA	NA
WP_010931669.1\|4202066_4203524_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_010931670.1\|4203510_4205037_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_003815061.1\|4205055_4205523_-	membrane protein	NA	NA	NA	NA
WP_010931671.1\|4205522_4206545_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_003815064.1\|4206665_4207406_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.4e-35	39.7
WP_003815066.1\|4207460_4208561_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003815068.1\|4208562_4209753_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003815070.1\|4209872_4210889_-	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	1.0e-71	42.1
WP_003815073.1\|4211207_4211879_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	9.5e-29	38.2
WP_010927126.1\|4211875_4212784_+	FtsX-like permease family protein	NA	NA	NA	NA
WP_010931672.1\|4212995_4213643_+	chemoreceptor glutamine deamidase CheD	NA	NA	NA	NA
WP_033446142.1\|4217503_4218571_+	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_003815084.1\|4218581_4219391_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003815086.1\|4219480_4220254_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_023853189.1\|4220254_4220419_-	hypothetical protein	NA	NA	NA	NA
WP_010930363.1\|4220436_4221387_+\|transposase	IS481 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP017404

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection