CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Prophage number
NZ_CP017752	Cupriavidus sp. USMAHM13 chromosome 2, complete sequence	2 crisprs	csa3,DEDDh	0	1
NZ_CP017751	Cupriavidus sp. USMAHM13 chromosome 1, complete sequence	1 crisprs	WYL,cas3,csa3,DinG,DEDDh,RT	1	3
NZ_CP017753	Cupriavidus sp. USMAHM13 plasmid unnamed1, complete sequence	0 crisprs	NA	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP017752_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017752_1

585336-585430

Orphan

Consensus_repeat	Method
CGCGACCCGTACTCGGATGGCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP017752_1

>merge|NZ_CP017752|1|585336-585430|CRISPRCasFinder
CGCGATCCGTACTCGGAAGGCGCACGCGCCGGCAATCGCGACCCGTACTCGGATGGCGCACGCATCGGCGCCCGTGACCCGTATGCGGAAGGCGC

>NZ_CP017752|1|1|585336-585430|CRISPRCasFinder
CGCGATCCGTACTCGGAAGGCGC	ACGCGCCGGCAATCGCGACCCGTACTCGGATGGCGCACGCATCGGCGCC
CGTGACCCGTATGCGGAAGGCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017752.1\|WP_071017399.1\|582910_583696_-\|glycine-zipper-2TM-domain-containing-protein	unknown	unknown	gnl\|CDD\|183072
NZ_CP017752.1\|WP_071017411.1\|587682_588510_-\|phytanoyl-CoA-dioxygenase	unknown	unknown	gnl\|CDD\|227609
NZ_CP017752.1\|WP_071017420.1\|594913_595237_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017752.1\|WP_071017390.1\|577388_578372_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|223787
NZ_CP017752.1\|WP_071017392.1\|578441_579227_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213260
NZ_CP017752.1\|WP_071017401.1\|583831_584284_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
NZ_CP017752.1\|WP_071017407.1\|585613_586540_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP017752.1\|WP_083384315.1\|589581_590640_+\|DUF58-domain-containing-protein	unknown	unknown	gnl\|CDD\|224635
NZ_CP017752.1\|WP_071017422.1\|595533_596994_-\|DegQ-family-serine-endoprotease	unknown	unknown	gnl\|CDD\|273938
NZ_CP017752.1\|WP_071017413.1\|588659_589577_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|285027
NZ_CP017752.1\|WP_071017409.1\|586815_587640_+\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|131484
NZ_CP017752.1\|WP_071017418.1\|593266_594823_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341046
NZ_CP017752.1\|WP_071017417.1\|592760_593252_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP017752.1\|WP_071017398.1\|581296_582835_+\|acyl-CoA-synthetase	unknown	unknown	gnl\|CDD\|181381
NZ_CP017752.1\|WP_071017403.1\|584460_585030_+\|YggT-family-protein	unknown	unknown	gnl\|CDD\|376765
NZ_CP017752.1\|WP_156811413.1\|576540_577389_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|223673
NZ_CP017752.1\|WP_071017388.1\|575545_576544_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP017752.1\|WP_071017415.1\|590636_592628_+\|DUF3488-domain-containing-transglutaminase-family-protein	unknown	unknown	gnl\|CDD\|378784
NZ_CP017752.1\|WP_071017394.1\|579840_580263_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017752.1\|WP_071017396.1\|580418_581117_+\|dienelactone-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223489

Protein	Function_ID	Function_description	E-value
NZ_CP017752.1\|WP_071017399.1\|582910_583696_-\|glycine-zipper-2TM-domain-containing-protein	gnl\|CDD\|183072	PRK11280, PRK11280, hypothetical protein; Provisional.	2.08304e-11
NZ_CP017752.1\|WP_071017411.1\|587682_588510_-\|phytanoyl-CoA-dioxygenase	gnl\|CDD\|227609	COG5285, COG5285, Protein involved in biosynthesis of mitomycin antibiotics/polyketide fumonisin [Secondary metabolites biosynthesis, transport, and catabolism].	2.16469e-36
NZ_CP017752.1\|WP_071017390.1\|577388_578372_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|223787	COG0715, TauA, ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components [Inorganic ion transport and metabolism].	6.7666e-36
NZ_CP017752.1\|WP_071017392.1\|578441_579227_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213260	cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters. NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	3.42276e-114
NZ_CP017752.1\|WP_071017401.1\|583831_584284_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	3.46733e-11
NZ_CP017752.1\|WP_071017407.1\|585613_586540_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.70786e-55
NZ_CP017752.1\|WP_083384315.1\|589581_590640_+\|DUF58-domain-containing-protein	gnl\|CDD\|224635	COG1721, COG1721, Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) [General function prediction only].	6.92378e-23
NZ_CP017752.1\|WP_071017422.1\|595533_596994_-\|DegQ-family-serine-endoprotease	gnl\|CDD\|273938	TIGR02037, Probable_periplasmic_serine_protease_do/HhoA-like, periplasmic serine protease, Do/DeqQ family. This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures. [Protein fate, Protein folding and stabilization, Protein fate, Degradation of proteins, peptides, and glycopeptides].	0
NZ_CP017752.1\|WP_071017413.1\|588659_589577_+\|AAA-family-ATPase	gnl\|CDD\|285027	pfam07726, AAA_3, ATPase family associated with various cellular activities (AAA). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.	1.65353e-84
NZ_CP017752.1\|WP_071017409.1\|586815_587640_+\|IclR-family-transcriptional-regulator	gnl\|CDD\|131484	TIGR02431, p-hydroxybenzoate_hydroxylase_transcriptional, beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family. Member of this family are IclR-type transcriptional regulators with similar DNA binding sites, able to bind at least three different metabolites related to protocatechuate metabolism. Beta-ketoadipate is the inducer for PcaR, p-hydroxybenzoate for PobR, and protocatechuate for PcaU. [Regulatory functions, DNA interactions].	9.85957e-125
NZ_CP017752.1\|WP_071017418.1\|593266_594823_+\|MFS-transporter	gnl\|CDD\|341046	cd17503, MFS_LmrB_MDR_like, Bacillus subtilis lincomycin resistance protein (LmrB) and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including Bacillus subtilis lincomycin resistance protein LmrB, and several proteins from Escherichia coli such as the putative MDR transporters EmrB, MdtD, and YieQ. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. For example, MMR confers resistance to the epoxide antibiotic methylenomycin. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.36983e-34
NZ_CP017752.1\|WP_071017417.1\|592760_593252_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	1.6862e-16
NZ_CP017752.1\|WP_071017398.1\|581296_582835_+\|acyl-CoA-synthetase	gnl\|CDD\|181381	PRK08316, PRK08316, acyl-CoA synthetase; Validated.	0
NZ_CP017752.1\|WP_071017403.1\|584460_585030_+\|YggT-family-protein	gnl\|CDD\|376765	pfam02325, YGGT, YGGT family. This family consists of a repeat found in conserved hypothetical integral membrane proteins. The function of this region and the proteins which possess it is unknown.	6.69252e-10
NZ_CP017752.1\|WP_156811413.1\|576540_577389_-\|ABC-transporter-permease-subunit	gnl\|CDD\|223673	COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism].	1.35646e-70
NZ_CP017752.1\|WP_071017388.1\|575545_576544_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	2.70314e-116
NZ_CP017752.1\|WP_071017415.1\|590636_592628_+\|DUF3488-domain-containing-transglutaminase-family-protein	gnl\|CDD\|378784	pfam11992, DUF3488, Domain of unknown function (DUF3488). This presumed domain is functionally uncharacterized. This domain is found in bacteria. This domain is typically between 323 to 339 amino acids in length. This domain is found associated with pfam01841. This domain has a conserved PLW sequence motif. This domain contains 6 transmembrane helices.	2.41793e-83
NZ_CP017752.1\|WP_071017396.1\|580418_581117_+\|dienelactone-hydrolase-family-protein	gnl\|CDD\|223489	COG0412, COG0412, Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism].	2.85447e-49

>NZ_CP017752.1|WP_071017403.1|584460_585030_+|YggT-family-protein
MFTEIALFLLDTVFSLFGMALLLRLWMQLTRLPTRNPVSQGVFQVTDWLVRPLRRIIPGLGGFDWATLVGAWLAAVVYLTLALMVSGGNPLDFLPFSLLMAIPSVLKWGVSLVMWVTLLMALLSWVNPHSPITPIIHHLTAPLLRPIQRVVPRLGGFDISPLVLFVIAQILLMMIARLGAGLTGTRFLL
>NZ_CP017752.1|WP_071017401.1|583831_584284_-|MarR-family-transcriptional-regulator
MTRRTTAAPIPLDKRDFEALSDFRYQLRRFLRFSEDAAREEGLTVQQYLLLLHVRGCPGKDWASIGELAERLQAKPHGVVALVNRCEEAGLVRRQVNAGDRRIVEVHLLPAGERSLARLAMLHRVELESLQGTFRVARITAFNDDGAERG
>NZ_CP017752.1|WP_071017399.1|582910_583696_-|glycine-zipper-2TM-domain-containing-protein
MSVPVRSLLSVTLAALAALGLGACAAPYGYGSPGGYGGYAPYGSAGATAYANGYGGSTAGGTYVSQDGYASADGAQAGAYAPPAYPGPQAPAPAYAPAEPAPAYPPAAYPPATYPGAAGQPPAYGQSGQQGSYGAPGYAQGAPAAPVAYGVRYGWVESIEQLPPQPAGTSGAGAVVGGLVGGLLGHQVGGGRGNTVATIGGAVVGALAGNEVEKRASTAPQAFRVRVRTSDNAYLTLTQSDAYRLRNGDRVRIENGVAVPY
>NZ_CP017752.1|WP_071017398.1|581296_582835_+|acyl-CoA-synthetase
MQSEQQRARRNTIPDAIARAVRRDPERIAIRFQERSWSFRALEQASARVAGALAAWGLQPGDRVAAFGKNSDAYLLLWLGCLRAGLVHVPVNYAMTRKEAEYIIGQSGASAVFADPALAERVDGLPCRLHGTLHGGTAHDVLQAAAQGPLAELSPALDDEMPAQILYTSGTTSAPKGAVMTHRALLAEYASAIACCDIRAEDRALAALPLYHSAQMHVFLMPLLLMGGTSLIAESPEAGFCLRTIEAEGLNSFFAPPTVWIALLRHPGFDPARLGTLAKAYYGASIMPVPVLLELQQRLPALGFYNCYGQSEIGPLATVLGPREHRDRPASAGRPVLNVETRIVDETLRDVAPGEMGEIVHRSPQLLTGYWDKPEQTAEAFTGGWFHSGDLGYMDEAGYLYVVDRIKDVINSGGVLVSSREVEECLYTHASVGEVAVIALPHPRWVEAVVACVVRKPGGGVSEDALLEHARASLAAYKVPKRIVFVDDLPRNTAGKLLKRQLRDDYAALFDD
>NZ_CP017752.1|WP_071017396.1|580418_581117_+|dienelactone-hydrolase-family-protein
MPQSRWIRIEADTGSFDAYLSLPPAAKLDGAPGIVLLQEIFGVNEHIRAVADQYAADGYVVLAPDVFWRLAPRVELGYAGADMERALSLRKQVDVGLALQDIGATVRALRQHSGGGKVAALGYCFGGLLSYLSAARGLVDAAVPFYGGGIQNNLQEAAAIEVPVQFHYGALDAHIPPEAVRQVREAVAGKRAEVFVYEQADHGFNCWARASYHQHSAALSHGRALTFLADAL
>NZ_CP017752.1|WP_071017394.1|579840_580263_+|hypothetical-protein
MQGKHTSMRSVATGAALSGGLALCALLLPATGVAAPMVPATSGSITYVCGGVGADEQQALQADAPHYGMSLLFTEGRRGEYLSDVAVKVRRNGKDVAEFQAEGPRCLMKGPQGSYQVSAVYDGVEKHTVLAPGVSRQLNW
>NZ_CP017752.1|WP_071017392.1|578441_579227_-|ABC-transporter-ATP-binding-protein
MIEIEFRKVGKRFVDRQSGALRSAVSHLDIRIRSGEVVSIIGPSGCGKSTLLNMGAGLYLPSEGEVYVGGERVTRPVKKVAFMLQKDLLMPWRTIRANVELGMEIDGVPAAERRRVADELLARCHLKGFEQHYPYQLSGGMRQRAALARTLAVDPQVLLLDEPFSALDAQTKMVLQQDLARMLHQGRKTALFITHDLVEAIALSDRLLVMSERPGTIIEEIVIDLPLRENPLERRKLPQIGPLQGRLMELLKVGRESAALH
>NZ_CP017752.1|WP_071017390.1|577388_578372_-|ABC-transporter-substrate-binding-protein
MSKPLTASLACAAALLATVAGGVQAAPEEVTYLLPAPPNLPAFAPWMIAQQKGYYADENIKVTFVAARGGVDVAKQIGAGNAIIGGAIGDTPIIVRANGVPVKAVAVLGAGALTQLAVHQDEGIRSVKDLKGKTVTVMAYADTTYYALLGTLRKAGLGKEDVPVQAAGPAGVWQLFAAKKASAMAGAPEWVVNAAEAGAKVELLPAQDSFKSMAQAILASDEAIRTRPELVRKLVRATLRGMDDIVKDPKAAAQVYAQAVPTFKGKEATVERIFALYRQNVYAGQKPLGIIDGARLEAVQKFYVSEGIVARATPVNELYTNQFVGGR
>NZ_CP017752.1|WP_156811413.1|576540_577389_-|ABC-transporter-permease-subunit
MDGATTTTSATSAAAPPEPRARLLRSARVRAGLGSVVLLLAFLAAWQWGPGWLGMPEFILPRFSRVVAESLRMWEQESLLRHFGITAFEVIVGFALGSLLGLAVGVVLGLSPTTESVLSPYILALQIAPKVAFAPLFVMWLGYTIYPKILVAILIVFFPVMINVLSAVRTVDPDMVNLVRTLNAGRWQIFRLVEFPSALPALFSGLRIASTLAVIGVTVGELVGGNQGLGFLLVDGEGQGNTAAVFVSIAALTLIGVVAYAAVVWAERRLLHYLPRAAVSTT
>NZ_CP017752.1|WP_071017388.1|575545_576544_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKAAVLVMRTAYGLTLAAALAAGPARADGALPACKPLRLVVPFPAGGPADLLARALGHAMQERHGMAVLVDNKPGANGNIGMDAVRRAAGDGCTLAVVPAGNLTINPTLMPALPYQVARDYRSVALLAGSPNVLAVHPAVKARSVAELVQLARRAGPPLGFASPGVGSGLHLAGVLFAQKAGVTLLHVPYKGTTQALNDVVGGQVPILFGTLPTLAPFLQSGALRALAVTQARRSPAAPQIPSLAEQGITGVEVSSWYALMAPAGTPAPVVDALSREVRAVLALPTVREALQHQGMEPADEADGAPRALDARIRAETAAWAALIRKHGIRAE
>NZ_CP017752.1|WP_071017407.1|585613_586540_-|LysR-family-transcriptional-regulator
MSSANETIQWNDWEAFCSVVEYGTFTAAAEQLECPKSRVSAAVARLEDAIGAKLLERTTRRMRLTDAGSAVYRDVAPLFARLREIRQETLAREERVQGVLRIATPYEFGAQQLGGVICRTLAAYPELDVSVETAQGLVDPIRDGFDIAFVAVDADLPDSGTVARRIYHVERGLFAAPALAATLPQAAVPEQLANLPVLTTPGDTVWEFTYAGERVSVPIHPRMQTFNAELRLQGALAGLGIARLALHYCEAEVAQGRLVRVLPEFTPPPLRVFALLPDRRLQPRKVRAFMEEVESMLAAHEQAGIAIC
>NZ_CP017752.1|WP_071017409.1|586815_587640_+|IclR-family-transcriptional-regulator
MATPATSHPTAEAGAGPAAEKPSDSYVQSFARGLSVIRAFNAEHPAQTLTEIAQASGLTRAGARRILLTLVGLGYVQADGRLFRLTPKILDLGFAYLTSMPFWNLAEPIMETLSQQVHESCSISVLDGTEIVYVLRVPARKIMTINLSIGSRLPAYCSSMGRVLLAGLPEAELDRVLRASDLRARTRNTVTDIDALKQVIADIRARGWAENDQELEEGLVSLAAPIRNRAGQVLAAINISGQANRTSAAEMIQNFLPPLLAASEKISNLVGLRT
>NZ_CP017752.1|WP_071017411.1|587682_588510_-|phytanoyl-CoA-dioxygenase
MTSPQQPHPTAPAAAGGISPSPAELDKLAVDFHQDGYLVLRSFAPEAVCAALEQVARAHLAGAVPPVEYEAELGYPGAPASRDAAGGGTVRRLRQAYGRDEVFRRWAGDPALVRVVEGLLGEPARLTLAHHNCVMTKHPQFGSQTGWHRDTRYWSFTSPELVTVWLALGDEDERNGVLRVIPGSHRAALEPGQLDALEFLVEAHPASQALLQGVVPLSLHRGDVLFFDSRLFHSAGRNASEAVKLSVAFAYHGAGNQPLPGTRSAEFGSIALPPA
>NZ_CP017752.1|WP_071017413.1|588659_589577_+|AAA-family-ATPase
MTARPRITDALGEAQTQLGRIVLGKPRQVRLALACMLARGHLLLEDLPGVGKTTLAHALARTLGLQYRRVQFTSDLLPADLIGVSVFLRDAGEFRFHPGPVFAQVVLADEINRAPPKTQSALLEAMAEGQVTHDGTTHALPSPFFVIATQNPLEQLGTHALPESQLDRFTMRLSLGYPDPAFERVLYLGGADEAAAPAILDATQVRGLQAAAAQVYASPALVDYVLALVQATRGRREFAAGLSPRAGLALLACARAWALLDHRELVLPEDVQAVFTAVAGHRLLPGAARSGQDDVARLLAEVAIP
>NZ_CP017752.1|WP_083384315.1|589581_590640_+|DUF58-domain-containing-protein
MARTRADAATAPRARPTGPALAALRRWTAMRLRRRRAPLDGVVTLDRRHLYILPTRSGAGFAVLLAAMLLTALNYNISLGFALTFVLGGIAMGSMWQAYRNLLDLAVGAVAAEPAFAGDAATFRVRLRNAGTMPRYSVALQAARGPVLADGGEFLAAEADAVLALRLDAPQRGWLALPRLTVSSRFPLALFRVWSHADLPLAALVYPAPETGAPPPPWTAPDTGDESAARSGDDGIDRLRRYRNGDPLHRIAWKHSARTGSWLTRTGGNEDRPACWLAWQDMPASLDEEARLSRLCAWVLAADESVRFGLRLPGVEIPPGSGAAQRRACLEALALWPDGRGAGGAAAAEAVP
>NZ_CP017752.1|WP_071017415.1|590636_592628_+|DUF3488-domain-containing-transglutaminase-family-protein
MKTAAHPLGHDEHGLLLGQLALVLAPQARTLPLAVSLLLMLLMLWRWLLWQQRAPLPSRLALGTVAGLVVLTGAALAWQDGGSVGRELAVALLGAFVVLKLLECRALADATFVTQLCFYLLLSLYLFEQPFWLAVYGTGVAAWMLRNWLWLQHPEARARLAPWPMLARMALLGLPWALLLFLLFPRLEQPLWRLPQAARTATTGLSDTMRPGSVGELIRSAEPAFHATLRGAPLPNAALYWRAMVLWHYDGTAWLPDAARRRTLQPPPPLSAAAAGDAVDYDIALEPSGQRWLLLLDRGRSLEQAGSAAVTVDGEFLAGAPADHRLQYRARSAPPPAAEILDERTARLALELPPGNARSRALARQWQTDLAAPWQRVQAALQLFAGAPFRYTLSPPPLGQQQVDSFLFGTRSGFCEHYAGSFVFLMRAAGVPARVVTGYQGGEYNPIGGHYLVRQSDAHAWAEVWLAGRGWVRVDPTAAVAPDRIDLGAADVLGDGAAGLGGWQRGPAWLRRLHWGLDGMVYAWQRWVLQYDRRQQARLLGHLERLGIGASLMQLLLAGMAVLALLLPLPWWLRRRGTDPVTALYARFCARLGRLGCVRRTGEGPRDFATRAAAQLPAVAPHAQAFIDAYIALRYGTATAQQRAAALAIMRRTLGKLARLRRR
>NZ_CP017752.1|WP_071017417.1|592760_593252_+|MarR-family-transcriptional-regulator
MSSFEARIDRICTTYADAPRELILASRLLLRTSRLLRAHIERALAPFGLDLSQYLVISMLAADAGEPTMPSELGVAIDATRTQMTRLVDGLETRGLVQRHASTQDRRSLDLVLTPAGRRLLEQAMPAVHAAYGEAWEPLGSGGLDKATRALARLHANLEALEP
>NZ_CP017752.1|WP_071017418.1|593266_594823_+|MFS-transporter
MQPLRIGWRWLRLLSHRQRQTLVMMLLALATAVEFLENIMFVFASSHIVGGVDADPRGFALVQGGYAVGGMLMILKQQWLARRFGYRYYMTGALLLFIAGTLAAATSHNLAQLVAARFVQGVGGGSLFTSCRILIVAMFGAADRPRATRIFMIGIFGASALAPALAAELIDRGVWQDVFYGVLPFAVLAAIGAWLLLPDAEQRAPDEGPALGPLLLFGTAVVALQAAMTEARFDIFSHPLRLLLVCLLGLALLASFLWQQWHHAAPVLRLRPLRNPVYLTGLALYFLYYVVSNLSAYLFPVYAEQALKIPLATTGWLNSFAALVSFGGILVYLRVAPRLPDKKPLIVCGLLVMAGAAWWFSVMPPDAGPSALAWGLVGKGLFGVMVVIPVAGLTFRSLADDDFAHGYRSKNLIRQIAGTFASALGAVLLQNRQFAVHTSLTDALGQRPEQVSQWLAQVQETLVARGMDAAHGHQGAVAQLGLLVEQQARLIACEDLYRLVVVLALATAAFVLIQRRLN
>NZ_CP017752.1|WP_071017420.1|594913_595237_-|hypothetical-protein
MQLDFTRAPAGAGTERARRAPHSTPSAPRRRKKAATPPHWERGYRSHYYRNERGDKLGEVRLSERGDLPVVYHWAAGNYSGAEGSLAHARMRVEETVGFGMRQLPLF
>NZ_CP017752.1|WP_071017422.1|595533_596994_-|DegQ-family-serine-endoprotease
MIRQTLARSALGIAALAAIGGGYAYLQKEVITPSYAATTPAIAAAQSVAVATPTDFSGIVQQYGPAVVNISVTARAQRTSAQTQGMDPEDPLFQFFKRFGPQFQMPQNNQPQLVRGLGSGFIISHDGLILTNAHVVDNAQEVTVKLTDRREFKAKVLGSDAQSDIAVIRIDAKDLPTVKLGDASVVRVGEPVLAIGSPYGFENTATAGIVSAKSRSLPDDTYVPFIQTDVAVNPGNSGGPLFNQRGEVIGINSQIYSQTGGYQGLSFAIPINVATKVEQQLVEHGKVTRGRLGLAVQEVNQALANSFGLPKPSGALVTSVEPDSPASKAGLKAGDVIVQFNNDVIDHSGDLPERVADIKPGTDSTVKIIRKGQPMTLTVKVGAAREQNVAQKGGNSDAGGRLGLAVRQLTAEEKRDSGIDAGLVVEDVSGPAARVGIQPGDVILSLNGTPITSADQLRSLVAKSGKQVALLVQRDDARIFIPLDLG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP017752_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017752_2

2402761-2402863

Orphan

Consensus_repeat	Method
GCGCCCTGGCTGTAGGGGTCGAACT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP017752_2

>merge|NZ_CP017752|2|2402761-2402863|CRISPRCasFinder
GCGCCCTGGCTGTAGGGGTCGAACTTGTCGCCGGCCTTGGCACCCTGGCTGTAGGGATCGAACTTCTCGCCAGCCTTGGCACCCTGGCTGTAGGGGTCGAACT

>NZ_CP017752|2|2|2402761-2402863|CRISPRCasFinder
GCGCCCTGGCTGTAGGGGTCGAACT	TGTCGCCGGCCTTGGCACCCTGGCTGTAGGGATCGAACTTCTCGCCAGCCTTG
GCACCCTGGCTGTAGGGGTCGAACT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017752.1\|WP_071020013.1\|2396535_2396907_-\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|235094
NZ_CP017752.1\|WP_071020010.1\|2395338_2396523_-\|DegT/DnrJ/EryC1/StrS-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|223476
NZ_CP017752.1\|WP_071020017.1\|2398970_2399540_-\|HdeD-family-acid-resistance-protein	unknown	unknown	gnl\|CDD\|225786
NZ_CP017752.1\|WP_071022551.1\|2406693_2408067_-\|TolC-family-protein	unknown	unknown	gnl\|CDD\|224455
NZ_CP017752.1\|WP_071020005.1\|2393426_2394371_-\|formyltransferase	unknown	unknown	gnl\|CDD\|235902
NZ_CP017752.1\|WP_071020008.1\|2394358_2395360_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|182669
NZ_CP017752.1\|WP_071020024.1\|2403169_2404093_-\|amino-acid-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270406
NZ_CP017752.1\|WP_071020036.1\|2415109_2416357_+\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|225715
NZ_CP017752.1\|WP_071022562.1\|2413369_2414923_-\|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein	unknown	unknown	gnl\|CDD\|225098
NZ_CP017752.1\|WP_083384517.1\|2399740_2400646_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017752.1\|WP_083384518.1\|2400845_2402552_+\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|185001
NZ_CP017752.1\|WP_071020042.1\|2417063_2419049_+\|FUSC-family-protein	unknown	unknown	gnl\|CDD\|377393
NZ_CP017752.1\|WP_071020027.1\|2404445_2406515_-\|bifunctional-diguanylate-cyclase/phosphodiesterase	unknown	unknown	gnl\|CDD\|236645
NZ_CP017752.1\|WP_071020035.1\|2412148_2413129_-\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|235136
NZ_CP017752.1\|WP_071020001.1\|2391475_2392366_-\|polysaccharide-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|200564
NZ_CP017752.1\|WP_071020032.1\|2409358_2412145_-\|ribosome-associated-ATPase/putative-transporter-RbbA	unknown	unknown	gnl\|CDD\|224054
NZ_CP017752.1\|WP_071020016.1\|2396914_2398660_-\|glycosyltransferase-family-39-protein	unknown	unknown	gnl\|CDD\|224720
NZ_CP017752.1\|WP_071020002.1\|2392377_2393430_-\|bifunctional-UDP-4-keto-pentose/UDP-xylose-synthase	unknown	unknown	gnl\|CDD\|183375
NZ_CP017752.1\|WP_071020039.1\|2416582_2417059_+\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
NZ_CP017752.1\|WP_071020029.1\|2408228_2409356_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|378925

Protein	Function_ID	Function_description	E-value
NZ_CP017752.1\|WP_071020013.1\|2396535_2396907_-\|EamA-family-transporter	gnl\|CDD\|235094	PRK02971, PRK02971, 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; Provisional.	3.70523e-06
NZ_CP017752.1\|WP_071020010.1\|2395338_2396523_-\|DegT/DnrJ/EryC1/StrS-aminotransferase-family-protein	gnl\|CDD\|223476	COG0399, WecE, Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane].	7.12771e-153
NZ_CP017752.1\|WP_071020017.1\|2398970_2399540_-\|HdeD-family-acid-resistance-protein	gnl\|CDD\|225786	COG3247, HdeD, Uncharacterized conserved protein [Function unknown].	2.00564e-25
NZ_CP017752.1\|WP_071022551.1\|2406693_2408067_-\|TolC-family-protein	gnl\|CDD\|224455	COG1538, TolC, Outer membrane protein [Cell envelope biogenesis, outer membrane / Intracellular trafficking and secretion].	4.73973e-60
NZ_CP017752.1\|WP_071020008.1\|2394358_2395360_-\|glycosyltransferase	gnl\|CDD\|182669	PRK10714, PRK10714, undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional.	1.00594e-114
NZ_CP017752.1\|WP_071020024.1\|2403169_2404093_-\|amino-acid-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270406	cd13688, PBP2_GltI_DEBP, Substrate-binding domain of ABC aspartate-glutamate transporter; the type 2 periplasmic binding protein fold. This subfamily represents the periplasmic-binding protein component of ABC transporter specific for carboxylic amino acids, including GtlI from Escherichia coli. The aspartate-glutamate binding domain belongs to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.03881e-97
NZ_CP017752.1\|WP_071020036.1\|2415109_2416357_+\|MgtC/SapB-family-protein	gnl\|CDD\|225715	COG3174, COG3174, Predicted membrane protein [Function unknown].	5.86091e-52
NZ_CP017752.1\|WP_071022562.1\|2413369_2414923_-\|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein	gnl\|CDD\|225098	COG2187, COG2187, Uncharacterized protein conserved in bacteria [Function unknown].	2.41955e-89
NZ_CP017752.1\|WP_071020005.1\|2393426_2394371_-\|formyltransferase	gnl\|CDD\|235902	PRK06988, PRK06988, formyltransferase.	0
NZ_CP017752.1\|WP_083384518.1\|2400845_2402552_+\|HAMP-domain-containing-protein	gnl\|CDD\|185001	PRK15041, PRK15041, methyl-accepting chemotaxis protein.	1.06278e-105
NZ_CP017752.1\|WP_071020042.1\|2417063_2419049_+\|FUSC-family-protein	gnl\|CDD\|377393	pfam04632, FUSC, Fusaric acid resistance protein family. This family includes a conserved region found in two proteins associated with fusaric acid resistance, FusC from Burkholderia cepacia and fdt-2 from Klebsiella oxytoca. These proteins are likely to be membrane transporter proteins.	1.28394e-172
NZ_CP017752.1\|WP_071020027.1\|2404445_2406515_-\|bifunctional-diguanylate-cyclase/phosphodiesterase	gnl\|CDD\|236645	PRK10060, PRK10060, cyclic di-GMP phosphodiesterase.	1.24865e-118
NZ_CP017752.1\|WP_071020035.1\|2412148_2413129_-\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|235136	PRK03598, PRK03598, putative efflux pump membrane fusion protein; Provisional.	9.25909e-29
NZ_CP017752.1\|WP_071020001.1\|2391475_2392366_-\|polysaccharide-deacetylase-family-protein	gnl\|CDD\|200564	cd10939, CE4_ArnD, Catalytic domain of Escherichia coli 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD and other bacterial homologs. This family is represented by Escherichia coli 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD (EC 3.5.1.n3). ArnD plays an important role in the biosynthesis of undecaprenyl phosphate alpha-4-amino-4-deoxy-L-arabinose (alpha-L-Ara4N). It catalyzes the deformylation of 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol to 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol. The ArnD-dependent deformylation likely occurs on the inner leaflet of the inner membrane. This family also includes many uncharacterized bacterial polysaccharide deacetylases. All family members show high sequence homology to the catalytic domain of bacterial PuuE (purine utilization E) allantoinases and Helicobacter pylori peptidoglycan deacetylase (HpPgdA), and are classified within the larger carbohydrate esterase 4 (CE4) superfamily.	2.69778e-143
NZ_CP017752.1\|WP_071020032.1\|2409358_2412145_-\|ribosome-associated-ATPase/putative-transporter-RbbA	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	9.86677e-91
NZ_CP017752.1\|WP_071020016.1\|2396914_2398660_-\|glycosyltransferase-family-39-protein	gnl\|CDD\|224720	COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane].	2.5251e-64
NZ_CP017752.1\|WP_071020002.1\|2392377_2393430_-\|bifunctional-UDP-4-keto-pentose/UDP-xylose-synthase	gnl\|CDD\|183375	PRK11908, PRK11908, bifunctional UDP-4-keto-pentose/UDP-xylose synthase.	0
NZ_CP017752.1\|WP_071020039.1\|2416582_2417059_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	4.06177e-14
NZ_CP017752.1\|WP_071020029.1\|2408228_2409356_-\|ABC-transporter-permease	gnl\|CDD\|378925	pfam12698, ABC2_membrane_3, ABC-2 family transporter protein. This family is related to the ABC-2 membrane transporter family pfam01061.	4.6005e-24

>NZ_CP017752.1|WP_083384518.1|2400845_2402552_+|HAMP-domain-containing-protein
MRDRRIADSHCLTDPYNNAPQAEGVTVKLSSLTIKTKLLLGFGTLAAIAIVICAMSLRALSQTTEAFSAYIHGLDARAEMAVKVRTAVDRRAIAARNLVLVTQQADLDIEKADVAQAHEDVKNNLRRLKEMALSAPARAQELVAEIDRVETRYGPVALDIVSLALAKRNDEAIAKMNNECRPLLAAQVKATEAYAAFTRTRQEETIRQMEADYALQRQLLIGISIAAVALAVIGGLLLTRAITRPIERAVDAARAVAQGELGQRIDVESDDETGRLLRALRDMTARLAQIVIGVRDSSGRITGATGEIATGNVDLSARTEQQAASLEETAASIEELTVTVRQNSENAREASTLAHDAADVAQKGSTAVGRVVDTMQQISASSEKIAEITGIIEGIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRSLAQRSSSAAKEIKELISVSVQQVHAGSTLAGEAGETMGVVTQAVARVNRIIEEIAQASGEQSRGIEQVNQAISQIDHVTQQNATLVSEAASASRAMEEEARRLKEAVAFFRLPVARSGGRLAPAEHGSPLGDHPDYAAA
>NZ_CP017752.1|WP_083384517.1|2399740_2400646_+|hypothetical-protein
MKKKSLHGLPLALAWLYLWAFAPASAQALDGRGAQAAAGGAGEAPAITVPPARAVLCDAPWFRSGARVQMEGDGAMPMSITMTLRDTDQTPQGCRAVLEVMSKSALSALMGPPVVMDQVHEVSIDRHPNETAPDAASEIESQHAVINARGRYARMFGEAAFKGKGVFSYAGMDIREGTTLAGETFESSVALDISPAGSDEVVGSMRALHASIIVGSRRVGKRQVIDTVLGRKSCLPITYDKRTSLGPLMVGDEVIQVEPTVMHITDWYCPTEAFVLRTDIRQLDQLQRIDVTSMTLDSGDN
>NZ_CP017752.1|WP_071020017.1|2398970_2399540_-|HdeD-family-acid-resistance-protein
MLLYYAKLWWVVALRGIFAVLFGLCAFFAPIATLAVLILIFGAYAAADGVVALAMAISGKERDGSDRWILALQGVLGLGIGALTLFNPAVTALSLLLYIAAWTLATGVLQIVAAVRLRKEIPNEWWMILAGLASIALAFLLLWNPVAGALAVLWMIASWATVCGILLIGVAFRLRRAHHDHLHGKPLAA
>NZ_CP017752.1|WP_071020016.1|2396914_2398660_-|glycosyltransferase-family-39-protein
MRSSSTSRYAGLPVAAIALVSLFILLVWFGTLDARHLLRSDEGRYAEIAREMFASGDWVTIRYNDLKYFEKPPFHMWVTALTYTLFGLGDWQARLCVALSGMIGLVASMMASTRWFGARAGLLTGLVLVAAPMWSVAAHFNSLDMTLSGAMACVLAFMLLAQHPDASPAARRGWMWACWLAMGVAILTKGLVGIALPGLVLVLYTLISRDFALWRRIHLFSGIALMLVVTVPWFWLVSERNPEFPQFFFIHEHWQRYTSKVHSRSGPVYYFVPLLIAGFLPWLGLFPRMWQVVRGEGQALRSGARPFRPALLTAIWAIAIFVFFSLSDSKLPGYIVPIFPALGILAGSALEHITERSWRRQMLAMAVICAIGLAASPYVATLNSDNTPNALYRPFAVWVGAAFVALLAGIWLSYRVLRRRGVFASVVTYSVAMFCGFTIALLGHEVMGRKSSGADMVPAIKAVLTDDMPLYGVRMLDHTLPFYLQHTLVMVEAPDELDFGTKQEPQKWVPTLDGFVAKWQDGQHAMAIMGADTYEHLRQRHVTMYKIAQDTRRVVVSNFAPPGQAQAAPAASVEPAASAPQ
>NZ_CP017752.1|WP_071020013.1|2396535_2396907_-|EamA-family-transporter
MSLSTFAFIFTGVLLNACAQLLLKAGVNAVGAITLDRATLFATALRVLTQWPVLAGLTLYVVSVGVWIVGLSRVDVSIAYPMLSLGYVVNALAAWWLFGEMIGPLRVAGILLILAGVFLIARS
>NZ_CP017752.1|WP_071020010.1|2395338_2396523_-|DegT/DnrJ/EryC1/StrS-aminotransferase-family-protein
MSASVSPAEAFLPFVRPSIDEAAIAEVGKVLASGWITSGPKMQAFEEALSALFGGRPVRTFANGSATMEIALRIADIGPGDEVITTPITWVATANVVLTVGARPVFVDIDPRTRNIDLDAVEAAITPRTRAIMPVYLSGLPVDMERLYAIAARHQLRVIEDAAQAIDSRWRGQRIGAFGDLASFSFQANKNITCVEGGCLVMNSPEEALRAERLRLQGVIRTGMDGMDVEEPGGKFNLTDVNAAIGLAQLAHLDAITARRAALAETYFRCAEAAGLRDLGIGLPLPLDPHEATTNWHMFQVVLPVERFAGEHPLGARAAVMEAMREQGVGTGVHYPPVHLFSYYRSLGWREGMLPHAERIGRGIVTLPMFPAMRDADVERVCATLSETCKRLFK
>NZ_CP017752.1|WP_071020008.1|2394358_2395360_-|glycosyltransferase
MQTPLQMSPVEVSVIIPVYNEEDGLQALFDRLYPVLDGLGESYEIIFVNDGSRDRSPQLLAAQFHRRPDVTRVVLFNGNFGQHMAILAGFEHSRGKIVVTLDADLQNPPEEIPRLVASMREGHDYVGTIRRERNDSAFRRIASKAMNRLRERITRIKMTDQGCMLRAYDRNIVDTVNACREVNTFIPALAYTFSANPIEIVVEHEQRHAGESKYSLFQLIRLNFDLVTGFSIVPLQWFSAIGTLLSIASAGLVVLLLARRFLFGAEVQGVFTLLAFNFFLVGIMLFGIGLLGEYIGRIYQEVRNRPRFRIQAVLEAGPEGAARPASTEAPCAQ
>NZ_CP017752.1|WP_071020005.1|2393426_2394371_-|formyltransferase
MRAVVFAYHNVGDRCLRVLHARGVEVALVVTHRDRADENIWFRRVADTAAELGLPCIYGEDPADPALAEAVAAARPDMIFSFYYRAMIPQAVLSLAPRGAFNMHGSLLPKYRGRVPVNWAVLHGENETGATLHAMEAKPDAGYIVGQTAVPILPDDTAAQVFDKVTVAAEQTLWGVLPEMLAGRTPQHPNRLEQGSYFSGRKPEDGRIDWSQPAAAVYNLIRAVAPPYPGAFTDLGGRRFVVAQARRPAPARQASLAAALQGGAPGLHVVQDSIVGLCGDGGLVLVHELQSDGATLAPAAFASLLTASTKEENR
>NZ_CP017752.1|WP_071020002.1|2392377_2393430_-|bifunctional-UDP-4-keto-pentose/UDP-xylose-synthase
MKKVLILGVNGFIGHHLTRRILETTSWEVYGMDMSSDRLGDLVEHPRMHFFEGDITINKEWIEYNIRKCDVVLPLVAIATPATYVRQPLRVFELDFEANLPIVRAAVKYGKHLVFPSTSEVYGMCTDGEFDPESSSLVYGPINKPRWIYACSKQLMDRVIHAYGMEQGLNYTLFRPFNWIGAGLDSIFESKEGSSRVVTQFLGHIVRGEPIKLVDGGEQKRAFADIADGISALMRIIENPNGVASGKIYNIGNPGNIHSVRELAEMMLKMAGDYPEYAEEAKKTQIIETSSGDFYGKGYQDVQHRVPKIDNTMTELGWKPEFNMEQALRRIFEAYRGKVVEARTLVDSAS
>NZ_CP017752.1|WP_071020001.1|2391475_2392366_-|polysaccharide-deacetylase-family-protein
MARIALKVDVDTLRGTREGVPALLNMLEKVRAEATFLYSLGPDHTGWALRRVFRPGFLKKVSRTSVVSNYGLRTLMYGVLLPGPDIGRRGAAQMRAAQAAGHECGIHTWDHVYWQDNVRGRDAAWTRRQMQSAFDRFVDIFGEAPPTHGAAGWQMNDEAFLQIDDWGMAYASDGRGVSPYIPTVGGRPCRHVQMPTTLPTLDELIGVDGLTEDNVHEAVLKLSADGRDHVFTLHTELEGGKLAPVFMRLLQGWRAQGHELVSMATYYRHLDRSTLPQLPVSWGSIPGRSGELIIQP
>NZ_CP017752.1|WP_071020024.1|2403169_2404093_-|amino-acid-ABC-transporter-substrate-binding-protein
MPFFAVPVRAAMFRRLGAFASLATVAAAFAMPAQAQSPVLQKIRDTGTITLGYRESALPFSFADDKGQPAGYAVDLCLRVAEAAKQKLGLPELKVRWLPLTPQNRVPAVVNGLVDLDCAPNTNTLERQKQVAFSVSHYVSTVRLLVRADSGIHSFADLRGKTVVTSAGSTGDRHVRRLKAEYGYRDVYAKDHGESFLLLESGRAQAFVMDDVLLAGLRARAKDPSQYVIVGPALSVEQNALMMSKADPAWKQLVDQTLAKMFAGPDIAALQKRWFQEAIGARGVNLALVPSDQVRAAWKHPSDAVTE
>NZ_CP017752.1|WP_071020027.1|2404445_2406515_-|bifunctional-diguanylate-cyclase/phosphodiesterase
MLASSYDQLLVLFSVLVAMLASYTALDLAGRLTAARGRAAQMWLLAGAVVMGLGIWSMHFVGMLAFRLPIRLGYDLPITLLSLLIAIGASGFALRLVTLPSLPPSRLALGALLMGGAVAGMHYTGMAAMRMRPGIDYEPWWFALSLVIAVAACGAALWIAFRLRHQGRHTHRLRVGAAVLMGLAIAAMHYTGMAAARFPLGTICGAATDGLAGEALALPILVITICVLTMALLTSILDLRMEMRTAVLAASLAAANEELSYLALHDKLTKLPNRALLEDRFEQALRSAARTRSRLAILFIDLDGFKAINDSFGHQIGDQVLAEAAGRIRASAGAGDIVGRLGGDEIVLVSQSDAPEDAGALAARILGSLRDAITVSGHALHISASIGIALYPDNGTDQRTLLRNADAAMYHAKASGRDTCCFFTHSMNADAQARLELAQDLRMALERHELELHYQPKFQAPDNTVCGAEALLRWRHPRRGLLSPDQFLALAEKTGLILPIGTWVLDEACAQLARWHAEGRAQLTMAVNLSATQFCHPALVGTVRAAIERHGLAPQCLTIEITESTAMRDVETSLAILQRLDEMGVRIAIDDFGTGYSSLLYLKRIPASELKIDRGFVRELAQDGEDAAIVSAIIALGQTLNLKIVAEGVETTAQQDFLTRLGCDTLQGYLLGAPVPAVDFPGQAIPAAA
>NZ_CP017752.1|WP_071022551.1|2406693_2408067_-|TolC-family-protein
MAACSTVQVDMPAAPAAPAAFQQVPQAGGSQADLARWWQDWHDPELTRHVEAALRANTDLRVARARVLEARAWAAVADSARYPTLAAQAGAARGFGDLRSPSPVPDRSPDLEAYAGGVSAAWEVDVFGRRASDAEAAAGMALAAEEQLHGVQLAIAADVAQNYLEAQGLQRRLALLDRSLATLGELERYVQARFRAGQALGYDLERVREQVSAREAERPVLQSQIEVRQRRLAVLEGQAAQSAPALGEPGPFHVPPVPSGELPSSVLDRRPDVRASAALVRAQAARLGSAKAELLPRFYLSFVGLDGRIRIDGLPALSGTGGLLGVGVDLPLFNAGRIRSTIAANDARLQAALAEHDKTVLRTLEEVDSAYGVRSGLDQREARLGGTLAIARRNADQSRRLYEAGRRTFEDVLSARLGALQREDELLQAQTGQALATVQLYRALGGGWSPAAGAAAG
>NZ_CP017752.1|WP_071020029.1|2408228_2409356_-|ABC-transporter-permease
MRQWLKNVARLSRKEIFSLFSDATLMILIVFAFTLAVVSVAKGIKAEVSNASVAIVDGDQSALSRHLRDAIQPPYFKPPVDVDRRAIDAELDRGRYIFAIEIPPDFEANVLAGRSPSLQVLVDATAMTQAGLGAAYLQEILTGETLAFLRARNLQAQLPAVAVMRVQFNPNTESYWFTSTMQIVVNITVLSIILVGAAVIREREHGTIEHLLVMPVRASEIAAAKIIANGSVIFLVSLLSLWLVVNLWLRVPLQGSLALFALSTALYLFSVTALGMWLATLAPAMPQFGLLAVPTYAVAYLLSGAATPVQSMPAAMQPVVQFLPTTQFVTLTQAILFRGAGIDIVWPQLLGVTAAGGLFLALALARFRAMLAQQG
>NZ_CP017752.1|WP_071020032.1|2409358_2412145_-|ribosome-associated-ATPase/putative-transporter-RbbA
MAMSGGALPGAIEITGLAHRYGAVQALETVSLTLPGQSTIGLIGPDGVGKSTLLGLIAGVKRIQQGQVSVLGADLRERARREAILPRVAFMPQGLGRNLYPTLSVYENVDFFGRLFGLDGAARAARIRRLLEATGLAPFPDRPAGKLSGGMKQKLGLCCALVHNPDLLILDEPTTGVDPLSRRQFWTLVDELRAEQRGMTVIVATAYMEEAQRFEHLVAMDAGRVLVSDSTAAVLQRAGTRDLEQAYISLLPPARRGDGAGLQIPPRPPVDGEPAIEAEGLTRRFGDFVAVDHVSFRIERSEIFGFLGSNGCGKTTTMKMLTGLLDASSGSARLLGQPIDATDMRTRMRVGYMSQSFSLYEELSVRQNLDLHARLYRMEGEQAQQAVAQALDGFELAPYADERPAALSLGIRQRLQLAAACLHRPEVLILDEPTSGVDPGARDMFWRHLVKLSREARVTIFVSTHFMNEAARCDRISFMHRGRVLAVGTPEALRRQRDAATLEDAFVDYLLEAEGQDAPAATPAAAAAGTKATTGPAGHGLPGGDAAAPAPSALAAPLARIWAFARRESIELARDKLRLAFAILGPVILLLAAAWSVSFDVENVRFAALDRDQSLASRELLEQFAGSRYFVPAGTVRDETEAQQALRAARASLVVEIPPDFGRDLLAGRRPEVAFHIDGSSPFPGATVRTYANAVLLGYVQARARALPVAAPALPMGVETRFVYNEQFRSIYAISPGIVMLALILIPTMLTALGVVREKEMGSITNLYASPAGVGEYLLGKQLPYAGLAMVAYLALVALTITVLGVPLKGSFLALSLGALLFILAATSLGLLVSTFVRSQVAAIFGTAILCLIPSVNFSGLLYPVSTLTGSGYWVGLGFPSSWFQLVSLGSFTKGLGADSFGAMYLALLGFALAYLAGARCLLRKQEA
>NZ_CP017752.1|WP_071020035.1|2412148_2413129_-|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit
MKNRFRWALLGLLVILLAGAGFWWETAHRTRWPADIAYANGRLEMARVDVAVKYGGRVVELPVHEGDVLAAGALVARQDDSELRAQLAAANAARARAADAMLRARAETDGRAARQRLARLEWSETVKLFDEGQVSAVERDRRRLALEGEQAGVDGAHAALGEARAAEAEAEAQIARLQAVLDETAVRAPVAGRVEYRVVEVGTVLPAGGRVASMLNPDDIYFTIFLPGPQAGRLAIGAAARILLDAFPGEAIPARIGYVASEAQFTPKYVETEGERAKLMYRVKLQLPVEVARRLAPRLKAGMTGAGYVRLDAARSWPPALAVRGE
>NZ_CP017752.1|WP_071022562.1|2413369_2414923_-|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein
MDDGALTRALMHGAAYPHAAPGVRCIETHLSRVFLAGEYAYKVRKPVRFDFVDFSTLAARRADCEEELRLNRRLAGALYLDVVPIAAVAGGAGGHEDREADGNTPVRLGGSGPALDYAVRMRRFAQHDLLAARVQAGNVDGAMMDALGRRLADFHADAPRCGSTDATDYGTPARVAATLEECLQGVARLADADGAEAIQCLGRAMRAEALRLAPAMAARRRSGHVRECHGDLHLGNVVVVDGEALPFDCLEFNAGLRWIDSISDTAFLYMDLIHHGRRDLAYRFLNAYLERGGDYAGLGLLPFYAALRALVRARVGLERRQQCAAAGADAAPAAGWRALLELAETLLSRRRGAILLMHGLSGSGKSTVAARLAERGGMVRVRADVERKRPGAPPAGGWYAPAAGAATYRRLLAACRLGACAGFPMIADATFLARAHRECFAAQAARLRLPFVIVHCEATVDTLRARISARAQARNDPSDADLEVLGRQLREQEPLCAAELRATTSASDADMLAARFA
>NZ_CP017752.1|WP_071020036.1|2415109_2416357_+|MgtC/SapB-family-protein
MEHDYVAFSVALGIGLAIGLERERSNAGGDEQVPAGLRTFTVASLAGAVAARLPGPLVLPAVLLATGALACLAYHRTSDRDPGMTTELALLCVVLLGALATSEATLAAGAATVVLLLLHGKAWLHHFARQILSEQELRDALVLAAAALVVWPLLPDRYLGPFKAWNPHTLWLIAVLVMLMGAAGHIAVRWLGSQLGLPMAGLFGGFVSSSATIASMAALARKEPDKAQAAVAAALLSTVSTFVQMILLLAATSLATLRQLAIPLAAGLAVIAAFGGLWAWRSTHAEQAPEESPQGRAFDWRVAAGFALMTAFLLWLAAAAQAWLGATALVAVAAVAGFADAHAATASIGAQVAAGRLPVGSAMWPVLAAFSTNTLTKIGLATAAGGYRFALQVGAGLVAAAGATWLGTLAALSLS
>NZ_CP017752.1|WP_071020039.1|2416582_2417059_+|winged-helix-turn-helix-transcriptional-regulator
MNSIDALRFAFTGQLMLAGRQWRQISQAAVTSYGISAAAAGPLLFIRRLGGGVRQVTLADYVGLEGASLVRLLDQLSAAGLVRREVDASDRRANALWLTEAGEELAAKIEVDLKRIRSQVFAHIPAQDLEGALRVLDALARAADSVVVPQSPAPSQEA
>NZ_CP017752.1|WP_071020042.1|2417063_2419049_+|FUSC-family-protein
MGSTWPSARDWIFSTKAFVASMLALFIALYIGLPRPYWAMATVYVVAHPLTGATRSKSMYRVLGTLLGAAASVALVPSLVNTPPLLMAAVAVWVAVLLYVALLDRSPRSYLFMLAAYTLPMVALPAVDHPGGVFDLAIARSEEICLGIICASVVGAVVFPAKVSNVLRDRLAQWMGDAAQWAGDMLSLRDAGAAVSLHQSRHRMAADILALDQLISQLSYDTETAARIRDAKELRGRMTMLLPVLASLASLVETMQRDEAGVPDQLAARMTAVSAWIRGEAAAPPALEENTPPALATAVASTAYERLRELTALWQDCVALQRRLGEAAPAGDWQPVFRRWNVGAARHYDHGMLLFSTGTTALGIFCMGMVWILSGWADGASAVALGAVSCCFFAALDEPAPMIRSFFIWNVVCVLLAMVYLFMILPRAHDFEMLVAMFAIPYLLFGVMIAQPRLALIAVPLAMVTATDIGLQGSYNADFQTFFNTNVAGVAGILFALVWTLLVRPFGTAAAARRLVRASWGDIARNATGRAPHEHDHLRARMLDRLAQLVPRLAASENERSTDGFTEVRVELSTLALQRELPALPEASQHAVRRVLQSVAGYYRDRLEAKADAPPEALQRRLMRAMQGVAERADQASRTAMSALVEMEVALFSTSPVNGKQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1160910 : 1181071

Escherichia_phage(23.08%)

tail

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071018144.1\|1160910_1162863_-	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	1.3e-06	27.0
WP_071018145.1\|1163163_1163526_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_156811428.1\|1163506_1163740_-	hypothetical protein	NA	NA	NA	NA
WP_071018147.1\|1163809_1163995_-	hypothetical protein	NA	NA	NA	NA
WP_071022133.1\|1164146_1164854_-	helix-turn-helix transcriptional regulator	G9L676	Escherichia_phage	8.7e-25	34.8
WP_156811429.1\|1165250_1165562_+	hypothetical protein	NA	NA	NA	NA
WP_071018150.1\|1165634_1166582_+	hypothetical protein	V5URT9	Shigella_phage	7.1e-46	58.9
WP_071018152.1\|1166578_1167961_+	replicative DNA helicase	A0A077SK18	Escherichia_phage	1.3e-80	43.0
WP_083384380.1\|1168729_1169269_+	hypothetical protein	A0A0M3LQB6	Mannheimia_phage	1.4e-06	31.5
WP_071018157.1\|1169343_1170552_+	hypothetical protein	A0A0S0MV10	Pseudomonas_phage	3.3e-32	31.4
WP_071018159.1\|1170625_1171042_+	hypothetical protein	NA	NA	NA	NA
WP_071018161.1\|1171053_1171386_+	hypothetical protein	NA	NA	NA	NA
WP_071018163.1\|1171388_1172744_+	hypothetical protein	A0A2H4J9A1	uncultured_Caudovirales_phage	9.5e-12	54.2
WP_071018164.1\|1172747_1173371_+	hypothetical protein	Q7Y3Z8	Yersinia_phage	9.7e-20	37.9
WP_071018166.1\|1173367_1173922_+	hypothetical protein	NA	NA	NA	NA
WP_156811430.1\|1173918_1174320_+	hypothetical protein	NA	NA	NA	NA
WP_083384382.1\|1174330_1177522_+	hypothetical protein	A0A1B1IRL4	uncultured_Mediterranean_phage	3.5e-65	26.2
WP_083384383.1\|1177548_1178205_+\|tail	phage tail protein	D5LGZ0	Escherichia_phage	1.8e-32	50.0
WP_071018173.1\|1178227_1178827_+	hypothetical protein	F5B3N7	Synechococcus_phage	8.5e-05	45.0
WP_071018175.1\|1178904_1179108_+	hypothetical protein	NA	NA	NA	NA
WP_071018177.1\|1179109_1179571_+	lysozyme	A0A0U4JP67	Pseudomonas_phage	1.3e-42	65.4
WP_071018180.1\|1179558_1179930_+	hypothetical protein	NA	NA	NA	NA
WP_071018181.1\|1180149_1180446_-	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_071018183.1\|1180456_1181071_-	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	6.6e-21	35.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP017751

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP017751_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017751_1

772393-772525

Orphan

Consensus_repeat	Method
GTCGGCTCCCCCGCAGGGGGAGTCGAAACAGGCCGTTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP017751_1

>merge|NZ_CP017751|1|772393-772525|CRISPRCasFinder
GTCGGCTCCCCCGCAGGGGGAGTCGAAACAGGCCGTTGTCACACTGACCGATACCACTCGAATCCACGCGCAAAAGCCTTGCGTCACGAAAGCGAGTCGGCTCCCCCGCAGGGGGAGTCGAAACCGGCCGTTG

>NZ_CP017751|1|1|772393-772525|CRISPRCasFinder
GTCGGCTCCCCCGCAGGGGGAGTCGAAACAGGCCGTTG	TCACACTGACCGATACCACTCGAATCCACGCGCAAAAGCCTTGCGTCACGAAAGCGA
GTCGGCTCCCCCGCAGGGGGAGTCGAAACCGGCCGTTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017751.1\|WP_071010766.1\|762620_763622_+\|pyrimidine-5'-nucleotidase	unknown	unknown	gnl\|CDD\|319791
NZ_CP017751.1\|WP_071010778.1\|776976_777786_-\|polyphosphate-kinase-2-family-protein	unknown	unknown	gnl\|CDD\|274737
NZ_CP017751.1\|WP_071010765.1\|761642_762560_+\|acetylglutamate-kinase	unknown	unknown	gnl\|CDD\|234869
NZ_CP017751.1\|WP_071010768.1\|764618_765791_+\|homoserine-O-acetyltransferase	unknown	unknown	gnl\|CDD\|234678
NZ_CP017751.1\|WP_071010781.1\|779661_780537_-\|lysophospholipid-acyltransferase-family-protein	unknown	unknown	gnl\|CDD\|236348
NZ_CP017751.1\|WP_071010779.1\|777849_778716_-\|diaminopimelate-epimerase	unknown	unknown	gnl\|CDD\|234768
NZ_CP017751.1\|WP_071010783.1\|782227_783172_+\|3-deoxy-D-manno-oct-2-ulosonic-acid-(Kdo)-hydroxylase	unknown	unknown	gnl\|CDD\|371337
NZ_CP017751.1\|WP_071010773.1\|769428_770685_-\|muropeptide-transporter	unknown	unknown	gnl\|CDD\|183369
NZ_CP017751.1\|WP_071010775.1\|772701_773649_-\|N-acetyl-gamma-glutamyl-phosphate-reductase	unknown	unknown	gnl\|CDD\|237004
NZ_CP017751.1\|WP_083384194.1\|767564_768422_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP017751.1\|WP_071010782.1\|780789_781953_+\|methionine-adenosyltransferase	unknown	unknown	gnl\|CDD\|235374
NZ_CP017751.1\|WP_071010777.1\|774582_775284_+\|orotate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|234771
NZ_CP017751.1\|WP_071010770.1\|766377_767370_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP017751.1\|WP_071010774.1\|770847_771804_+\|M48-family-metallopeptidase	unknown	unknown	gnl\|CDD\|320690
NZ_CP017751.1\|WP_071010769.1\|765787_766399_+\|methionine-biosynthesis-protein-MetW	unknown	unknown	gnl\|CDD\|273958
NZ_CP017751.1\|WP_071010772.1\|768545_769397_+\|thioesterase-family-protein	unknown	unknown	gnl\|CDD\|379298
NZ_CP017751.1\|WP_071010776.1\|773776_774553_-\|exodeoxyribonuclease-III	unknown	unknown	gnl\|CDD\|197336
NZ_CP017751.1\|WP_071010767.1\|763608_764277_+\|nucleoid-occlusion-factor-SlmA	unknown	unknown	gnl\|CDD\|181894
NZ_CP017751.1\|WP_071010780.1\|778771_779665_-\|lauroyl-acyltransferase	unknown	unknown	gnl\|CDD\|180770
NZ_CP017751.1\|WP_083383917.1\|775523_776939_+\|patatin-like-phospholipase-family-protein	unknown	unknown	gnl\|CDD\|132848

Protein	Function_ID	Function_description	E-value
NZ_CP017751.1\|WP_071010766.1\|762620_763622_+\|pyrimidine-5'-nucleotidase	gnl\|CDD\|319791	cd02604, HAD_5NT, haloacid dehalogenase (HAD)-like 5'-nucleotidases similar to Saccharomyces cerevisiae Phm8p and Sdt1p. This family includes Saccharomyces cerevisiae Phm8p (phosphate metabolism protein 8) and Sdt1p (Suppressor of disruption of TFIIS). Phm8p participates in the ribose salvage pathway, it catalyzes the dephosphorylation of nucleotide monophosphates to nucleosides, its preferred substrates are nucleotide monophosphates AMP, GMP, CMP, and UMP. Phm8p is also a lysophosphatidic acid phosphatase, dephosphorylating lysophosphatidic acids (LPAs) to monoacylglycerol in response to phosphate starvation. Sdt1p is a pyrimidine and pyridine-specific 5'-nucleotidase; it is an NMN/NaMN 5'-nucleotidases involved in the production of nicotinamide riboside and nicotinic acid riboside, and is a pyrimidine 5'-nucleotidase with high specificity for UMP and CMP. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	7.55353e-46
NZ_CP017751.1\|WP_071010778.1\|776976_777786_-\|polyphosphate-kinase-2-family-protein	gnl\|CDD\|274737	TIGR03709, PPK2_rel_1, polyphosphate:nucleotide phosphotransferase, PPK2 family. Members of this protein family belong to the polyphosphate kinase 2 (PPK2) family, which is not related in sequence to PPK1. While PPK1 tends to act in the biosynthesis of polyphosphate, or poly(P), members of the PPK2 family tend to use the terminal phosphate of poly(P) to regenerate ATP or GTP from the corresponding nucleoside diphosphate, or ADP from AMP as is the case with polyphosphate:AMP phosphotransferase (PAP). Members of this protein family most likely transfer the terminal phosphate between poly(P) and some nucleotide, but it is not clear which. [Central intermediary metabolism, Phosphorus compounds].	5.46415e-156
NZ_CP017751.1\|WP_071010765.1\|761642_762560_+\|acetylglutamate-kinase	gnl\|CDD\|234869	PRK00942, PRK00942, acetylglutamate kinase; Provisional.	3.26712e-160
NZ_CP017751.1\|WP_071010768.1\|764618_765791_+\|homoserine-O-acetyltransferase	gnl\|CDD\|234678	PRK00175, metX, homoserine O-acetyltransferase; Provisional.	0
NZ_CP017751.1\|WP_071010781.1\|779661_780537_-\|lysophospholipid-acyltransferase-family-protein	gnl\|CDD\|236348	PRK08905, PRK08905, lysophospholipid acyltransferase family protein.	4.44541e-154
NZ_CP017751.1\|WP_071010779.1\|777849_778716_-\|diaminopimelate-epimerase	gnl\|CDD\|234768	PRK00450, dapF, diaminopimelate epimerase; Provisional.	1.28441e-149
NZ_CP017751.1\|WP_071010783.1\|782227_783172_+\|3-deoxy-D-manno-oct-2-ulosonic-acid-(Kdo)-hydroxylase	gnl\|CDD\|371337	pfam11004, Kdo_hydroxy, 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase. This is a family of 3-deoxy-D-manno-oct-2-ulosonic acid 3-hydroxylases, which catalyze the conversion of 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) to D-glycero-D-talo-oct-2-ulosonic acid (Ko). It contains a potential iron-binding motif, HXDX(n)H (n>40). Hydroxylation activity is iron-dependent.	5.56683e-147
NZ_CP017751.1\|WP_071010773.1\|769428_770685_-\|muropeptide-transporter	gnl\|CDD\|183369	PRK11902, ampG, muropeptide transporter; Reviewed.	0
NZ_CP017751.1\|WP_071010775.1\|772701_773649_-\|N-acetyl-gamma-glutamyl-phosphate-reductase	gnl\|CDD\|237004	PRK11863, PRK11863, N-acetyl-gamma-glutamyl-phosphate reductase; Provisional.	0
NZ_CP017751.1\|WP_083384194.1\|767564_768422_+\|DMT-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	2.23493e-12
NZ_CP017751.1\|WP_071010782.1\|780789_781953_+\|methionine-adenosyltransferase	gnl\|CDD\|235374	PRK05250, PRK05250, S-adenosylmethionine synthetase; Validated.	0
NZ_CP017751.1\|WP_071010777.1\|774582_775284_+\|orotate-phosphoribosyltransferase	gnl\|CDD\|234771	PRK00455, pyrE, orotate phosphoribosyltransferase; Validated.	4.08188e-77
NZ_CP017751.1\|WP_071010770.1\|766377_767370_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.02186e-75
NZ_CP017751.1\|WP_071010774.1\|770847_771804_+\|M48-family-metallopeptidase	gnl\|CDD\|320690	cd07331, M48C_Oma1_like, Peptidase M48C, integral membrane endopeptidase. This subfamily contains peptidase M48C Oma1 (also called mitochondrial metalloendopeptidase OMA1) protease homologs that are mostly uncharacterized. Oma1 is part of the quality control system in the inner membrane of mitochondria, with its catalytic site facing the matrix space. It cleaves and thereby promotes the turnover of mistranslated or misfolded membrane proteins. Oma1 can cleave the misfolded multi-pass membrane protein Oxa1, thus exerting a function similar to the ATP-dependent m-AAA protease for quality control of inner membrane proteins; it cleaves a misfolded polytopic membrane protein at multiple sites. It has been proposed that in the absence of m-AAA protease, proteolysis of Oxa1 is mediated by Oma1 in an ATP-independent manner. Oma1 is part of highly conserved mitochondrial metallopeptidases, with homologs present in higher eukaryotes, eubacteria and archaebacteria, all containing the zinc binding motif (HEXXH). It forms a high molecular mass complex in the inner membrane, possibly a homo-hexamer.	4.98854e-77
NZ_CP017751.1\|WP_071010769.1\|765787_766399_+\|methionine-biosynthesis-protein-MetW	gnl\|CDD\|273958	TIGR02081, conserved_hypothetical_protein, methionine biosynthesis protein MetW. This protein is found alongside MetX, of the enzyme that acylates homoserine as a first step toward methionine biosynthesis, in many species. It appears to act in methionine biosynthesis but is not fully characterized. [Amino acid biosynthesis, Aspartate family].	1.05424e-103
NZ_CP017751.1\|WP_071010772.1\|768545_769397_+\|thioesterase-family-protein	gnl\|CDD\|379298	pfam13622, 4HBT_3, Thioesterase-like superfamily. This family contains a wide variety of enzymes, principally thioesterases. These enzymes are part of the Hotdog fold superfamily.	2.3547e-51
NZ_CP017751.1\|WP_071010776.1\|773776_774553_-\|exodeoxyribonuclease-III	gnl\|CDD\|197336	cd10281, Nape_like_AP-endo, Neisseria meningitides Nape-like subfamily of the ExoIII family purinic/apyrimidinic (AP) endonucleases. This subfamily includes Neisseria meningitides Nape and related proteins. These are Escherichia coli exonuclease III (ExoIII)-like AP endonucleases and belong to the large EEP (exonuclease/endonuclease/phosphatase) superfamily that contains functionally diverse enzymes that share a common catalytic mechanism of cleaving phosphodiester bonds. AP endonucleases participate in the DNA base excision repair (BER) pathway. AP sites are one of the most common lesions in cellular DNA. During BER the damaged DNA is first recognized by DNA glycosylase. AP endonucleases then catalyze the hydrolytic cleavage of the phosphodiester bond 5' to the AP site, and this is followed by the coordinated actions of DNA polymerase, deoxyribose phosphatase, and DNA ligase. If left unrepaired, AP sites block DNA replication, and have both mutagenic and cytotoxic effects. AP endonucleases can carry out a variety of excision and incision reactions on DNA, including 3'-5' exonuclease, 3'-deoxyribose phosphodiesterase, 3'-phosphatase, and occasionally, nonspecific DNase activities. Different AP endonuclease enzymes catalyze the different reactions with different efficiences. Many organisms have two AP endonucleases, usually one is the dominant AP endonuclease, the other has weak AP endonuclease activity; for example, Neisseria meningitides Nape and NExo. Nape, found in this subfamily, is the dominant AP endonuclease. It exhibits strong AP endonuclease activity, and also exhibits 3'-5'exonuclease and 3'-deoxyribose phosphodiesterase activities.	4.34375e-147
NZ_CP017751.1\|WP_071010767.1\|763608_764277_+\|nucleoid-occlusion-factor-SlmA	gnl\|CDD\|181894	PRK09480, slmA, division inhibitor protein; Provisional.	9.61095e-124
NZ_CP017751.1\|WP_071010780.1\|778771_779665_-\|lauroyl-acyltransferase	gnl\|CDD\|180770	PRK06946, PRK06946, lipid A biosynthesis lauroyl acyltransferase; Provisional.	0
NZ_CP017751.1\|WP_083383917.1\|775523_776939_+\|patatin-like-phospholipase-family-protein	gnl\|CDD\|132848	cd07209, Pat_hypo_Ecoli_Z1214_like, Hypothetical patatin similar to Z1214 protein of Escherichia coli. Patatin-like phospholipase similar to Z1214 protein of Escherichia coli. This family predominantly consists of bacterial patatin glycoproteins and some representatives from eukaryotes and archaea. The patatin protein accounts for up to 40% of the total soluble protein in potato tubers. Patatin is a storage protein, but it also has the enzymatic activity of a lipid acyl hydrolase, catalyzing the cleavage of fatty acids from membrane lipids. Members of this family have also been found in vertebrates.	4.28025e-49

>NZ_CP017751.1|WP_071010774.1|770847_771804_+|M48-family-metallopeptidase
MSRRQCVRQPAKAMPGRPLCAALGLALVLLPLPLLAQEDGIRLEDRNASIRKIVPLEDIERQAAQEYEQIKQEAVAQRTLMPDNNPQLIRLRAIARRLLPETVRWNERARQWNWEVNLINTRQVNAFCMPGGKIAFYAGLLDRLKLTDDEVAMAMGHEIAHALREHARERAAQSEITNLGANVISQLFGFGNLGNMALGTGAHLLTLRFSRADETEADLVGMDIAARAGYDPRSSVSLWQKMGTVTQSQAGAEFLSTHPSGRSRIAELEKHMPEVLPLYVQARNMTMSELPPYQANMKNLGDAPVDSGDEDKQRPLKK
>NZ_CP017751.1|WP_071010773.1|769428_770685_-|muropeptide-transporter
MTFHDYLDIFRNRRIGAMLALGFASGLPLALTSGTLQAWMTVEGLDIKTIGFFSLVGQAYIFKFLWAPLMDRYTPPRLGRRRGWLLLTQLGLAAAIAGMAFCPPREALWALAALAALVAFLSASQDIVFDAYSTDVLQPAERGVGAAVKVLGYRLAMLVSGGLALWLADRVLGWPQMYLLMAALMAACVLSLLWAPEPDAPARAPRSLEEAVLGPLRDFFSRPGAWWLLLLIVLYKLGDAFAGALSTTFLIRGVGFSAGEVGIVNKTLGLAATIVGALFGGTLMVRLGLYRSLLLFGVLQAVSNLGYWMLAVTPQHLWTMGAAIGVENLCGGMGTAAFVALLMALCNRSFSATQYALLSALASIGRVYVGPSSGYLVEAWGWAPFYLGTVAIAIPGVLLLRAMRGTIHRYEAEARAGN
>NZ_CP017751.1|WP_071010772.1|768545_769397_+|thioesterase-family-protein
MSSVSAVSADAAGTLAPHPFDDALALEPAGPDRFLGRTTPAYWNMIGPFGGITAATLLQAVLQHPQRLGDPIALTVNFAGPIAEGPFEIEARPSRTNRSTQHWSLELRQQGVVATTASAVFAVRRETWGCGEAVRPEAPPPEQVPAAGGFAPVRWLKAYDMRPLRGAKPSAEAGTEHPDSLTQFWLRDAPARTPDFAAVASWCDTFYPRIFLKRAGFVPAGTVSLTTYFHADAATLAALGDSHVLASARAQVFRQGYFDQSAQIWSAAGELLATSHQIVYYKE
>NZ_CP017751.1|WP_083384194.1|767564_768422_+|DMT-family-transporter
MVAAMALSGTIGAFVVMSGQPPIDVVWFRCLLGGLALLGALALQRGWRPMDTRQWSWLALGGIALILNWICLFSAYRYSGISIATVVYHTQPFFLLWLVALFQRERVGAGRLPWLLLAFAGVVLITGLEHGGSGTPGRLLAGVALSLVAALLYAVTTFATRRLQGLPPAQIAGLQMLLGVPLLLPLAHPAPGSYGAQAWGALLALGLLHTGVMYTWLYAAFQRLGVLSIATLSFIYPLVAIAIDVLVFRVVLSPAQLAGMALVLLAVVANQRGWQLPGGRQAAGR
>NZ_CP017751.1|WP_071010770.1|766377_767370_-|LysR-family-transcriptional-regulator
MPMPSLNAMAVFARVVDAGSFSAAARQLGMTPSAASRHVSRLEAALGTALLQRTTRAVALTEPGRAVYAACTRMLAGAREVEALAGAQPGEPRGLLRVSAPVSFGQAWLAPRLPALLARHAGLELQLSLTDRLVDLVEEGVDVAVRIARDLAPGLVARPLCAVRYRLVAAPAFLARHGVPGTPAALPALPCLYLGYGAFGEQWTLRREDRATEGETAEAGKAAGAESDSNATAEMAETVTVRVPPRVTVNNSAAIVAMAAAGAGIGLVPDFAAAQGLADGSLVSVLDDWRVLEPYAGTAYAVYTPTRHLAPKVRAFIDHLAAPAQAEQTR
>NZ_CP017751.1|WP_071010769.1|765787_766399_+|methionine-biosynthesis-protein-MetW
MNAAANPNILALRPDFRAIARWVEPNSTVLDLGCGDGSLLRVLQDELSVQAYGVEIRDEGVLSCAQKGVHVIQQDLEGGLKLFEDKSFDTVILSQTLQTIHNTAQVLRDTLRVGRECIVSFPNFGYWPHRLSVFRGSMPVSESLPYQWYDTPNVRVLTIKDFEALAPKVGLRVLDRVVMHEGVTVNWAANWRGSLAVYRVCSA
>NZ_CP017751.1|WP_071010768.1|764618_765791_+|homoserine-O-acetyltransferase
MTDVAPPPALRDLPPDSVGIVAPQRMHFPEPLKLRNGSSIAGYDLMVETYGTLNAERSNAVLVCHALNASHHVAGIYADDPRDVGWWDNMVGPGKPLDTDRFFVIGVNNLGSCFGSTGPMSPNPATGLPYGAAFPVVTVEDWVNAQARVADAFGIRQFAAVMGGSLGGMQAVAWSLMYPERLRHCIVVASTPKLSAQNIAFNEVARSAILSDPDFHGGNYYAHGVKPKRGLRVARMIGHITYLSDEDMAEKFGRELKTEDIRFSFDVEFQVESYLRYQGDKFAEYFDANTYLLITRALDYFDPALAFGGNLTRAMAQTQASFLVASFTTDWRFAPNRSREIVKALLDNKRPVTYAEIDAPHGHDAFLLDDARYHNLMRAYYERVAEEIGA
>NZ_CP017751.1|WP_071010767.1|763608_764277_+|nucleoid-occlusion-factor-SlmA
MMHSNGHTSGPAPAAPAGAVQDGGDAAAPARKRPRPGERRIQILQTLAGMLEHPRGEKITTAALAAKLGVSEAALYRHFASKAQMFEGLIGFIEQSVFGLINQITTQEEHGLRQAHAIVRMLLSFAEKNPGMTRVLTGEALVGEHERLQERINQMIDRIEASLRQCLKVAVSQGAFPPDADVSMRAALIVSAVQGQWHRYAKSGFRKLPGEHAEAQLRVLLG
>NZ_CP017751.1|WP_071010766.1|762620_763622_+|pyrimidine-5'-nucleotidase
MSYPYPTRTHGTRRGRLRRAAGNTAGPTVWLFDLDNTLHDASHAIFPAINRQMTAYVARVLGCDEARASEVRVAYWQRYGATLLGMIRHHGVDAADFLRAAHDFPELARMVKVRRGLAAHLRRLPGRKILVTNAPQDYALAVLRIAGIAQYFERVVAIEQMWVHGHLRPKPDRRMLRRLLAQERIAPHRAVLVEDTLSHLKRYAGMGIGTAWVTGYLRALAPARPQALPAPAEAAVPGVTADAVLRTTLAAEDGRHAPHTAQERAVTLVAAEAQVPPAGSEGRQPPAPQAMPDSAPRVRARVVNRPAYVKVKVQSMHQLQRQRQTRSKGHDAQ
>NZ_CP017751.1|WP_071010765.1|761642_762560_+|acetylglutamate-kinase
MNADAPGPAVTSVAAIAPSLKAEILAEALPYIRKFHGKTIVVKYGGNAMTEEKLKHGFARDVILLKLVGMNPVVVHGGGPQIDEALKKVGKVGTFIQGMRVTDEETMEVVEWVLGGEVQQDIVMLINQYGGQAVGLTGKDGGLIRAKRLQMPDRENPGTFIDIGFVGDIEAINPAVVRALQDDAFIPVISPIGFSDDGQAYNINADVVAGKMAEILKAEKLVMMTNIPGVMDKKGNLLTDLSAREIEELFADGTISGGMLPKISSALDAAKSGVNSVHIIDGRIEHSLLLEILTEQAFGTMIRSH
>NZ_CP017751.1|WP_071010775.1|772701_773649_-|N-acetyl-gamma-glutamyl-phosphate-reductase
MVFKVFVDGQEGTTGLRLLDYLSGRPDVELLRIAEDKRKDPAERARFLNAADVAFLCLPDVASREAVSLVTNPDTCIIDASTAFRTSDDWAYGLPELTRGQRDKVRQSKRIAVPGCHASAFITAVRPLVEAGVMQADYPVSAFSLTGYSGGGKKMIAEYEAGDNPKLTSPRPYALGLTHKHLPEMRVQTGLAQAPVFTPVVGNFLKGLAVTVPVYPDRLARKVSPEQIVEIYRQHYEGEQFVRVLPFDADSNLDAGAFDVQGCNDTNRVDLFVFGTPEHVVLMARLDNLGKGAAGAAVQCMNVHVGADEATGLTA
>NZ_CP017751.1|WP_071010776.1|773776_774553_-|exodeoxyribonuclease-III
MLRIISANLNGIRSASKKGFFEWMGKQDADMVCVQELKAQAADMTEAFLAPHGYHGYFHYAEKKGYSGVGLYTRHRPERVITGFGNTEFDNEGRYVEVQYPHLAVISVYVPSGSSSEERQLAKFRFMEAFLPHLLQLKASGREIVLCGDVNIAHKEIDIKNWKGNLKNSGFLPEERAWIGELFDTHGYVDVFRRLDPRPEQYTWWSNRGQAYAKNVGWRIDYHLATQKIAETASATSIYKDEKFSDHAPLSIDYDFAL
>NZ_CP017751.1|WP_071010777.1|774582_775284_+|orotate-phosphoribosyltransferase
MTQQTTPSATQPGEAAELRQTFIRFALDAGVLSFGEFVTKAGRKSPYFFNAGLFNQGGMLGQVAQFYAKTLLASGLEFDVLFGPAYKGITLASATAVALAGMGRDVGFAYNRKEAKDHGEGGTLVGAKLRGKVVIIDDVISAGTSVRESMQMIRAAGAEPAAVLIALDRMEKSGTADQVGTHSAVQDVQREYGVPVISIASLGDLLAYLDASQDPALGASREAVAAYRARYGV
>NZ_CP017751.1|WP_083383917.1|775523_776939_+|patatin-like-phospholipase-family-protein
MRASVAGRPGTAARGLNEADGGTGVAGNGQGGARRAPARRGNGAQVPAAVKRARAGASATAATAATAATAPRQAHAAPAVPHAASIEALARAYRVRALVLQGGGALGSYQGGVYQGLAEHGIEPDWVAGISIGALNAAVIAGNAPQRRVEQLRNFWEYICGQPWLPSLPHGWMDWDAVDWPDPLRLWYDGWHAMRAVLEGQRGFFVPRSLPKLLSGHVPTGQASFYDTSALRATLERFADFDRINDHRAMRVSLGAVNVHTGNFAYFDNTRETLRPEHFMASGALPPGFPAVEVDGEYYWDGGLVSNTPLAEVLSAQPRRDALIFQVDLWSARGHLPHNLMEVAERQKDIQYSSRTRAVTDALCEQQNLRRLLSEVLELVPPAGREDPWYKRALEHACTARRNVVHLIYRDKSFEGNAKDYQFGRLAMEEHWESGLADIRQTLQHPEWLAMPSAEHPFVTHDVHRDRGHGE
>NZ_CP017751.1|WP_071010778.1|776976_777786_-|polyphosphate-kinase-2-family-protein
MTLENFRITHGKDFRLAEFAAGAKPISSGDKAADLARLDDICEKLDAMQDVFYAEHQRKLLVVLQGMDTAGKDGTVRSVFRTFDPLGIRVVAFKSPTPEELAHDYLWRVHAQVPRRGEIVVFNRSHYEDVLITRVHGWIDKAECERRYRQLRDFERMLTETGTTVVKCFLHISKEEQKARLEARLADPEKHWKFDTTDLAERKYWKEYMAAYEDAIAATSTPETPWYVVPADSKTHRNLMVAEILFAVFSAMKPAYPPAKPELAGLKVD
>NZ_CP017751.1|WP_071010779.1|777849_778716_-|diaminopimelate-epimerase
MKLQFTKMQGAGNDFVVLDGIHQKIDLSPAQWRALADRHFGVGADQMLVVEPATRDDADFRYRIFNADGGEVEHCGNGARCFVRFVSDRGMTDKRSVRVQVMKGLITLTLQDDGQVTVDMGAPELEPAQVPFVPAGLPQRSEGEDTQYGLEVNGRTAWITPVSMGNPHAVQVVDDVEHFPVLQDGPLIEHHASFPQRVNAGFMEIVERGTVRLRVFERGAGETLACGTGACAAVVAGIRRGLLDSPVKVHTHGGDLTIAWAGGASPVLMTGPATTVFEGSIDLDRLPV
>NZ_CP017751.1|WP_071010780.1|778771_779665_-|lauroyl-acyltransferase
MSRVLTRLGIGLLSVLGKLPYPLVARFGEALGSLLHCVPSSRRRVVETNLRLCFPDKSEAEIQALSRQTFRQVFRSFAERGIFWTGSEKQMRRWVQIDDQADLVALDGTPHILVTMHLSGVEAGAIRLTIHLRDHVGRSGASLYTQQKNRLFDAFLKEARGRFGANMISRSDSARDILRCLKKGEALQLIADMDFGERDSEFVPFFGVPALTLTSVARLARLTGAKVVPIYTEMLPDYGGYVLHILPPWDGYPGENVSEDTRRMNAFFEDCIRPRIAEYYWVHKRFKHRPPGEPEVY
>NZ_CP017751.1|WP_071010781.1|779661_780537_-|lysophospholipid-acyltransferase-family-protein
MTFLFWLISRLPLRWLHAAGGILGLLAARLPGRYATRLDENFRLAFPAATDAMLADAARSTGRMMLEMPYFWSRKTLKAKLYDFNDRVWPELDRLQDAHGKGLIILTPHLGCFEVLPQSYALRRPVTCLFKPPHQPWLRDFVERMRGRDNIAMAPATPRGVRMLVKALKRGQAVGILPDQVPSAGEGAWAPFFGKPAYTMSLVQRLQQLTGAPIVMVFAERLPHGGGYRAHLRVIDGMLPDDPSAAAAVINRTVESLVADAPTQYLWGYNRYKHPAGASLPPQAATDPSTP
>NZ_CP017751.1|WP_071010782.1|780789_781953_+|methionine-adenosyltransferase
MANDFLFTSESVSEGHPDKVADQISDAILDAILSQDKYARVAAETLCNTGLVVLAGEITTTANVDYIQVARDTIKRIGYDNTDYGIDYKGCAVLVAYDKQSPDIAQGVDRASDDYLNQGAGDQGLMFGYACDETPELMPFPIYYAHRLVERQSLLRRDGRLPWLRPDAKSQVTVRYVDGKPHSVDTVVLSTQHSPEISQAQIREAVIEEIIKPVLPAEMLKETKYLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGASPHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLARQCQVQVSYAIGVARPINITVYTEGTGKISDEKIAELVQEHFDLRPKGIVQMLDLLRPIYEKTAAYGHFGREEPEFSWEATDKAAALRAAAGL
>NZ_CP017751.1|WP_071010783.1|782227_783172_+|3-deoxy-D-manno-oct-2-ulosonic-acid-(Kdo)-hydroxylase
MATAQTRAPSPADRSQAAAPALDLIRPQPYTDWQPQVSPATAAALRRELEQGCVLYFPELKFHFEPGEERFLDSRWSDGKSKNINLRADSGAVRGAVGSAADLAAMSALVRRYAEYSEKLVLTLFPEYGPHMKRAGTSLRPSEIAGRPVSWRKDDTRLHVDSFPSNPLLGQRLLRVFHNIDPDAPRVWRVGEPFGDFARRFVPQTRGMWPGQAWLMKQLHITKRRRSEYDHRMLQLHDLAKADLDYQAQVPQQEFHFPPGSTWIVFSDQVLHAAMRGRAMMEQTFYLAPKAISDHTHSPEAVLSRMLGRPMLAG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP017751_1	1.1\|772431\|57\|NZ_CP017751\|CRISPRCasFinder	772431-772487	57	NZ_CP017751.1	1342757-1342813	0	1.0
NZ_CP017751_1	1.1\|772431\|57\|NZ_CP017751\|CRISPRCasFinder	772431-772487	57	NZ_CP017751.1	1862369-1862425	1	0.982
NZ_CP017751_1	1.1\|772431\|57\|NZ_CP017751\|CRISPRCasFinder	772431-772487	57	NZ_CP017752.1	2656073-2656129	1	0.982

1. spacer 1.1|772431|57|NZ_CP017751|CRISPRCasFinder matches to position: 1342757-1342813, mismatch: 0, identity: 1.0

tcacactgaccgataccactcgaatccacgcgcaaaagccttgcgtcacgaaagcga	CRISPR spacer
tcacactgaccgataccactcgaatccacgcgcaaaagccttgcgtcacgaaagcga	Protospacer
*********************************************************

2. spacer 1.1|772431|57|NZ_CP017751|CRISPRCasFinder matches to position: 1862369-1862425, mismatch: 1, identity: 0.982

tcacactgaccgataccactcgaatccacgcgcaaaagccttgcgtcacgaaagcga	CRISPR spacer
tcacacagaccgataccactcgaatccacgcgcaaaagccttgcgtcacgaaagcga	Protospacer
****** **************************************************

3. spacer 1.1|772431|57|NZ_CP017751|CRISPRCasFinder matches to position: 2656073-2656129, mismatch: 1, identity: 0.982

tcacactgaccgataccactcgaatccacgcgcaaaagccttgcgtcacgaaagcga	CRISPR spacer
tcacactgaccgataccactcgaatccacgcgcaaaagccgtgcgtcacgaaagcga	Protospacer
**************************************** ****************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1629955 : 1638913

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071011649.1\|1629955_1631341_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	4.9e-72	36.2
WP_071011651.1\|1631412_1632360_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.3e-12	26.4
WP_071011652.1\|1632443_1633436_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	1.2e-27	33.1
WP_071011654.1\|1633600_1633945_+	hypothetical protein	NA	NA	NA	NA
WP_071011655.1\|1634330_1635635_+	pyrimidine utilization transport protein G	Q9KX94	Enterobacteria_phage	2.8e-146	64.9
WP_071011657.1\|1635720_1636623_+	cysteine synthase CysM	A0A1X9I5K7	Streptococcus_phage	2.5e-53	40.5
WP_071011658.1\|1636747_1637854_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_071011660.1\|1637989_1638913_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	1.1e-38	33.2

DBSCAN-SWA_2

2386731 : 2395075

Ralstonia_phage(85.71%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071012657.1\|2386731_2387031_-	hypothetical protein	A0A097ZIG4	Ralstonia_phage	2.1e-20	58.8
WP_083384049.1\|2387331_2388423_+	replication initiation protein	A0JC21	Ralstonia_phage	2.6e-124	65.5
WP_071012659.1\|2388426_2388735_+	hypothetical protein	E5F068	Ralstonia_phage	1.4e-40	78.2
WP_156811215.1\|2388731_2388902_+	hypothetical protein	NA	NA	NA	NA
WP_156811217.1\|2388916_2389150_+	hypothetical protein	NA	NA	NA	NA
WP_071012663.1\|2389152_2389368_+	hypothetical protein	NA	NA	NA	NA
WP_156811219.1\|2389519_2390893_+	hypothetical protein	A0A097ZIF9	Ralstonia_phage	1.1e-23	54.0
WP_071012666.1\|2390889_2391213_+	DUF2523 domain-containing protein	B5UAS1	Ralstonia_phage	6.8e-25	58.4
WP_083384050.1\|2391217_2392420_+	zonular occludens toxin	A0A1W5LU16	Ralstonia_phage	3.9e-158	73.5
WP_156811364.1\|2394247_2395075_-	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.0e-09	22.5

DBSCAN-SWA_3

2767155 : 2775538

Burkholderia_phage(22.22%)

tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071016404.1\|2767155_2767509_-	DUF1353 domain-containing protein	A0A1L2CVI8	Pectobacterium_phage	8.2e-16	47.8
WP_071013181.1\|2767532_2767733_-	hypothetical protein	NA	NA	NA	NA
WP_071013183.1\|2767733_2768009_-	hypothetical protein	NA	NA	NA	NA
WP_071013186.1\|2768060_2768282_-	hypothetical protein	NA	NA	NA	NA
WP_071013189.1\|2768271_2768760_-	hypothetical protein	NA	NA	NA	NA
WP_071013192.1\|2768849_2770355_-	hypothetical protein	A0A0B4ZZU0	Achromobacter_phage	3.1e-64	38.2
WP_071013194.1\|2770370_2770757_-	hypothetical protein	NA	NA	NA	NA
WP_071013197.1\|2770828_2771164_-	ammonia monooxygenase	A0A291AUV3	Sinorhizobium_phage	5.2e-28	49.6
WP_071013198.1\|2771160_2771715_-	glycoside hydrolase family 19 protein	A0A059VA40	Pseudomonas_phage	5.6e-43	52.5
WP_071013202.1\|2771711_2772143_-	hypothetical protein	A0A0U5LBV3	unidentified_phage	5.1e-28	49.2
WP_071013205.1\|2772278_2773454_+	acyltransferase	A0A2H4IZR3	uncultured_Caudovirales_phage	2.2e-28	29.2
WP_083384092.1\|2773470_2773875_-\|tail	tail fiber assembly protein	U5P083	Shigella_phage	6.1e-23	46.3
WP_071013208.1\|2773891_2774821_-	hypothetical protein	A9YX14	Burkholderia_phage	5.0e-20	48.1
WP_071013211.1\|2774878_2775538_-	DUF2612 domain-containing protein	A9YX13	Burkholderia_phage	6.8e-72	59.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP017753

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

121422 : 178667

Stx2-converting_phage(18.18%)

integrase,transposase

attL 112303:112319|attR 149115:149131

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
112303:112319	attL	NA	NA	NA	NA
WP_083384933.1\|121422_121776_-\|transposase	IS200/IS605 family transposase	A0A1S5RHE3	Helicobacter_phage	4.3e-33	58.9
WP_071023426.1\|121838_123971_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_071023152.1\|123997_125416_-	HNH endonuclease	NA	NA	NA	NA
WP_083384866.1\|125648_126266_+	hypothetical protein	NA	NA	NA	NA
WP_083384868.1\|126262_126448_+	hypothetical protein	NA	NA	NA	NA
WP_071023156.1\|129347_129695_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	3.6e-40	71.0
WP_083384873.1\|129691_130099_-\|transposase	transposase	A0A0P0ZBP6	Stx2-converting_phage	6.8e-14	35.3
WP_071023158.1\|130196_131477_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	7.4e-22	38.9
WP_071023161.1\|131609_132386_-	EAL domain-containing protein	NA	NA	NA	NA
WP_071023163.1\|132704_132959_+	H-NS histone family protein	NA	NA	NA	NA
WP_071023166.1\|133191_134055_+	hypothetical protein	NA	NA	NA	NA
WP_083384935.1\|134051_134162_+	DUF3560 domain-containing protein	NA	NA	NA	NA
WP_071023171.1\|135439_136084_-	BON domain-containing protein	NA	NA	NA	NA
WP_071023173.1\|136133_136598_-	CBS domain-containing protein	NA	NA	NA	NA
WP_071023176.1\|136772_136964_+	hypothetical protein	NA	NA	NA	NA
WP_071023179.1\|138537_139173_+	hypothetical protein	NA	NA	NA	NA
WP_071023428.1\|139212_139641_-	TraR/DksA family transcriptional regulator	NA	NA	NA	NA
WP_071023182.1\|139710_140043_-	DUF883 family protein	NA	NA	NA	NA
WP_156811587.1\|140600_140930_+	hypothetical protein	NA	NA	NA	NA
WP_071023186.1\|140957_142022_+	AMP-binding protein	NA	NA	NA	NA
WP_083384877.1\|142044_142554_+	AMP-binding protein	NA	NA	NA	NA
WP_083384879.1\|144211_145186_-	acyltransferase	W6MVL2	Pseudomonas_phage	4.2e-09	25.9
WP_083384881.1\|145624_146644_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.1e-41	33.7
WP_071023198.1\|147676_148801_+\|transposase	IS481 family transposase	A0A0M3LS26	Mannheimia_phage	3.1e-08	24.7
WP_071023200.1\|149247_150054_-	polyphosphate kinase 2	NA	NA	NA	NA
149115:149131	attR	NA	NA	NA	NA
WP_083384883.1\|150050_150653_-	hypothetical protein	A0A2K9R7H3	Dishui_lake_phycodnavirus	7.0e-07	33.1
WP_071023434.1\|152237_153131_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_071023208.1\|153424_153910_-	carboxypeptidase regulatory-like domain-containing protein	NA	NA	NA	NA
WP_071023210.1\|154209_154713_-	hypothetical protein	NA	NA	NA	NA
WP_071023212.1\|155314_156298_-	FAD:protein FMN transferase	NA	NA	NA	NA
WP_071023215.1\|156278_158486_-	NADPH flavoprotein	NA	NA	NA	NA
WP_071023217.1\|158511_158979_-	DUF2271 domain-containing protein	NA	NA	NA	NA
WP_071023220.1\|159092_159506_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_071023223.1\|159649_160309_+	response regulator	W8CYM9	Bacillus_phage	1.9e-29	32.7
WP_071023225.1\|160311_161667_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_156811588.1\|161765_162386_-	hypothetical protein	NA	NA	NA	NA
WP_071023228.1\|162382_164680_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.9e-50	28.8
WP_071023231.1\|164786_165698_-	cation transporter	NA	NA	NA	NA
WP_071023234.1\|165960_167148_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_071023236.1\|167152_169519_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_071023239.1\|169512_170229_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.8e-31	38.2
WP_156811589.1\|170280_170721_-	universal stress protein	NA	NA	NA	NA
WP_083384885.1\|171863_172700_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_071023245.1\|172727_173315_-	LysE family translocator	NA	NA	NA	NA
WP_071023248.1\|174439_174853_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_071023251.1\|174945_175899_+	aromatic alcohol reductase	NA	NA	NA	NA
WP_071073779.1\|176793_177129_+	hypothetical protein	NA	NA	NA	NA
WP_083384526.1\|177287_178667_-\|transposase	ISNCY family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP017752

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP017751

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP017753

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection