CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP013101	Clostridium perfringens strain FORC_025 chromosome, complete genome	2 crisprs	DEDDh,cas14j,cas2,cas3,WYL,c2c9_V-U4,csa3,DinG	0	0	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013101_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013101_1

341580-341668

Orphan

Consensus_repeat	Method
AGTTTTATATAAATCAATATAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013101_1

>merge|NZ_CP013101|1|341580-341668|CRISPRCasFinder
AGTTTTATATAAATCAATATAAATTTAAAATTGCAATTTCAAAAGCTAGATTAGGTACTGATAAAGAGTTTTATATAAATCAATGTAAA

>NZ_CP013101|1|1|341580-341668|CRISPRCasFinder
AGTTTTATATAAATCAATATAAA	TTTAAAATTGCAATTTCAAAAGCTAGATTAGGTACTGATAAAG
AGTTTTATATAAATCAATGTAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013101.1\|WP_004458079.1\|341705_342383_-\|uracil-DNA-glycosylase	unknown	unknown	gnl\|CDD\|235376
NZ_CP013101.1\|WP_004458058.1\|339670_340981_-\|DUF1576-domain-containing-protein	unknown	unknown	gnl\|CDD\|377881
NZ_CP013101.1\|WP_070956308.1\|359195_360629_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340856
NZ_CP013101.1\|WP_003464290.1\|336527_337034_+\|CarD-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224248
NZ_CP013101.1\|WP_003464293.1\|339337_339550_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013101.1\|WP_003453458.1\|354162_355335_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213187
NZ_CP013101.1\|WP_070956307.1\|357899_359081_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213187
NZ_CP013101.1\|WP_003464244.1\|341201_341498_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013101.1\|WP_004458069.1\|337217_338354_+\|mechanosensitive-ion-channel-family-protein	unknown	unknown	gnl\|CDD\|366370
NZ_CP013101.1\|WP_003468707.1\|342720_345258_+\|glycoside-hydrolase-family-3-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|366376
NZ_CP013101.1\|WP_004458067.1\|338350_338974_+\|copper-homeostasis-protein-CutC	unknown	unknown	gnl\|CDD\|225684
NZ_CP013101.1\|WP_003472385.1\|333343_334075_-\|NAD-dependent-protein-deacylase	unknown	unknown	gnl\|CDD\|234777
NZ_CP013101.1\|WP_003453477.1\|356650_357886_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340856
NZ_CP013101.1\|WP_003470229.1\|351001_351469_-\|peroxiredoxin	unknown	unknown	gnl\|CDD\|224146
NZ_CP013101.1\|WP_003453483.1\|355348_356632_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340856
NZ_CP013101.1\|WP_003453475.1\|352122_352869_+\|peptidylprolyl-isomerase	unknown	unknown	gnl\|CDD\|234605
NZ_CP013101.1\|WP_003479536.1\|334290_335433_+\|type-I-restriction-enzyme-HsdR-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|227091
NZ_CP013101.1\|WP_070956306.1\|335693_336308_+\|sugar-O-acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP013101.1\|WP_003453460.1\|353332_354145_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224596
NZ_CP013101.1\|WP_003458352.1\|332559_332808_+\|spore-coat-protein	unknown	unknown	gnl\|CDD\|377935

Protein	Function_ID	Function_description	E-value
NZ_CP013101.1\|WP_004458079.1\|341705_342383_-\|uracil-DNA-glycosylase	gnl\|CDD\|235376	PRK05254, PRK05254, uracil-DNA glycosylase; Provisional.	1.66958e-148
NZ_CP013101.1\|WP_004458058.1\|339670_340981_-\|DUF1576-domain-containing-protein	gnl\|CDD\|377881	pfam07613, DUF1576, Protein of unknown function (DUF1576). This small family is found in several undescribed proteins. The alignment is distinguished by the frequent occurrence of conserved glycine and aromatic residues.	2.98799e-64
NZ_CP013101.1\|WP_070956308.1\|359195_360629_+\|glycosyltransferase	gnl\|CDD\|340856	cd04950, GT4_TuaH-like, teichuronic acid biosynthesis glycosyltransferase TuaH and similar proteins. Members of this family may function in teichuronic acid biosynthesis/cell wall biogenesis. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	1.33688e-56
NZ_CP013101.1\|WP_003464290.1\|336527_337034_+\|CarD-family-transcriptional-regulator	gnl\|CDD\|224248	COG1329, COG1329, Transcriptional regulators, similar to M. xanthus CarD [Transcription].	2.01008e-14
NZ_CP013101.1\|WP_003453477.1\|356650_357886_+\|glycosyltransferase	gnl\|CDD\|340856	cd04950, GT4_TuaH-like, teichuronic acid biosynthesis glycosyltransferase TuaH and similar proteins. Members of this family may function in teichuronic acid biosynthesis/cell wall biogenesis. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	1.34702e-58
NZ_CP013101.1\|WP_003453458.1\|354162_355335_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213187	cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system. The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenza) and a cytoplasmic membrane protein MPA2.	7.45112e-115
NZ_CP013101.1\|WP_003470229.1\|351001_351469_-\|peroxiredoxin	gnl\|CDD\|224146	COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones].	9.8243e-79
NZ_CP013101.1\|WP_004458069.1\|337217_338354_+\|mechanosensitive-ion-channel-family-protein	gnl\|CDD\|366370	pfam00924, MS_channel, Mechanosensitive ion channel. Two members of this protein family of M. jannaschii have been functionally characterized. Both proteins form mechanosensitive (MS) ion channels upon reconstitution into liposomes and functional examination by the patch-clamp technique. Therefore this family are likely to also be MS channel proteins.	1.0067e-41
NZ_CP013101.1\|WP_003468707.1\|342720_345258_+\|glycoside-hydrolase-family-3-C-terminal-domain-containing-protein	gnl\|CDD\|366376	pfam00933, Glyco_hydro_3, Glycosyl hydrolase family 3 N terminal domain.	5.22634e-110
NZ_CP013101.1\|WP_004458067.1\|338350_338974_+\|copper-homeostasis-protein-CutC	gnl\|CDD\|225684	COG3142, CutC, Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism].	1.28712e-89
NZ_CP013101.1\|WP_003472385.1\|333343_334075_-\|NAD-dependent-protein-deacylase	gnl\|CDD\|234777	PRK00481, PRK00481, NAD-dependent deacetylase; Provisional.	3.29219e-134
NZ_CP013101.1\|WP_070956307.1\|357899_359081_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213187	cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system. The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenza) and a cytoplasmic membrane protein MPA2.	1.94778e-120
NZ_CP013101.1\|WP_003453483.1\|355348_356632_+\|glycosyltransferase	gnl\|CDD\|340856	cd04950, GT4_TuaH-like, teichuronic acid biosynthesis glycosyltransferase TuaH and similar proteins. Members of this family may function in teichuronic acid biosynthesis/cell wall biogenesis. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	5.35525e-51
NZ_CP013101.1\|WP_003453475.1\|352122_352869_+\|peptidylprolyl-isomerase	gnl\|CDD\|234605	PRK00059, prsA, peptidylprolyl isomerase; Provisional.	1.6338e-32
NZ_CP013101.1\|WP_003479536.1\|334290_335433_+\|type-I-restriction-enzyme-HsdR-N-terminal-domain-containing-protein	gnl\|CDD\|227091	COG4748, COG4748, Uncharacterized conserved protein [Function unknown].	5.3452e-80
NZ_CP013101.1\|WP_070956306.1\|335693_336308_+\|sugar-O-acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	1.37891e-96
NZ_CP013101.1\|WP_003453460.1\|353332_354145_+\|ABC-transporter-permease	gnl\|CDD\|224596	COG1682, TagG, ABC-type polysaccharide/polyol phosphate export systems, permease component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	2.59948e-37
NZ_CP013101.1\|WP_003458352.1\|332559_332808_+\|spore-coat-protein	gnl\|CDD\|377935	pfam07875, Coat_F, Coat F domain. The Coat F proteins, which contribute to the Bacillales spore coat. It occurs multiple times in the genomes it is found in.	2.38946e-13

>NZ_CP013101.1|WP_003464244.1|341201_341498_-|hypothetical-protein
MKNYKDNDENFKLVPMNMKCNQEYSFMPMNKFNSNSMNLNPMINKNSNHSCCCMHNYVMKPSPYNNNYYENQMFPQNHTDNMMVKTLITVKKKSDLFD
>NZ_CP013101.1|WP_004458058.1|339670_340981_-|DUF1576-domain-containing-protein
MKRLPQEYLIHSILYISFIIFAFFLESPKEILNGLYNIISNSDILITDYISIGGFGATLINSALLGLIFIFLFYITDTKSTGKSIMSLWFLTGFGMFGKNIINIWPIVLGTFIYSKVKKKPFKDYLVIASLGTALAPTVSQFSFFPEVHPISGAIMGALVGIIVGFILPPIAKNASKIHSGFSLYNVGFAGGIIAIAVMSLMRAVGHDFETNSIWHKGNNILYMLFLFTISAYFIICSLILDKSKKSVLKDQIGINKEHGIFPSDFFSIYGSSCYFNMGVLCIFSTLFVLLINGDLNGPTIGAIFSMAGFGCYGKNLANSVPLIIGASLASLISISDINSPVTVVCILFSTGLAPISGYYGWPYGIIAGFLHIFMVFNIGELHGGLNLYNNGLASGFVAAIIVPVIESLQVTNTKNNLKDSSKRHPISLGIKKEAD
>NZ_CP013101.1|WP_003464293.1|339337_339550_+|hypothetical-protein
MLEKMILSDKECEYLAKSIAGGVLIGLALGAIFNNPQFGFALGGVTGIVASLIYTLVKRAKIKSDKKLIN
>NZ_CP013101.1|WP_004458067.1|338350_338974_+|copper-homeostasis-protein-CutC
MTIKLEACVGNYKEGKRAEELGANRIELCDNLAQGGTTPSYGTILQCKKDINIDINVIIRPRGGNFVYSKEELNIMKNDIKLCKDIGVTGVVFGFLKEDNTLDYETTKEFVELAKPLSVTFHMAFDEIENKVDALGKLIDLGVDRVLTKGGLDNAFKNKDTLKELVEHAKDKIIILPGGGVTKDNFLELKDYTNAREFHGTKIVGNL
>NZ_CP013101.1|WP_004458069.1|337217_338354_+|mechanosensitive-ion-channel-family-protein
MKELERLLGRITIINIKEIIIILVIMIIVLIINKILINNLFKLLMRGARRTKNYLDNNIVRALENPLKLIVSFVGIYSIFKVINLDSLGIDFLSTYKILRVGIIVSIIYFAYNLTLENSLLYSKLHKNDGGNTIVFPFISIIIRLIILLVGIIIIANEFGLTGFIAGLGVSGVAFALAAQDTCSNLFGGMVIVLDRPFSIGDWIQAGDVEGVVEEITFRSTRIRTFSMAIATVPNSKLANSNIINWTQRKLRRIHFKFTMDCKTQIESIKNSVNKIENMLKKHDKIDKNLIIVSFNELSTYGFGIFIYFYTDEFEYLKYEKLKEEINIKILEILREENVSLMFLNFDFKGFERRSGNCNLENTELESIKNITEEERGV
>NZ_CP013101.1|WP_003464290.1|336527_337034_+|CarD-family-transcriptional-regulator
MFKINDYIMYGTVGVCQVIDITKETLMNNIEKEYYVLSPVYSKYPKKTVIKIPVDNKKISMRTLLSKEDVNSIINSIPETETLWIDNDRQRNDEFKTMLRSGNCDDLIVLIRSIYLDKKKRKLDGKKACKGDDEIMQTAEKLINEEFAVILDIRPEEVKSYIKSHIPQ
>NZ_CP013101.1|WP_070956306.1|335693_336308_+|sugar-O-acetyltransferase
MDLKEIRERMYGQKLYYCNDEDLMREQMKALELLYDFNQTRPSEQDKREKILKKMFAEIGDDCYIEPPFHANWGGKNVHFGNGVYANFNLTMVDDCDIFVGNNVLFGPNVTVSAGTHPIHPELRSKQAQYNIPIHIGNNVWIGANSVILPGVNIGDNSVIGAGSIVTKDIPSNVIAVGNPCRVLREINENDMKYYYRDMKIDIE
>NZ_CP013101.1|WP_003479536.1|334290_335433_+|type-I-restriction-enzyme-HsdR-N-terminal-domain-containing-protein
MAFKDDIQKLSVQVKERKEYITNEEMTKQALIIPFIQILGFDVFNPIEIRPEYSADFGIKKGEKVDYALFKENEPIIFIEAKSVNENLNNHDAQLARYFNSTKEVKLAILTNGIEYKFFTDLNANNVMDDTPFLNINLLEIKESDIESLNKLRKENFDKDSLITYAEELVYTSTLNESLRRLFSNPSDDFVRFIVKDFSEMRITSNVIERFRPLVKKAISNAVLDIVSKGLYQQETLTIKKEENINNDSVNREDLSEIEIGNKVQKGIITTENELKGFNIVKDILEKNNRDISEINYKDTTNYFSVYLRNTTRWIIRFNLDASKKNVMTKLPVEYAKNICPNKEIEQAPKGIGESRVYINSIDELYDLEKYLVDAYDNVN
>NZ_CP013101.1|WP_003472385.1|333343_334075_-|NAD-dependent-protein-deacylase
MDDKINKLKEIIKNSNNIVFFGGAGVSTESGIPDFRSANGLFNEKLNITFTPEQLVSHSFFERYPEEFFNFYKAKLIYPNAKPNDAHIALAKLEEMGKLKAIVTQNIDGLHQMAGSKNVFELHGSVLRNYCVDCHTFYDEKFILESKGVPKCTKCGGIVKPDVVLYEEPLDDNVIRGAIDAISKADTLIIGGTSLVVYPAAGLINYFRGKNLVLINKSSTQADSKADLVINDSIGKVLGKVID
>NZ_CP013101.1|WP_003458352.1|332559_332808_+|spore-coat-protein
MQEKEMISDYLAGINASLAGYGGIISQCENQELRETIQNMRNQDEVRQYALFKIAKEKGYYIPAQQATPEEVATVKQQVSQG
>NZ_CP013101.1|WP_004458079.1|341705_342383_-|uracil-DNA-glycosylase
MAAEFNNDWDDLLKDEFEKEYYLNLRKFLINEYKTQKIHPSMYDIFNALKFTPYKDVKVVILGQDPYHGPNQAHGFSFSVKPGVQTPPSLRNMFKELNSDLGCYIPNNGFLESWAKQGILLLNTVLTVREGQANSHKGKGWEIFTDRVIELLNKREEPIVFILWGRNAISKEALITNSIHKIIKSVHPSPLSATRGFFGSKPFSKTNDFLVSINKEPIDWQIPNI
>NZ_CP013101.1|WP_003468707.1|342720_345258_+|glycoside-hydrolase-family-3-C-terminal-domain-containing-protein
MLLKKLAAILTVASIGATIFTSNKEVMATDSYSKAKEIVSNMTLEEKLGQMIMPDFRMWQEEGAKEPSDLTEINSEVAEVIDKYDLGGVILFAENVKEISQTTTLIHDLQEVAINDEDGNLPLLITLDQEGGIVTRLGEGTNLPGNMALGATRSEKSSYDAGYVIGKELNALGVNVDFAPVLDTNNNPENPVIGVRSISSNPELVGKLGKNIAKGIQDQGVAATAKHFPGHGDTATDSHYGLPMVDKSIEELRETELKPFKIAIENGIDMIMTAHIQFPQIEKDTFISKKDGSQISIPATLSDDIIKGILREEMEYDGVVITDAMNMKAISDHFGELESTKMAINAGIDIILMPTILRNNEDVKKLDYIVNGILDSIKSGEIKEEEITDSAERIVKLKIDRGIIDLKNNNASLEEKIKKAKKTVGSVENRNIERRISEEAITITKNEENILPLNPKEGEKVLLIAPNESQIHSMKFGINRLIHENSLNNIKLDTYEYNNIGIIDDVLKEKIESSDYIIVASLSSNANHLKPGAWNRDLPRSVIDYGNKLNKDTVLISLRNPYDLAAYDNAKAQVVAYGFKGMDPTEGDTLFPTKSSGPNIPASMGVVFGAVEPKGKLPVDIPSLNNDGTMNTEVNYYDYGHGITNINSLGNVNISMNKKINLGDNFQVKFNLSDFNEIVAGKYRAKIKFQGEKLEFINGKVEFSGDLQTNIIDNNTLEVLINLEEGSLKANEVNFILEFKAIDKAELTSIEITSSELIDEKGRCFKQKYVISEFSIEDNKEDKPLSPDEDKEDEENNEDLGNSDDNNKDELPQTGSGVGKEFIFGLGSLSLLAGIGLKSKRFKRK
>NZ_CP013101.1|WP_003470229.1|351001_351469_-|peroxiredoxin
MSIEINKLAPDFKLMGSDGKEHSLSDYKGKNIVLYFYPKDNTAGCTTEACDFRDNIQNFHDLNAIILGVSRDSLASHDKFITKLSLPFVLLSDPDETVCKLYDVIKEKNMYGKKYMGVERSTFLINKEGILIEEFRKVRVKGHIEKVLDKLKEIN
>NZ_CP013101.1|WP_003453475.1|352122_352869_+|peptidylprolyl-isomerase
MEKKVLATVGNTEITSDYIDEIIARYPAQQQAMLASDEGKRQVLEQAIAFELMSEFAKETGLDKTEEFKDQLNKFAKELLAQMVMKKTLSSVTVTDDEAKAFYEEHKENFVELETVTAKHILVASEEEAKKVEEEIASGSITFEDAANKYSSCPSKEQGGNLGSFSKGMMVPEFEEAAFNLELGVVSAPVKTQFGYHLIKVEDKTEAKTKAFEDVKEQVVNMLIQERQQKKYLELIKELREKYGVKLA
>NZ_CP013101.1|WP_003453460.1|353332_354145_+|ABC-transporter-permease
MKDWLEIEKSIFSHWRMIFSISKKEFKKEFAGSKLGMAWAIIRPLAMITVFWMIFSTGMRTTSSNVQVNYLVWLVSAYIPWIFISDVIMSGAGSIRVNSFLVKKVKFPVEILPTIRIVISFYTFLILLVISFIIFAVNGNLNLINIPKLIYAIIITIIFLAALSRLLSTWVVMSIDILHGISVFMQFLFWMCPVMWQAGELPVGSSMPWIEKILKLNPLYYLAVLFRDAYLGTHTVSLAYGVYFWVVTIILFIFGSKVFKKFRPEFDDVL
>NZ_CP013101.1|WP_003453458.1|354162_355335_+|ATP-binding-cassette-domain-containing-protein
MSVAIRVKDLTKKYKLYQKRSERLANAFGKEKNIKEFYALKGVSFEISKGECVGIIGHNGAGKSTLLKLLTGVAFPTSGEIEINGRLASMLELGSGFNPELTGMENIYFNGSLNGLTKEEIDGKLKDILEFADIGNFIEQPVKNYSSGMFARLAFAVAINVDPDILIVDEILSVGDVGFQVKCMEKFNEFKKKGKTILYVSHGLGTVKKFCDRAIWLQKGEVVDDGNSVIVVERYYNLNFNPANIEQLKDHKSDIINSIAVKSNTKNVEYLEKLDLEVEYDLISNDLKDPNIVLEFRKTDYEPGTTRGNDQFVCGINSKDNIKNIPFNLGVNKLKVSLNKVNLVAGVYYIDFVLRDGEEEVYRKINGYSFTLNDKYRGEGFLILGHSWGN
>NZ_CP013101.1|WP_003453483.1|355348_356632_+|glycosyltransferase
MSVGRIARRTTEVLKEDGLIEVIKRVLRYIKRRIKDKLDNNALTYRKNYEEANAIFHKILKKEKFKAVVVFDSRVGWNIPLFQRSQHMANELTDDGYLYFYRTSEQFDPHVKTVEKLKDRLYLVNMANFALQNAMFDLLKEYKGHKFLSLYSTDVYLDEQYIKEKYIDNGFKIIYEYIDELSDEISGHLPDFVYDRHKNIIEDKSNIAVGSADKLIEEIEEIRGKENVAMITNGVQYDHWQYRSDEVPEKLKDIVSKGNPIIGYFGALAKWFDYELLKKVAKERPNYEIVLIGFLYDNSFKDSKIDELENVHYLGIVDYKELNQYSQYFTISTIPFLLNDITESTSPVKLFEYMAMGHPIVTTDMRECRKYKSVLIGKSHEDFIEKLDFALTLDKKDEYYNYLKEEALANTWREKAAILDRLIEKNI
>NZ_CP013101.1|WP_003453477.1|356650_357886_+|glycosyltransferase
MSLKRSLKNLLRPILKPMLLKYREKGHEDQKQVFFDEITGAIKNGNYDAIVIFDVYFGFEVKMFQRPQHIALNLAKENVLYFYKASPYVDKDIKTYKKMEENLYLVNTDLYWLQECLIDIVSQSGVPAFGQIYSTSFVEYDSWLKKFTDRNFKIIYEYVDDLSDDIAGFKISDEIKASHKRMLEDTEKVYVVTTADKLYQEAKELRGENKLALVTNGVQYEHFANIDCKKIPDKMKNIVNSKKKIIGYFGALASWFDYDLIKELAEEFKDDYEIVLIGIDYDQSLGKSGILKLDNVHYLGTVNYNELPTYSKFFNVSIIPFVVNEITEATSPVKLFEYMALGKPIVTTALPECRKYESPLVSDSHEDFINNIKKAAELENSKEYIELLRKEGNQNTWRQKAKDIKELILNS
>NZ_CP013101.1|WP_070956307.1|357899_359081_+|ABC-transporter-ATP-binding-protein
MEKAIEVKNLCKNYRVYDSKSSRIRNIINPFAKKEVKEFKALTDVSFHVNKGEIVGIIGNNGAGKSTLLKILTGVSFPSSGEVNVNGRVSSLLELGTGFNPELTGEENIYFNGSLMGLTQDEIDKVKDNIIEFADIGEFINQPVKSYSSGMYARLAFAVAININPDILIVDEILSVGDVGFQKKCMDKFNEFKEAGKTVLYVSHGLETVQTFCERAIWLEKGRVVDIGPSFDIVEKYYDKLMKSDDKEELETCKFVELINVEILDDKKVYKKGESIEFLVEYEVFNPSVKNAGITIEMRKAYREPCEYRNADQFIFSVNSNVDEFTIPWKKGRNKITFKIDSLDVKEGIYYLDAIFSESQNLVALETQEDIVSFEVKNEGESEGFVLLDSTWT
>NZ_CP013101.1|WP_070956308.1|359195_360629_+|glycosyltransferase
MSNIFEVMLKKNIGDFTYEEKRELNNWLIENLKLKELIYSGLELTKVINEDGEETAYYENKITEEDILSGNFNELCSKTSKYIDDAISSILFEGQFNCFYEKIKSILELEDFDEIIVFHASFGWNIEMKQRPQHLAEALSKKKVLYIYRSDVKNDNSYSIKKIKDNLYVLNLDMYSLNVAFFEAIKSINKPKFVHVYATCLNSVDYEKIKTYMDKGFKVIYDFVDELSSEISGYNITSKMIEDHEKLLRDKENVLVVSTAKKLKDIANKFRGENENNILAPNAVNLEDFKNHGNEIGEKIQPIVNKRKPIIGYYGALAKWFDYKLIEQLAKEREDYEIVLIGMDYDGSYDQSNLKYYSNISYLGMIDYKDLINYSRYFDVCIVPFIKNDITDSTSPLKIFEYMALEKPIVTTNINECKNYESCLISKDYDEFIRNIDKALKLEIDNKEYFNILRREAEENTWDNRAELIKEAIKNLE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013101_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013101_2

2410200-2410311

Orphan

Consensus_repeat	Method
TTCTATTTAAATCTATTACTTTACATAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013101_2

>merge|NZ_CP013101|2|2410200-2410311|CRISPRCasFinder
TTCTATTTAAATCTATTACTTTACATAAGAAATTATTCTAATTATTTTTAAAATAATAAATCTTTTTTGAGTCCTCTTCTTCTCTTCTATTTAAATTTATTACTTTACATAA

>NZ_CP013101|2|2|2410200-2410311|CRISPRCasFinder
TTCTATTTAAATCTATTACTTTACATAA	GAAATTATTCTAATTATTTTTAAAATAATAAATCTTTTTTGAGTCCTCTTCTTCTC
TTCTATTTAAATTTATTACTTTACATAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013101.1\|WP_070957029.1\|2412328_2412946_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013101.1\|WP_003481872.1\|2409299_2410184_-\|stage-III-sporulation-protein-AA	unknown	unknown	gnl\|CDD\|274324
NZ_CP013101.1\|WP_003451336.1\|2405522_2406128_-\|stage-III-sporulation-protein-AG	unknown	unknown	gnl\|CDD\|274319
NZ_CP013101.1\|WP_003451464.1\|2410380_2410743_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013101.1\|WP_070957031.1\|2413742_2414255_-\|type-II-secretion-system-protein	unknown	unknown	gnl\|CDD\|225076
NZ_CP013101.1\|WP_070957030.1\|2412914_2413325_-\|type-IV-pilin	unknown	unknown	unknown
NZ_CP013101.1\|WP_070957305.1\|2413311_2413608_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013101.1\|WP_003451406.1\|2407890_2408277_-\|stage-III-sporulation-protein-AD	unknown	unknown	gnl\|CDD\|131896
NZ_CP013101.1\|WP_004456727.1\|2411584_2411932_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013101.1\|WP_070957033.1\|2414695_2415715_-\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|224376
NZ_CP013101.1\|WP_070957032.1\|2414274_2414703_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	unknown	unknown	unknown
NZ_CP013101.1\|WP_070957028.1\|2411928_2412369_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013101.1\|WP_003451536.1\|2404999_2405497_-\|SpoIIIAH-like-family-protein	unknown	unknown	gnl\|CDD\|378918
NZ_CP013101.1\|WP_003475129.1\|2408637_2409153_-\|stage-III-sporulation-protein-SpoAB	unknown	unknown	gnl\|CDD\|131880
NZ_CP013101.1\|WP_011592693.1\|2403999_2404407_-\|transcription-antitermination-factor-NusB	unknown	unknown	gnl\|CDD\|234686
NZ_CP013101.1\|WP_003475139.1\|2406707_2407880_-\|stage-III-sporulation-protein-AE	unknown	unknown	gnl\|CDD\|213743
NZ_CP013101.1\|WP_003451410.1\|2404525_2404915_-\|Asp23/Gls24-family-envelope-stress-response-protein	unknown	unknown	gnl\|CDD\|377129
NZ_CP013101.1\|WP_003481869.1\|2406142_2406700_-\|stage-III-sporulation-protein-AF	unknown	unknown	gnl\|CDD\|131942
NZ_CP013101.1\|WP_003451649.1\|2410856_2411414_-\|elongation-factor-P	unknown	unknown	gnl\|CDD\|234788
NZ_CP013101.1\|WP_003451671.1\|2408364_2408562_-\|stage-III-sporulation-protein-AC	unknown	unknown	gnl\|CDD\|131895

Protein	Function_ID	Function_description	E-value
NZ_CP013101.1\|WP_003481872.1\|2409299_2410184_-\|stage-III-sporulation-protein-AA	gnl\|CDD\|274324	TIGR02858, Stage_III_sporulation_protein_AA, stage III sporulation protein AA. Members of this protein are the stage III sporulation protein AA, encoded by one of several genes in the spoIIIA locus. It seems that this protein is found in a species if and only if that species is capable of endospore formation. [Cellular processes, Sporulation and germination].	1.25989e-161
NZ_CP013101.1\|WP_003451336.1\|2405522_2406128_-\|stage-III-sporulation-protein-AG	gnl\|CDD\|274319	TIGR02830, Stage_III_sporulation_protein_AG, stage III sporulation protein AG. CC A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is found in a spore formation operon and is designated stage III sporulation protein AG. [Cellular processes, Sporulation and germination].	2.26928e-69
NZ_CP013101.1\|WP_070957031.1\|2413742_2414255_-\|type-II-secretion-system-protein	gnl\|CDD\|225076	COG2165, PulG, Type II secretory pathway, pseudopilin PulG [Cell motility and secretion / Intracellular trafficking and secretion].	0.000905693
NZ_CP013101.1\|WP_070957033.1\|2414695_2415715_-\|type-II-secretion-system-F-family-protein	gnl\|CDD\|224376	COG1459, PulF, Type II secretory pathway, component PulF [Cell motility and secretion / Intracellular trafficking and secretion].	3.39541e-51
NZ_CP013101.1\|WP_003451406.1\|2407890_2408277_-\|stage-III-sporulation-protein-AD	gnl\|CDD\|131896	TIGR02849, Stage_III_sporulation_protein_AD, stage III sporulation protein AD. Members of this family are the uncharacterized protein SpoIIIAD, part of the spoIIIA operon that acts at sporulation stage III as part of a cascade of events leading to endospore formation. Note that the start sites of members of this family as annotated tend to be variable; quite a few members have apparent homologous protein-coding regions continuing upstream of the first available start codon. The length of the alignment and the scoring cutoff thresholds for the model have been set to try to detect all valid members of the family, even if annotation of the start site begins too far downstream. [Cellular processes, Sporulation and germination].	5.58273e-33
NZ_CP013101.1\|WP_003451536.1\|2404999_2405497_-\|SpoIIIAH-like-family-protein	gnl\|CDD\|378918	pfam12685, SpoIIIAH, SpoIIIAH-like protein. Stage III sporulation protein AH (SpoIIIAH) is a protein that is involved in forespore engulfment. It forms a channel with SpoIIIAH that is open on the forespore end and closed (or gated) on the mother cell end. This allows sigma-E-directed gene expression in the mother-cell compartment of the sporangium to trigger the activation of sigma-G forespore-specific gene expression by a pathway of intercellular signaling. This family of proteins is found in bacteria, archaea and eukaryotes and so must have a wider function that in sporulation. Proteins in this family are typically between 174 and 223 amino acids in length.	3.45938e-23
NZ_CP013101.1\|WP_003475129.1\|2408637_2409153_-\|stage-III-sporulation-protein-SpoAB	gnl\|CDD\|131880	TIGR02833, Stage_III_sporulation_protein_AB, stage III sporulation protein AB. A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is designated stage III sporulation protein AB. [Cellular processes, Sporulation and germination].	7.19558e-76
NZ_CP013101.1\|WP_011592693.1\|2403999_2404407_-\|transcription-antitermination-factor-NusB	gnl\|CDD\|234686	PRK00202, nusB, transcription antitermination factor NusB.	6.37134e-50
NZ_CP013101.1\|WP_003475139.1\|2406707_2407880_-\|stage-III-sporulation-protein-AE	gnl\|CDD\|213743	TIGR02829, Stage_III_sporulation_protein_AE, stage III sporulation protein AE. A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is found in a spore formation operon and is designated stage III sporulation protein AE. [Cellular processes, Sporulation and germination].	5.56452e-150
NZ_CP013101.1\|WP_003451410.1\|2404525_2404915_-\|Asp23/Gls24-family-envelope-stress-response-protein	gnl\|CDD\|377129	pfam03780, Asp23, Asp23 family, cell envelope-related function. The alkaline shock protein Asp23 was identified as an alkaline shock protein that was expressed in a sigmaB-dependent manner in Staphylococcus aureus. Following an alkaline shock Asp23 accumulates in the soluble protein fraction of the S. aureus cell. Asp23 is one of the most abundant proteins in the cytosolic protein fraction of stationary S. aureus cells, with a copy-number of >25000 per cell. A second Asp23-family protein, AmaP, which is encoded within the asp23-operon, is required to localize Asp23 to the cell membrane. The overall function for the family is thus a cell envelope-related one in Gram-positive bacteria.	5.69298e-30
NZ_CP013101.1\|WP_003481869.1\|2406142_2406700_-\|stage-III-sporulation-protein-AF	gnl\|CDD\|131942	TIGR02896, Stage_III_sporulation_protein_AF, stage III sporulation protein AF. This family represents the stage III sporulation protein AF of the bacterial endospore formation program, which exists in some but not all members of the Firmicutes (formerly called low-GC Gram-positives). The C-terminal region of this protein is poorly conserved, so only the N-terminal region, which includes two predicted transmembrane domains, is included in the seed alignment. [Cellular processes, Sporulation and germination].	1.20144e-23
NZ_CP013101.1\|WP_003451649.1\|2410856_2411414_-\|elongation-factor-P	gnl\|CDD\|234788	PRK00529, PRK00529, elongation factor P; Validated.	2.22205e-107
NZ_CP013101.1\|WP_003451671.1\|2408364_2408562_-\|stage-III-sporulation-protein-AC	gnl\|CDD\|131895	TIGR02848, Stage_III_sporulation_protein_AC, stage III sporulation protein AC. Members of this protein family are designated SpoIIIAC, part of the spoIIIA operon of sporulation genes whose mutant phenotype is linked to sporulation stage III. Members of this family are encoded by the genome of a species if and only if that species is capable of endospore formation, as in Bacillus subtilis. The molecular function of this small, probable integral membrane protein is unknown. [Cellular processes, Sporulation and germination].	1.97477e-14

>NZ_CP013101.1|WP_003481872.1|2409299_2410184_-|stage-III-sporulation-protein-AA
MKEIFDVLPDKINSCLKDKNNLNKLQEIRVKVGKPLNIVLDNTETIFNYVIRREDVKAIIQKISNYSLYAFEEDIRQGYITIQGGHRVGLAGQCVIEDNSIKTIRNITSLNIRVCREIVGCSNSLMNSLVENNRVNNTLIISPPKCGKTTLLRDITRNISNGISQIGFKGKRTVVIDERSEIAACYNGIPQMNVGMRTDVYDNCIKSEGMMMAVRGLSPEVIICDEIGTYKDMEGLMMAYNSGVSIIATLHGRNVEELYRRPVFREIVENNIINKVVVLSGKKGIGTIEGIYNV
>NZ_CP013101.1|WP_003475129.1|2408637_2409153_-|stage-III-sporulation-protein-SpoAB
MKVFFLLIIVLLSSLIGYLYGEGFRNRLSQLRELKRALIDFENDIVYTYTPLPESIESIALKAKSPIKELFNEISLKLKNNEVENVYMAFKESINEHKKEMNLRNKDFEILLDLSKSLGETNVEGQIKIFNLAKEKLDIELEIAEDECNKNTKVYRYLGVAVGAMIAIFLV
>NZ_CP013101.1|WP_003451671.1|2408364_2408562_-|stage-III-sporulation-protein-AC
MSDLSLIFQIAGVGIVLVILDKVLDQSGKKEYATLANIVGVVIILTMMIQLISRLFSSVKSMFLF
>NZ_CP013101.1|WP_003451406.1|2407890_2408277_-|stage-III-sporulation-protein-AD
MDVVIQVISFVLISLFLYLVLKDNKSTFAVFLLLGAGIVIFLFVMPYVNEIIAFMQDIARESGMDSSYIAIVMKIIAIAYLSTFCSYICNDAGVTVLGKKVEFTGKIMILLLAIPIMANILNSILSIM
>NZ_CP013101.1|WP_003475139.1|2406707_2407880_-|stage-III-sporulation-protein-AE
MKKLINIILLSLIFVFCFNLKVLANDNLESSKEKIDNDSRIERFYDYINNLETEEDILGNMSAKEYIMNYLESGEDPITLKKIGASILSYMFRELNIVLKFIASILVIALLSALLKNLQDAFNIEEGVTQVAFFACYALLIMLLTKSFFISLNLGKEVLTSIIDFMNVIVPVIVMLIATSGGVTSAVTIDPIVLGAVSITPRIYTYFLFPLILAYFTLQFVNNLSSEFKIDRMCKFIKQVVMISQGFILTIFVGILTLRGMTADTLDAVAVKTVKFAVDNFVPIVGKAFSDAITTVAGYSLAMKSVITSLGVIVLVVIVIYPIIKIGLMAICFKLTSAVIEPVVDSKISSSVETVGEALFMIMSCIISVSIMFFIMASMMATAGNFIVGG
>NZ_CP013101.1|WP_003481869.1|2406142_2406700_-|stage-III-sporulation-protein-AF
MELLKNWISTLCVVIVIISIAHIILPNSSIKKHVKFAFSLIILSVMLSPIIGILTMNKDIDETVFQEKISDVTRSDEEKKLLYDEEAILKSVEKNLEKSLKDEFYENEFEVNLIGKIDFDEVKFNIEKAEITVLDEKKVKKVDKVVVGKEKVNKEEKKDSFLEKIEKFVEKELEISHENIIVSYA
>NZ_CP013101.1|WP_003451336.1|2405522_2406128_-|stage-III-sporulation-protein-AG
MHELKEKIANLFKQKNITNLIILLLLVIMFYLVVSYFTGVNNITKSEKTNLEKVSKEDMNSNSQKDSEVLSYQEKQEKDLERILGKINGVGSVDVVINFQSSEVKVPAVDNSSQKSTTEETDSEGGTRVNSQETDGDKIVMSNSSNGSEPVILKTEKPEVLGVMVVAEGAEDSKIKYEITKAISSLYNISVDKVNVLAMKK
>NZ_CP013101.1|WP_003451536.1|2404999_2405497_-|SpoIIIAH-like-family-protein
MNRKQAGIILTLLALIVCTGVLATRVNNQIKESMGEVPTAFGENDDNATETSSNYFYESRNLREQKDSKTIDNLKAIVEDKNTSAEQKEEAEKELTEKTMARDYETRIELSIKSKGYEDVICFIDGDNAKVVVKTNEELTQEKMVEIQDIVMNVSKVYDVDIEKK
>NZ_CP013101.1|WP_003451410.1|2404525_2404915_-|Asp23/Gls24-family-envelope-stress-response-protein
MNEMNRDEANLGIVNISDEVIGVVAGIAASEIDGILEINHNNSTGIGHKFSKKSLGKGIKVNVENGEAVIEIGVTVQYGIKIPDVVSQVQENVRRTVEAITGLKVALVNIYVQNIIILKEEDKNEILKK
>NZ_CP013101.1|WP_011592693.1|2403999_2404407_-|transcription-antitermination-factor-NusB
MNRVKSREYLLQLAYQMEITSETALETFNSFMENEDISKDDLDLAYIKSGLLGIEENKEKLDSLIESQLVKWKLNRISKVNLSILRISTYEILFAEDVPGKVSINEAIELCKKYSDNKSVSFINGVLDKVYKNIK
>NZ_CP013101.1|WP_003451464.1|2410380_2410743_-|hypothetical-protein
MKDIKNNISNLLKAMDKNTELDKEFKDSLLNVISSLVDKVEELQVNVETLDENVNLLNDDLSGVQDELFEELTLEELEEYDDEYCEVVCDKCHKPIYIEKDILNRSESIPCPYCGNEFEV
>NZ_CP013101.1|WP_003451649.1|2410856_2411414_-|elongation-factor-P
MISGSDLRKGTTFELDGQVYTVIDFLHVKPGKGAAFVRTKLRNVIMGGVTDRTFNPTDKLQEAIIERKEMQYLYSDGELYYFMDQETFEQIPLNHEKVEDAIKFLKENMNAVIKFYKGEAFSVEAPNFVELLITECEPSVKGNTATTAMKTAVVETGATVMVPMFVEEGNTIRIDTRTGEYMERV
>NZ_CP013101.1|WP_004456727.1|2411584_2411932_-|hypothetical-protein
MKKLKLDVTLATIFIVILLVQGIELFKLRNYEIPVLTNSIGEMDLNTVLKNIENKDCTVLQLEYKEGWIGKVLFTGSLEDLSNYVNLLKNNNINIKNYKIEKSEELRCFLELKVV
>NZ_CP013101.1|WP_070957028.1|2411928_2412369_-|hypothetical-protein
MRLEVRRIYIKKYKNFLPIEYVEEYNRKIKKKLNIYILLLLLFNLFFYGKIKTENNKIKNYLSEIKGVNRERSLDKEFLEDINKLKEIIKDEKILNLNLERKSFEVEVNSIYKNSLINYINKINGRVYDISLNESNNTYRLKGELR
>NZ_CP013101.1|WP_070957029.1|2412328_2412946_-|hypothetical-protein
MSLLIKTLVINDTNDISKLKELKDKRVKIILLNEKIFIETLRVDKKCNIEEKIEQLIRDRFFNYTPLVHYEVLKYKKSLFLIVYFIGCDERFKSLLYERKDFALTFPELKNKNILSFKKATFELKNLKISIYIKGKLVLLKSVKDSNIIEVIEESLKGLEKDFGVSLKDFTFKIQKEYLKEEIKELFKGLKLNEIRGEENLYQKI
>NZ_CP013101.1|WP_070957030.1|2412914_2413325_-|type-IV-pilin
MKRRKGFVSIEVMLVSLICSMIVTILMDNSFQRRKELDRSFKITCHNIDKNNSEEQFLKYMLKEKILNIDNINKLDFTLNNMNATYIEDKKAIHIKSKDKISGVFKDTYYGIDFRNDDIVFSKRRNYEFINKDLSN
>NZ_CP013101.1|WP_070957305.1|2413311_2413608_-|hypothetical-protein
MYLNYRFWDNMVENIKINKDKNYILVKFWRDGIVAEDKIEKIKNKLYVYYNYTGYGRNYSPALIEDVEKFDLMEKGNLFYIKLKVKNQEERIYCYEKA
>NZ_CP013101.1|WP_070957031.1|2413742_2414255_-|type-II-secretion-system-protein
MEGKINKKKGYLLVDMVLALALISILFLGIGKSYSTYIKNNYYIKEKIKVAEIINSLAMELKHNISFEDLRSINSGTYKISTLKINDLINSDIKEFLRKNLILHNKNHNDLGWTINISHFDQYESIINIIYKNEKPYISENKEVKIYKFLEKSFQNLENQLQKEEEKHIY
>NZ_CP013101.1|WP_070957032.1|2414274_2414703_-|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein
MYRKRKGFTISEVIIYLAITSLILAIPTSFMIIKDRGYELKVEGEISKIHDFLMEAKQLSKKDNLYGEIIFDILDNKLIYENALRTTSLKLNEVKVSFNRDNLITINETGMISIAGTITIIDKNNKQREITIVPGIWKINVK
>NZ_CP013101.1|WP_070957033.1|2414695_2415715_-|type-II-secretion-system-F-family-protein
MFGFKDEASYICLNLSTYVKSGMPIGRSLDLIKNTVKDKKYKESLKRIEKKVLNGEALSKAFKEEGNLYPDLMKDMMKIGEESGNLEEVLEKCARNILAEKEIKNKIIKSLRYPVSLLIGLIIMIFGYVTYILPQFVDMYELREIEGSKIMTLLNNYINFVEENPNVEVIVFCYFSCALISLYLLFKVIPSEKILEKIEVYRMYYEIRILFLINMILNSGISLNNSLSVFGESLSDIKLRKYIKSINEELIKGTTLSSSIGKINVISHVSKGFLITGEESGLFSKNIEELLKIREKDFDRALNKTVGKIEPAMFIILGFVISAMMLLVLVPTFEGMKYV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

817736 : 830325

Synechococcus_phage(25.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_070956433.1\|817736_818387_+	aminotransferase	A0A1B1P8C0	Bacillus_phage	8.3e-14	30.1
WP_070956434.1\|818889_820200_+	phosphomethylpyrimidine synthase ThiC	NA	NA	NA	NA
WP_070956435.1\|820436_824237_+	phosphoribosylformylglycinamidine synthase	A6N228	Microbacterium_phage	4.7e-32	25.1
WP_003453078.1\|824549_825029_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.6e-28	47.4
WP_070956436.1\|825028_825736_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	2.8e-47	43.8
WP_003480390.1\|825757_827203_+	amidophosphoribosyltransferase	A0A1B1ISH6	uncultured_Mediterranean_phage	1.0e-56	33.0
WP_003468449.1\|827203_828205_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3FGG1	Synechococcus_phage	6.7e-71	49.0
WP_070956437.1\|828192_828807_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.7e-24	36.2
WP_070956438.1\|828819_830325_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.5e-66	47.2

DBSCAN-SWA_2

1085334 : 1127324

Clostridium_phage(76.92%)

integrase,terminase,holin,capsid

attL 1081923:1081939|attR 1126612:1126628

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1081923:1081939	attL	NA	NA	NA	NA
WP_070956531.1\|1085334_1087146_+	ribonucleoside triphosphate reductase	D9ZNH0	Clostridium_phage	7.0e-220	62.7
WP_003477277.1\|1087142_1087601_+	4Fe-4S cluster-binding domain-containing protein	D9ZNH1	Clostridium_phage	2.9e-29	48.6
WP_057231030.1\|1087795_1088518_+	hypothetical protein	NA	NA	NA	NA
WP_003477284.1\|1088626_1089691_-\|integrase	site-specific integrase	B3GVW7	Streptococcus_phage	1.6e-33	33.1
WP_070956532.1\|1089783_1090248_-	ImmA/IrrE family metallo-endopeptidase	A0A0A7RVV2	Clostridium_phage	1.2e-38	51.3
WP_061426969.1\|1090263_1090761_-	helix-turn-helix domain-containing protein	A0A2H4J4X9	uncultured_Caudovirales_phage	4.3e-18	57.0
WP_070956533.1\|1090930_1091164_+	DUF739 family protein	A0A2H4JCQ4	uncultured_Caudovirales_phage	1.5e-13	54.3
WP_081340030.1\|1091179_1091935_+	ORF6C domain-containing protein	D2IYT0	Enterococcus_phage	6.2e-29	36.8
WP_070956534.1\|1091975_1092263_+	hypothetical protein	NA	NA	NA	NA
WP_070956535.1\|1092246_1092621_-	DUF2513 domain-containing protein	A0A0P0IV09	Lactobacillus_phage	1.3e-24	44.3
WP_061426975.1\|1092797_1093100_+	hypothetical protein	NA	NA	NA	NA
WP_070956536.1\|1093101_1093281_+	hypothetical protein	M9Q2G4	Clostridium_phage	1.4e-08	53.4
WP_070956537.1\|1093291_1093474_+	hypothetical protein	I2E8Z1	Clostridium_phage	3.6e-07	48.3
WP_070956538.1\|1093568_1093751_+	hypothetical protein	NA	NA	NA	NA
WP_070956539.1\|1093762_1094002_+	hypothetical protein	NA	NA	NA	NA
WP_070956540.1\|1094015_1094513_+	siphovirus Gp157 family protein	B6CXH7	Clostridium_phage	4.2e-26	42.2
WP_070956541.1\|1094522_1095095_+	ERF family protein	A0A2H4J7J4	uncultured_Caudovirales_phage	1.5e-38	49.0
WP_034833056.1\|1095107_1095296_+	hypothetical protein	NA	NA	NA	NA
WP_070956542.1\|1095309_1096080_+	hypothetical protein	Q9AZA0	Lactobacillus_prophage	1.8e-39	56.3
WP_172686401.1\|1096102_1096276_+	hypothetical protein	NA	NA	NA	NA
WP_070956543.1\|1096760_1097297_+	hypothetical protein	NA	NA	NA	NA
WP_070956545.1\|1097615_1098089_+	DUF722 domain-containing protein	Q0SPJ6	Clostridium_phage	7.4e-20	37.9
WP_070956546.1\|1098449_1099466_+	DUF4062 domain-containing protein	NA	NA	NA	NA
WP_070956547.1\|1099537_1100005_+\|terminase	terminase small subunit	A7J290	Streptococcus_phage	1.8e-34	59.4
WP_011590465.1\|1099997_1101362_+\|terminase	terminase	M9Q2I1	Clostridium_phage	4.7e-261	96.2
WP_070956548.1\|1101417_1102185_+	hypothetical protein	NA	NA	NA	NA
WP_041702637.1\|1102230_1103751_+\|capsid	phage capsid protein	M9Q246	Clostridium_phage	1.3e-283	97.2
WP_080503691.1\|1104874_1105372_+	hypothetical protein	A0A0A8WIE7	Clostridium_phage	4.8e-30	59.8
WP_041702747.1\|1105417_1105609_+	hypothetical protein	A0A0A8WJ56	Clostridium_phage	1.8e-09	64.7
WP_070956549.1\|1105636_1106254_+	hypothetical protein	NA	NA	NA	NA
WP_070956550.1\|1106347_1106956_+	hypothetical protein	M9Q248	Clostridium_phage	1.6e-59	69.8
WP_070956551.1\|1106979_1107885_+\|capsid	capsid protein	M9Q2F4	Clostridium_phage	3.1e-168	98.3
WP_003460293.1\|1107901_1108171_+	hypothetical protein	M9Q1H8	Clostridium_phage	3.4e-22	100.0
WP_070956552.1\|1108206_1108569_+	hypothetical protein	M9Q2K9	Clostridium_phage	5.0e-61	99.2
WP_011590474.1\|1108572_1108899_+	hypothetical protein	M9Q2I3	Clostridium_phage	5.2e-57	99.1
WP_057231069.1\|1108898_1109282_+	hypothetical protein	M9Q249	Clostridium_phage	3.2e-66	100.0
WP_057231071.1\|1109281_1109668_+	hypothetical protein	M9Q2F6	Clostridium_phage	8.6e-67	96.9
WP_070956553.1\|1109677_1110136_+	hypothetical protein	M9Q1I1	Clostridium_phage	9.2e-84	97.4
WP_003460275.1\|1110148_1110517_+	hypothetical protein	M9Q2L0	Clostridium_phage	1.1e-52	99.2
WP_070956554.1\|1110476_1110839_+	hypothetical protein	M9Q2I4	Clostridium_phage	2.5e-60	98.3
WP_070956555.1\|1110879_1114092_+	hypothetical protein	M9Q251	Clostridium_phage	0.0e+00	86.7
WP_070956556.1\|1114095_1114449_+	hypothetical protein	M9Q2F8	Clostridium_phage	4.8e-56	94.6
WP_070956557.1\|1114469_1114733_+	hypothetical protein	NA	NA	NA	NA
WP_070956558.1\|1114805_1115411_+	hypothetical protein	NA	NA	NA	NA
WP_070956559.1\|1115618_1115813_+	hypothetical protein	NA	NA	NA	NA
WP_070956560.1\|1115891_1116089_+	hypothetical protein	NA	NA	NA	NA
WP_070956561.1\|1116081_1116924_+	hypothetical protein	NA	NA	NA	NA
WP_070956562.1\|1116989_1117370_+	DUF1617 family protein	M9Q2L1	Clostridium_phage	8.5e-59	93.7
WP_070956563.1\|1117405_1122514_+	hypothetical protein	M9Q2I5	Clostridium_phage	8.5e-271	93.8
WP_011590481.1\|1122536_1122785_+	hypothetical protein	Q0SPG3	Clostridium_phage	5.4e-38	95.1
WP_070956564.1\|1122798_1123215_+\|holin	phage holin family protein	M9Q253	Clostridium_phage	2.6e-69	97.1
WP_070956565.1\|1123256_1124285_+	SH3 domain-containing protein	Q0SPG7	Clostridium_phage	1.1e-190	94.7
WP_070956566.1\|1124627_1125266_+	PH domain-containing protein	M9Q2L2	Clostridium_phage	5.3e-98	85.8
WP_070956567.1\|1125435_1125918_+	hypothetical protein	NA	NA	NA	NA
WP_070957292.1\|1126028_1126784_+	DNA adenine methylase	Q0SPG6	Clostridium_phage	3.5e-112	75.3
1126612:1126628	attR	NA	NA	NA	NA
WP_070956568.1\|1126886_1127324_+	DUF4065 domain-containing protein	I6R0L8	Salmonella_phage	9.5e-22	36.6

DBSCAN-SWA_3

1172733 : 1186010

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_070956599.1\|1172733_1173636_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	2.9e-81	49.2
WP_070956600.1\|1173652_1174663_-	lysozyme family protein	A0A1S5SEZ8	Streptococcus_phage	4.3e-126	66.8
WP_070956601.1\|1174659_1176864_-	hypothetical protein	A0A1S5SF30	Streptococcus_phage	1.3e-183	59.7
WP_070956602.1\|1176863_1179311_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	75.9
WP_070956603.1\|1179288_1179687_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	7.3e-45	69.0
WP_070956604.1\|1179803_1180307_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	3.4e-55	60.2
WP_070956605.1\|1180324_1180828_-	antirestriction protein ArdA	NA	NA	NA	NA
WP_070956606.1\|1180785_1181043_-	conjugal transfer protein	NA	NA	NA	NA
WP_070956607.1\|1181097_1181574_-	hypothetical protein	NA	NA	NA	NA
WP_003060793.1\|1181640_1181862_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	2.6e-28	86.3
WP_070956608.1\|1181862_1181997_-	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_070956609.1\|1182009_1183206_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	5.2e-147	62.7
WP_070956610.1\|1183450_1183849_-	conjugal transfer protein	NA	NA	NA	NA
WP_070956611.1\|1183861_1185232_-	cell division protein FtsK	A0A1S5SFB5	Streptococcus_phage	1.3e-170	65.3
WP_070956612.1\|1185284_1185668_-	YdcP family protein	A0A1S5SF96	Streptococcus_phage	5.4e-29	53.9
WP_070956613.1\|1185683_1186010_-	YdcP family protein	A0A1S5SF38	Streptococcus_phage	3.3e-27	56.3

DBSCAN-SWA_4

1420849 : 1456121

Clostridium_phage(56.0%)

terminase,holin,head,portal,tail,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_070956697.1\|1420849_1422322_-	recombinase family protein	A0A1L2BY67	Clostridium_phage	6.9e-48	35.5
WP_070956698.1\|1422726_1423092_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_147570605.1\|1423286_1423490_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_070956700.1\|1423553_1424309_+	Rha family transcriptional regulator	D2IYT0	Enterococcus_phage	3.5e-32	40.2
WP_070956701.1\|1424379_1424574_+	hypothetical protein	NA	NA	NA	NA
WP_070956702.1\|1424560_1424752_-	hypothetical protein	NA	NA	NA	NA
WP_070956703.1\|1424938_1425139_+	hypothetical protein	NA	NA	NA	NA
WP_070956704.1\|1425114_1425294_+	hypothetical protein	M9Q2G4	Clostridium_phage	3.3e-13	66.1
WP_070956705.1\|1425308_1425593_+	BC1881 family protein	NA	NA	NA	NA
WP_003460784.1\|1425589_1425799_-	KTSC domain-containing protein	D2IZW7	Enterococcus_phage	1.9e-12	60.0
WP_172686404.1\|1425892_1426057_+	hypothetical protein	NA	NA	NA	NA
WP_003460788.1\|1426176_1426416_+	hypothetical protein	NA	NA	NA	NA
WP_003453639.1\|1426419_1426608_+	hypothetical protein	NA	NA	NA	NA
WP_070956706.1\|1426625_1427279_+	ERF family protein	A0A0A7RVW0	Clostridium_phage	1.2e-28	41.5
WP_070956707.1\|1427291_1428203_+	DUF1351 domain-containing protein	A0A2H4J082	uncultured_Caudovirales_phage	3.5e-18	26.9
WP_070956708.1\|1428217_1428406_+	hypothetical protein	NA	NA	NA	NA
WP_070956709.1\|1428409_1429135_+	hypothetical protein	A0A1Q1PVU4	Staphylococcus_phage	2.4e-33	63.9
WP_172686405.1\|1429135_1429309_+	hypothetical protein	NA	NA	NA	NA
WP_070956710.1\|1429414_1430227_+	DUF4145 domain-containing protein	NA	NA	NA	NA
WP_070956711.1\|1430497_1430680_+	hypothetical protein	NA	NA	NA	NA
WP_070956712.1\|1430690_1431230_+	hypothetical protein	A0A0A7RVS1	Clostridium_phage	2.9e-12	33.3
WP_070956713.1\|1431726_1433280_+	DUF4935 domain-containing protein	NA	NA	NA	NA
WP_081340033.1\|1433304_1433415_+	hypothetical protein	NA	NA	NA	NA
WP_070956714.1\|1433536_1434040_+	hypothetical protein	NA	NA	NA	NA
WP_070956715.1\|1434226_1434667_+\|terminase	terminase small subunit	A7J290	Streptococcus_phage	6.6e-31	54.5
WP_070956716.1\|1434650_1435910_+\|terminase	PBSX family phage terminase large subunit	A0A0S0KEN9	Bacillus_phage	4.7e-146	61.2
WP_070956717.1\|1435923_1437363_+\|portal	phage portal protein	A0A0A7S074	Clostridium_phage	1.0e-104	42.4
WP_003477324.1\|1437352_1438117_+\|capsid	minor capsid protein	M1PSI8	Streptococcus_phage	7.5e-14	27.5
WP_003477325.1\|1438182_1438359_-	hypothetical protein	NA	NA	NA	NA
WP_164818931.1\|1438477_1438702_-	DUF2188 domain-containing protein	E8ZD70	Streptococcus_phage	2.0e-12	52.1
WP_003477328.1\|1438891_1439497_+	phage scaffolding protein	A0A0A8WEG1	Clostridium_phage	2.7e-22	39.5
WP_003477330.1\|1439513_1440335_+	hypothetical protein	A0A0A7AQF5	Bacillus_phage	3.2e-79	56.4
WP_003477331.1\|1440379_1440682_+\|head,tail	phage head-tail connector protein	H9A0N4	Staphylococcus_phage	9.5e-05	36.7
WP_003477332.1\|1440694_1441009_+	hypothetical protein	NA	NA	NA	NA
WP_003477333.1\|1440998_1441412_+	hypothetical protein	A0A0S2MVE4	Bacillus_phage	8.7e-09	40.7
WP_003477334.1\|1441799_1442327_+	hypothetical protein	NA	NA	NA	NA
WP_003477335.1\|1442341_1442683_+	hypothetical protein	NA	NA	NA	NA
WP_060670769.1\|1442664_1442967_+	hypothetical protein	NA	NA	NA	NA
WP_070956718.1\|1442966_1446530_+\|tail	phage tail tape measure protein	Q0SPL2	Clostridium_phage	1.6e-143	78.8
WP_003477338.1\|1446529_1447225_+	hypothetical protein	Q0SPL3	Clostridium_phage	1.6e-31	36.8
WP_003477339.1\|1447240_1447507_+	hypothetical protein	M9Q1I4	Clostridium_phage	6.1e-40	96.6
WP_070956719.1\|1447573_1447954_+	DUF1617 family protein	M9Q2L1	Clostridium_phage	1.7e-59	92.1
WP_070956720.1\|1447980_1453806_+\|tail	phage tail protein	M9Q2I5	Clostridium_phage	6.6e-102	50.5
WP_003481420.1\|1453819_1454116_+	hypothetical protein	NA	NA	NA	NA
WP_003460274.1\|1454133_1454550_+\|holin	phage holin family protein	M9Q253	Clostridium_phage	4.0e-70	99.3
WP_003460281.1\|1454590_1455007_+	hypothetical protein	M9Q2G0	Clostridium_phage	1.9e-59	91.3
WP_070956721.1\|1455092_1456121_+	SH3 domain-containing protein	Q0SPG7	Clostridium_phage	1.2e-187	93.6

DBSCAN-SWA_5

1576436 : 1638757

Clostridium_phage(48.0%)

integrase,protease,terminase,tRNA,holin,head,portal,tail,capsid

attL 1586943:1586960|attR 1639460:1639478

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_070956779.1\|1576436_1577540_-\|integrase	site-specific integrase	B3GVW7	Streptococcus_phage	3.1e-29	31.6
WP_070957294.1\|1577592_1577805_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_070956780.1\|1578239_1578602_-	helix-turn-helix transcriptional regulator	A0A1L2BY72	Clostridium_phage	2.1e-11	37.1
WP_070956781.1\|1578757_1578952_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_070956782.1\|1579016_1579322_+	histidine kinase	NA	NA	NA	NA
WP_172686407.1\|1579428_1579593_+	hypothetical protein	NA	NA	NA	NA
WP_070956783.1\|1579681_1580473_+	helix-turn-helix domain-containing protein	F0PIG9	Enterococcus_phage	1.7e-16	43.3
WP_155759204.1\|1580490_1580655_+	hypothetical protein	NA	NA	NA	NA
WP_070956784.1\|1580657_1581071_+	hypothetical protein	NA	NA	NA	NA
WP_147570606.1\|1581045_1581807_+	hypothetical protein	NA	NA	NA	NA
WP_070956786.1\|1581799_1582057_+	hypothetical protein	NA	NA	NA	NA
WP_070956787.1\|1582070_1582370_+	hypothetical protein	NA	NA	NA	NA
WP_070956788.1\|1582369_1582585_+	hypothetical protein	NA	NA	NA	NA
WP_070956789.1\|1582601_1582964_+	hypothetical protein	NA	NA	NA	NA
WP_070956790.1\|1582977_1583460_+	hypothetical protein	NA	NA	NA	NA
WP_070956791.1\|1583440_1584115_+	hypothetical protein	A0A2H4J8I2	uncultured_Caudovirales_phage	1.7e-33	42.9
WP_070956792.1\|1584132_1584312_+	hypothetical protein	NA	NA	NA	NA
WP_070956793.1\|1584324_1585101_+	phage antirepressor KilAC domain-containing protein	A0A2D1GQG9	Lysinibacillus_phage	6.6e-42	41.1
WP_172686408.1\|1585213_1585366_+	hypothetical protein	NA	NA	NA	NA
WP_081340035.1\|1585462_1585594_+	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
WP_070956794.1\|1585607_1585985_+	DUF1492 domain-containing protein	A0A0A7RTL7	Clostridium_phage	1.4e-21	45.0
WP_070956795.1\|1586100_1586751_+	hypothetical protein	NA	NA	NA	NA
WP_172686409.1\|1586933_1587092_+	hypothetical protein	NA	NA	NA	NA
1586943:1586960	attL	NA	NA	NA	NA
WP_070956796.1\|1587091_1587736_+\|integrase	tyrosine-type recombinase/integrase	F6K8Q2	Clostridium_phage	2.9e-27	38.8
1586943:1586960	attL	NA	NA	NA	NA
WP_172686410.1\|1588011_1588485_+	Xaa-His dipeptidase	A0A0E3U2Q7	Fusobacterium_phage	7.7e-09	33.1
WP_070956797.1\|1588502_1588808_+	hypothetical protein	NA	NA	NA	NA
WP_155759206.1\|1588788_1588962_+	hypothetical protein	NA	NA	NA	NA
WP_070956798.1\|1588983_1589448_+	hypothetical protein	M9Q2I2	Clostridium_phage	3.1e-71	82.5
WP_081340036.1\|1589528_1589864_+	HNH endonuclease	NA	NA	NA	NA
WP_070956800.1\|1589982_1590447_+\|terminase	P27 family phage terminase small subunit	A0A0A7RUQ4	Clostridium_phage	4.7e-35	54.3
WP_070956801.1\|1590443_1592129_+\|terminase	terminase	A0A0A7RUM0	Clostridium_phage	1.8e-148	53.5
WP_172686411.1\|1592142_1593375_+\|portal	phage portal protein	A0A075KJI8	Lactobacillus_phage	2.0e-72	37.2
WP_070956803.1\|1593349_1593934_+\|head,protease	HK97 family phage prohead protease	A0A1B1P7P1	Bacillus_phage	3.3e-54	56.5
WP_070956804.1\|1593948_1595118_+\|capsid	phage major capsid protein	NA	NA	NA	NA
1594306:1594323	attR	NA	NA	NA	NA
WP_070956805.1\|1595162_1595438_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
1594306:1594323	attR	NA	NA	NA	NA
WP_025647642.1\|1595451_1595778_+\|head	phage head closure protein	NA	NA	NA	NA
WP_025647640.1\|1595770_1596172_+	hypothetical protein	NA	NA	NA	NA
WP_070956806.1\|1596183_1596495_+	hypothetical protein	NA	NA	NA	NA
WP_025647636.1\|1596587_1596920_+	hypothetical protein	NA	NA	NA	NA
WP_070956807.1\|1596981_1597545_+	hypothetical protein	NA	NA	NA	NA
WP_070956808.1\|1597619_1597964_+	hypothetical protein	NA	NA	NA	NA
WP_070956809.1\|1598189_1600817_+\|tail	phage tail tape measure protein	A0A1L2BYA6	Clostridium_phage	1.0e-09	42.7
WP_070956810.1\|1600820_1601519_+\|tail	phage tail family protein	Q8SBP0	Clostridium_phage	7.6e-21	29.7
WP_070956811.1\|1601537_1603547_+\|tail	phage tail protein	I2E8W3	Clostridium_phage	3.7e-121	42.8
WP_070956812.1\|1603559_1605431_+	MBL fold metallo-hydrolase	I2E8W4	Clostridium_phage	1.4e-202	66.5
WP_070957296.1\|1608876_1609149_+	hypothetical protein	F8UBC0	Clostridium_phage	2.4e-39	93.2
WP_070956813.1\|1609234_1609660_+\|holin	phage holin family protein	M9Q253	Clostridium_phage	2.4e-46	66.9
WP_070956814.1\|1609723_1610413_+	N-acetylmuramoyl-L-alanine amidase	A0A2H4JDW4	uncultured_Caudovirales_phage	1.6e-18	40.7
WP_155759207.1\|1610573_1610735_+	hypothetical protein	NA	NA	NA	NA
WP_057232809.1\|1610737_1611073_+	hypothetical protein	NA	NA	NA	NA
WP_070956815.1\|1611077_1612379_+	hypothetical protein	NA	NA	NA	NA
WP_070956816.1\|1612381_1612990_+	hypothetical protein	NA	NA	NA	NA
WP_070956817.1\|1613279_1613801_+	hypothetical protein	NA	NA	NA	NA
WP_060670359.1\|1614541_1615006_+	hypothetical protein	NA	NA	NA	NA
WP_070956818.1\|1615051_1615522_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003469947.1\|1615705_1616098_-	hypothetical protein	NA	NA	NA	NA
WP_070956819.1\|1616457_1617438_+	linear amide C-N hydrolase	A7IWP6	Paramecium_bursaria_Chlorella_virus	2.8e-21	33.5
WP_070956820.1\|1617623_1618967_+\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
WP_070956821.1\|1619421_1621035_+	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
WP_081340038.1\|1621210_1621669_+\|integrase	phage integrase SAM-like domain-containing protein	NA	NA	NA	NA
WP_070956822.1\|1622316_1623726_+	TIR domain-containing protein	NA	NA	NA	NA
WP_070956823.1\|1624367_1624727_+	hypothetical protein	NA	NA	NA	NA
WP_070956824.1\|1625331_1625964_+	hypothetical protein	NA	NA	NA	NA
WP_070956825.1\|1626104_1626371_+	hypothetical protein	NA	NA	NA	NA
WP_003477787.1\|1626373_1626532_+	hypothetical protein	NA	NA	NA	NA
WP_070956826.1\|1626549_1626873_+	hypothetical protein	NA	NA	NA	NA
WP_070956827.1\|1628129_1628717_+	hypothetical protein	NA	NA	NA	NA
WP_003469972.1\|1628830_1629166_+	hypothetical protein	NA	NA	NA	NA
WP_003449375.1\|1629532_1631767_+	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	3.5e-176	44.9
WP_003460458.1\|1632053_1632761_+	pyruvate formate lyase-activating protein	A0A023MHS6	Escherichia_phage	1.3e-07	36.3
WP_070956828.1\|1633023_1635756_+	DNA mismatch repair protein MutS	E3T5Q7	Cafeteria_roenbergensis_virus	1.8e-49	24.8
WP_070956829.1\|1635782_1637807_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	3.7e-60	41.1
WP_003460446.1\|1637824_1638757_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
1639460:1639478	attR	NA	NA	NA	NA

DBSCAN-SWA_6

2048477 : 2061734

Clostridium_phage(22.22%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_070956928.1\|2048477_2049515_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	5.4e-31	36.0
WP_003454568.1\|2049715_2049985_+	ACT domain-containing protein	NA	NA	NA	NA
WP_070956929.1\|2050001_2051354_+	PFL family protein	NA	NA	NA	NA
WP_061415726.1\|2051565_2052069_-	QueT transporter family protein	E7DN70	Pneumococcus_phage	1.1e-13	37.2
WP_003457231.1\|2052393_2053269_-	MBL fold metallo-hydrolase	Q332C0	Clostridium_botulinum_C_phage	1.1e-64	50.2
WP_070956930.1\|2053439_2054762_-	sensor histidine kinase	X5JAC0	Clostridium_phage	1.0e-71	37.6
WP_003465542.1\|2054755_2055466_-	response regulator transcription factor	A0A2R2ZGH8	Clostridioides_phage	2.5e-32	31.8
WP_003465555.1\|2055604_2056618_-	N-acetylmuramoyl-L-alanine amidase	Q8SBN4	Clostridium_phage	1.4e-121	64.2
WP_003455890.1\|2056714_2057002_-	thiamine-binding protein	NA	NA	NA	NA
WP_003456055.1\|2057225_2058239_-	DUF348 domain-containing protein	A0A143FMI2	Bacillus_phage	3.5e-19	52.0
WP_003455941.1\|2058664_2059963_-	uracil permease	Q9KX94	Enterobacteria_phage	3.6e-69	39.3
WP_003456099.1\|2060150_2061734_+	ATP-binding cassette domain-containing protein	A0A1V0SGN0	Hokovirus	8.5e-44	25.6

DBSCAN-SWA_7

2888755 : 2895865

Bacillus_phage(33.33%)

integrase

attL 2892314:2892329|attR 2901598:2901613

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004456771.1\|2888755_2889568_-	ATP-binding protein	A0A0H4TGD5	Bacillus_phage	1.6e-30	31.7
WP_147570607.1\|2889533_2890652_-	helix-turn-helix domain-containing protein	A0A218KCJ2	Bacillus_phage	1.1e-10	39.8
WP_070957185.1\|2890776_2891001_-	excisionase	NA	NA	NA	NA
WP_070957186.1\|2891239_2891575_-	hypothetical protein	Q4Z944	Staphylococcus_phage	3.3e-06	37.6
WP_070957187.1\|2891721_2891931_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_070957188.1\|2892069_2892582_+	helix-turn-helix transcriptional regulator	A0A0A7RTR3	Clostridium_phage	5.4e-16	36.3
2892314:2892329	attL	NA	NA	NA	NA
WP_003470579.1\|2892595_2893051_+	hypothetical protein	A0A0A7RVV2	Clostridium_phage	2.6e-46	60.5
WP_164788612.1\|2893218_2893380_+	hypothetical protein	NA	NA	NA	NA
WP_070957189.1\|2894662_2895865_+\|integrase	site-specific integrase	A0A2R2ZGM9	Clostridioides_phage	1.1e-35	32.0
2901598:2901613	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP013101

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection