CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP017776	Bacillus velezensis strain 9912D plasmid p9912D, complete sequence	0 crisprs	NA	0	0	1	0
NZ_CP017775	Bacillus velezensis strain 9912D chromosome, complete genome	1 crisprs	csa3,DinG,casR,cas3,DEDDh,WYL	0	0	13	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

7385 : 33325

Bacillus_phage(66.67%)

tail,capsid,portal,terminase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061046993.1\|7385_10025_-\|tail	phage tail protein	Q5YA57	Bacillus_phage	2.9e-113	45.8
WP_071182138.1\|10040_10766_-\|tail	phage tail family protein	A0A1B1P894	Bacillus_phage	1.7e-28	37.9
WP_061046970.1\|10762_13411_-\|tail	phage tail tape measure protein	A0A0S2SXL7	Bacillus_phage	3.2e-104	58.8
WP_061046971.1\|13412_14057_-	hypothetical protein	A0A1B1P868	Bacillus_phage	2.0e-23	41.4
WP_061046972.1\|14064_14454_-	hypothetical protein	NA	NA	NA	NA
WP_061046973.1\|14511_14799_-	fibronectin type III domain-containing protein	NA	NA	NA	NA
WP_076983588.1\|15007_15304_-	fibronectin type III domain-containing protein	Q0PDK9	Bacillus_phage	7.1e-21	61.7
WP_061046974.1\|15263_15725_-	hypothetical protein	I1TLE8	Bacillus_phage	6.1e-19	39.0
WP_061046975.1\|15737_16127_-	hypothetical protein	NA	NA	NA	NA
WP_048367517.1\|16136_16484_-	hypothetical protein	B5LPR8	Bacillus_virus	8.6e-26	47.0
WP_061046976.1\|16480_16819_-	hypothetical protein	I1TLE5	Bacillus_phage	1.8e-15	39.8
WP_061046977.1\|16811_17213_-	hypothetical protein	A0A1B1P889	Bacillus_phage	4.1e-19	41.8
WP_061046978.1\|17228_17492_-	hypothetical protein	A0A1B1P891	Bacillus_phage	1.7e-10	54.7
WP_071182139.1\|17504_17828_-	fibronectin type III domain-containing protein	Q0PDK9	Bacillus_phage	9.5e-27	72.6
WP_061046979.1\|17760_18663_-	hypothetical protein	A0A1B1P885	Bacillus_phage	5.1e-102	61.0
WP_061046980.1\|18676_19315_-	hypothetical protein	B3GW02	Streptococcus_phage	1.6e-17	43.2
WP_155641728.1\|19393_19534_-	hypothetical protein	NA	NA	NA	NA
WP_071182140.1\|19548_20664_-\|capsid	phage minor capsid protein	A0A1B1P858	Bacillus_phage	3.9e-80	43.4
WP_061046981.1\|20663_22175_-\|portal	phage portal protein	A0A1B1P863	Bacillus_phage	3.5e-140	54.3
WP_061046982.1\|22187_23465_-\|terminase	PBSX family phage terminase large subunit	D2XPX9	Bacillus_virus	1.6e-181	70.8
WP_061046983.1\|23445_24093_-\|terminase	terminase small subunit	A0A2K9V3C4	Faecalibacterium_phage	3.6e-17	38.6
WP_061046984.1\|24285_24798_-	hypothetical protein	A0A0A7AQW8	Bacillus_phage	2.3e-14	35.8
WP_061046985.1\|25162_25507_-	hypothetical protein	Q38579	Bacillus_phage	1.3e-29	59.6
WP_061046986.1\|25774_26230_-	hypothetical protein	NA	NA	NA	NA
WP_061046987.1\|26253_26466_-	hypothetical protein	A0A2H4JDM6	uncultured_Caudovirales_phage	8.7e-13	52.9
WP_053075460.1\|26462_26915_-	hypothetical protein	NA	NA	NA	NA
WP_061046988.1\|26929_27370_-	hypothetical protein	M1HNE7	Bacillus_virus	7.6e-27	51.4
WP_048367579.1\|27375_27594_-	hypothetical protein	NA	NA	NA	NA
WP_048367577.1\|27639_28044_-	hypothetical protein	W8CYU3	Bacillus_phage	2.6e-18	40.5
WP_048367575.1\|28040_28226_-	hypothetical protein	NA	NA	NA	NA
WP_048367618.1\|28714_28990_-	hypothetical protein	F8WQ59	Bacillus_phage	1.7e-16	47.3
WP_048367569.1\|29022_29328_-	hypothetical protein	NA	NA	NA	NA
WP_048367567.1\|29327_29663_-	hypothetical protein	NA	NA	NA	NA
WP_155641729.1\|29941_30115_-	hypothetical protein	NA	NA	NA	NA
WP_175365358.1\|30101_30278_-	hypothetical protein	NA	NA	NA	NA
WP_048367565.1\|30296_30746_-	single-stranded DNA-binding protein	M5ABV5	Bacillus_phage	1.4e-52	71.3
WP_048367563.1\|30739_31276_-	Holliday junction resolvase RecU	Q0H273	Geobacillus_phage	6.2e-39	53.4
WP_048367561.1\|31369_31606_-	hypothetical protein	NA	NA	NA	NA
WP_048367559.1\|31602_31821_-	hypothetical protein	NA	NA	NA	NA
WP_048367555.1\|32059_32722_-	ERF family protein	A0A1J0MF78	Staphylococcus_phage	7.6e-31	36.8
WP_048367554.1\|32725_33325_-	host-nuclease inhibitor Gam family protein	D7RWM7	Brochothrix_phage	1.3e-24	37.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP017775

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP017775_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017775_1

746285-746352

Orphan

Consensus_repeat	Method
GGCTACCCGGGGTACGGTTTTGGCGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP017775_1

>merge|NZ_CP017775|1|746285-746352|CRISPRCasFinder
GGCTACCCGGGGTACGGTTTTGGCGGCCACGGAGGCTTCGGAGGATATCCGGGATACGGTTTCGGCGG

>NZ_CP017775|1|1|746285-746352|CRISPRCasFinder
GGCTACCCGGGGTACGGTTTTGGCGG	CCACGGAGGCTTCGGA
GGATATCCGGGATACGGTTTCGGCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017775.1\|WP_025649906.1\|738710_739181_-\|DUF600-family-protein	unknown	unknown	gnl\|CDD\|377394
NZ_CP017775.1\|WP_071182111.1\|739692_740181_-\|DUF600-family-protein	unknown	unknown	gnl\|CDD\|377394
NZ_CP017775.1\|WP_017419063.1\|751122_751812_+\|DUF421-domain-containing-protein	unknown	unknown	gnl\|CDD\|225205
NZ_CP017775.1\|WP_071181619.1\|738236_738686_-\|antitoxin-YezG-family-protein	unknown	unknown	gnl\|CDD\|377394
NZ_CP017775.1\|WP_017419051.1\|739214_739676_-\|antitoxin-YezG-family-protein	unknown	unknown	gnl\|CDD\|377394
NZ_CP017775.1\|WP_003155704.1\|747718_747967_+\|spore-coat-associated-protein-CotJA	unknown	unknown	gnl\|CDD\|378536
NZ_CP017775.1\|WP_087614160.1\|749477_750628_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP017775.1\|WP_025649905.1\|736922_737798_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|366444
NZ_CP017775.1\|WP_071182112.1\|743146_745027_-\|ribonuclease-YeeF-family-protein	unknown	unknown	gnl\|CDD\|227731
NZ_CP017775.1\|WP_007408934.1\|747950_748214_+\|spore-coat-protein-CotJB	unknown	unknown	gnl\|CDD\|378904
NZ_CP017775.1\|WP_032872498.1\|740265_740742_-\|antitoxin-YezG-family-protein	unknown	unknown	gnl\|CDD\|377394
NZ_CP017775.1\|WP_071181620.1\|740743_742750_-\|ribonuclease-YeeF-family-protein	unknown	unknown	gnl\|CDD\|227731
NZ_CP017775.1\|WP_017419060.1\|746715_747585_+\|aminoglycoside-6-adenylyltransferase	unknown	unknown	gnl\|CDD\|377357
NZ_CP017775.1\|WP_017419062.1\|750730_751009_+\|YesK-like-family-protein	unknown	unknown	gnl\|CDD\|372929
NZ_CP017775.1\|WP_071181621.1\|745325_746045_+\|YebC/PmpR-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|237084
NZ_CP017775.1\|WP_017419055.1\|742841_743141_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376019
NZ_CP017775.1\|WP_003155700.1\|748228_748798_+\|spore-coat-protein-CotJC	unknown	unknown	gnl\|CDD\|252986
NZ_CP017775.1\|WP_003155696.1\|751844_752171_-\|heme-degrading-oxygenase-HmoA	unknown	unknown	gnl\|CDD\|225209
NZ_CP017775.1\|WP_007408938.1\|752255_752618_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319924
NZ_CP017775.1\|WP_017419061.1\|748886_749420_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|235142

Protein	Function_ID	Function_description	E-value
NZ_CP017775.1\|WP_025649906.1\|738710_739181_-\|DUF600-family-protein	gnl\|CDD\|377394	pfam04634, DUF600, Protein of unknown function, DUF600. This conserved region is found in several uncharacterized proteins from Gram positive bacteria.	7.70908e-49
NZ_CP017775.1\|WP_071182111.1\|739692_740181_-\|DUF600-family-protein	gnl\|CDD\|377394	pfam04634, DUF600, Protein of unknown function, DUF600. This conserved region is found in several uncharacterized proteins from Gram positive bacteria.	1.8788e-41
NZ_CP017775.1\|WP_017419063.1\|751122_751812_+\|DUF421-domain-containing-protein	gnl\|CDD\|225205	COG2323, COG2323, Predicted membrane protein [Function unknown].	3.31508e-65
NZ_CP017775.1\|WP_071181619.1\|738236_738686_-\|antitoxin-YezG-family-protein	gnl\|CDD\|377394	pfam04634, DUF600, Protein of unknown function, DUF600. This conserved region is found in several uncharacterized proteins from Gram positive bacteria.	1.66044e-53
NZ_CP017775.1\|WP_017419051.1\|739214_739676_-\|antitoxin-YezG-family-protein	gnl\|CDD\|377394	pfam04634, DUF600, Protein of unknown function, DUF600. This conserved region is found in several uncharacterized proteins from Gram positive bacteria.	9.52341e-48
NZ_CP017775.1\|WP_003155704.1\|747718_747967_+\|spore-coat-associated-protein-CotJA	gnl\|CDD\|378536	pfam11007, CotJA, Spore coat associated protein JA (CotJA). CotJA is part of the CotJ operon which contains CotJA and CotJC. The operon encodes spore coat proteins. Interaction of CotJA with CotJC is required for the assembly of both CotJA and CotJC into the spore coat.	6.06894e-07
NZ_CP017775.1\|WP_087614160.1\|749477_750628_-\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	9.5844e-41
NZ_CP017775.1\|WP_025649905.1\|736922_737798_+\|ABC-transporter-permease	gnl\|CDD\|366444	pfam01061, ABC2_membrane, ABC-2 type transporter.	5.04546e-05
NZ_CP017775.1\|WP_071182112.1\|743146_745027_-\|ribonuclease-YeeF-family-protein	gnl\|CDD\|227731	COG5444, COG5444, Uncharacterized conserved protein [Function unknown].	7.6046e-83
NZ_CP017775.1\|WP_007408934.1\|747950_748214_+\|spore-coat-protein-CotJB	gnl\|CDD\|378904	pfam12652, CotJB, CotJB protein. CotJ is a sigma E-controlled operon involved in the spore coat of Bacillus subtilis. This protein has been identified as a spore coat protein.	2.72958e-30
NZ_CP017775.1\|WP_032872498.1\|740265_740742_-\|antitoxin-YezG-family-protein	gnl\|CDD\|377394	pfam04634, DUF600, Protein of unknown function, DUF600. This conserved region is found in several uncharacterized proteins from Gram positive bacteria.	2.11035e-53
NZ_CP017775.1\|WP_071181620.1\|740743_742750_-\|ribonuclease-YeeF-family-protein	gnl\|CDD\|227731	COG5444, COG5444, Uncharacterized conserved protein [Function unknown].	4.09533e-139
NZ_CP017775.1\|WP_017419060.1\|746715_747585_+\|aminoglycoside-6-adenylyltransferase	gnl\|CDD\|377357	pfam04439, Adenyl_transf, Streptomycin adenylyltransferase. Also known as Aminoglycoside 6- adenylyltransferase (EC:2.7.7.-), this protein confers resistance to aminoglycoside antibiotics.	1.1599e-147
NZ_CP017775.1\|WP_017419062.1\|750730_751009_+\|YesK-like-family-protein	gnl\|CDD\|372929	pfam14150, YesK, YesK-like protein. The YesK-like protein family includes the B. subtilis YesK protein, which is functionally uncharacterized. Its expression is regulated by the sporulation-specific sigma factor sigma-E. This family of proteins is found in bacteria. Proteins in this family are approximately 100 amino acids in length.	4.43053e-10
NZ_CP017775.1\|WP_071181621.1\|745325_746045_+\|YebC/PmpR-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|237084	PRK12378, PRK12378, YebC/PmpR family DNA-binding transcriptional regulator.	5.4586e-137
NZ_CP017775.1\|WP_017419055.1\|742841_743141_-\|hypothetical-protein	gnl\|CDD\|376019	pfam18593, CdiI_2, CdiI immunity protein. Contact-dependent growth inhibition (CDI) is an important mechanism of inter-bacterial competition found in many Gram-negative pathogens. CDI+ cells express cell-surface CdiA proteins that bind neighboring bacteria and deliver C-terminal toxin domains (CdiA-CT) to inhibit target-cell growth. CDI+ bacteria also produce CdiI immunity proteins, which specifically neutralize cognate CdiA-CT toxins to prevent self-inhibition. Structure analysis of CdiI immunity protein from Yersinia kristensenii shows that it is composed of eight alpha-helices packed together to form a nearly spherical structure with weak structural homology to a putative TetR family transcriptional repressor. The CdiI protein fits into the curved cavity of the CdiA-CTYkris toxin domain where it most likely neutralizes toxin activity by blocking access to RNA substrates. This domain is mostly found in gammaproteobacteria.	1.97753e-08
NZ_CP017775.1\|WP_003155700.1\|748228_748798_+\|spore-coat-protein-CotJC	gnl\|CDD\|252986	pfam05067, Mn_catalase, Manganese containing catalase. Catalases are important antioxidant metalloenzymes that catalyze disproportionation of hydrogen peroxide, forming dioxygen and water. Two families of catalases are known, one having a heme cofactor, and this family that is a structurally distinct family containing non-heme manganese.	9.22523e-95
NZ_CP017775.1\|WP_003155696.1\|751844_752171_-\|heme-degrading-oxygenase-HmoA	gnl\|CDD\|225209	COG2329, COG2329, Uncharacterized enzyme involved in biosynthesis of extracellular polysaccharides [General function prediction only].	1.45762e-20
NZ_CP017775.1\|WP_007408938.1\|752255_752618_-\|VOC-family-protein	gnl\|CDD\|319924	cd07263, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.20004e-35
NZ_CP017775.1\|WP_017419061.1\|748886_749420_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|235142	PRK03624, PRK03624, putative acetyltransferase; Provisional.	2.85681e-05

>NZ_CP017775.1|WP_071181621.1|745325_746045_+|YebC/PmpR-family-DNA-binding-transcriptional-regulator
MGRKWNNIKEKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQALKVVLERAKTYSVPKNIIERAIEKAKGGAEENFDELRYEGFGPNGSMIIVDALTNNVNRTAPEVRAAFGKNGGNMGVSGSVAYMFDATAVIGVEGKTADETLELLMEADVDVRDILEEDDSVIVYAEPDQFHALQEAFKNAGVEEFTVAELTMLAQNEVELPEDAKAQFEKLIDVLEDLEDVQQVYHNVDLGE
>NZ_CP017775.1|WP_071182112.1|743146_745027_-|ribonuclease-YeeF-family-protein
MKVFEANSLLAAAKQRAGEYKKLRGQMVNLKKAFQGMADLGEGDFSGRGADNIKAFFQDHAGVTDSWLDLIDMKIAFLTSLPGKVEDAGLSNSHVEESFLEHELTHALSKSKAIMEEQKKDMRSILGEIEDIISLDLFSTESTDQKLSSADKKRSETIHKLGKLDHDLTKEYAETEANEQFIQADFEQLQNASGKGKGATPLHYNAKAYRESDIHKKKGEIARHSDAYLTIKKEEAKEREIKDLKKKLADGVTDPDEYLEIAKKIGYENLEPAQVQYVMQLEQAKQLEEVGETAWDIVKGVGVGLYDVGKDTITGVKDLAVGAWDFYHLSDEQKVTKTISAVLNTPSYAKIIWTNLADSWNDKMVNGDAYSRSHYITYAIGSIVGLKGSGSAVKVSSKLAKTGAAKVDNVLEAGEKAAAKHVKTGIEKGNDYINSVSKNKYEPALAGIAQNIENTHNVKNTPLLKSIIEDKKESVLSKSETSNSTAVGNVKQGDSTPLAPGGGLAAHEAKGGHLIERHVGKSDQELMERLEKSKMSNKKISGSSSFKDRATAEKVANITLSDNKDKIEKWLNNDVKKPLVLSYKGSEVLGRGITKGSAEISDLTNAKIILKKKNDGSFILTGYPTR
>NZ_CP017775.1|WP_017419055.1|742841_743141_-|hypothetical-protein
MIETNISEPVFQFLGGIFHQDIDTPESALGEYLAEIPKKEQENDVVALKTFINSDYSDEEKNDFIEESADGVDINSYGLSPILWLRQVIQKIEKNIEAL
>NZ_CP017775.1|WP_071181620.1|740743_742750_-|ribonuclease-YeeF-family-protein
MKVFEANSLLAAAKQRAGEYKKLRGQMVNLKKAFQGMADLGDNDFSGRGANNIKAFFKDHAGVTDSWLDLIDMKIAFLTSLPGKVEDAGLSNSHVEESFLEHELTHALSKSKAIMEEQKKDMRSILGEIEDIISLDLFSTESTDQKLSSADKKRSKTIHKLGKLDHDLTKEYAETEANEQFLQADFQQLQNATGKGKSATPLHYNAKAYRESDIHKKKGEIARHSDAYLTIKNEEAKEREIEKLKERLKNYDYANADEFYSMAKTIGYKNLTKEQQRYFTQIENTRELTDGFKGVAVGLYDSGKDAVTGLWDMVTDPGGTVEAITGAMAHPIKTYEAISAAIEESYQKDMVNGDTYSRARWVSYAVGTVVTSVVGTKGVGAVSKTGTAAKVTTKVKTAAIKSATAQKAITVSKQTVDHIKQKVNTGMEVSKKRVKNKLHQIGDLTLADMLPYHPRHDLVPAGVPYNAVNGVTLKEGLQKFAKVILPKPYGTSASGRRTPAPHVPPVTVKYGEHFAKWTRKKVLKPNVIYKTKEGYTYTTDNYGRITSVKADLQLGEAKRNQYAQSKAGKPDRLTDDDGGHLIATQFKGSGQFDNIVPMNSQINRSGGKWYKMEQDWAAALQADPPQKVSVEINALYKGDSLRPTAFRVKYKIGDQEPKLMRIKNQVGG
>NZ_CP017775.1|WP_032872498.1|740265_740742_-|antitoxin-YezG-family-protein
METKKMGDLYQQIAEGINEIIPSEWKKVILYAEILDDSSEVFFYFNTPHSEDFIYSHNIPEHFHVSEEIYEGLLFDLHDLFEELRDEFKENNQDIWTNLTLNLAISGEFSIDYNYEDVIQSPYTISQRQTIWTYKNVGIYPKSKPLKSFLEQYLNSQN
>NZ_CP017775.1|WP_071182111.1|739692_740181_-|DUF600-family-protein
MENELNALYRSIAETVNEMIPEPWEKFLFYAQVSETGGGTYFFYSSQNEPNHFKYSLEIPFEFDIDENEFDQYEMELFKLSEKMRDVFKDHDQELFYSFTLSLEKSGKLTVNFDYTDWFKTDYSFSDQLIIWKFKNLGEEPKDPSLQKLIKKYSEEYPENPI
>NZ_CP017775.1|WP_017419051.1|739214_739676_-|antitoxin-YezG-family-protein
MLEKTYLKITDVIGKIIPSEWSKVVLYAEILDGSREVYFFFQTPENDEYIYSHDIPEQFQVSKKIYTELLIDLQELFKQLHNEFKENNPEAWTNLTLNLESDGTFSIDYDYADVIESDLDEYERQMIWEFNNLGIFPEDEEDKEFVKDYLNIK
>NZ_CP017775.1|WP_025649906.1|738710_739181_-|DUF600-family-protein
METEKMEQLYQKIAEHLNVMIPSQREKIILYAEILDDSADIYFYFTTPNNSDYLFSHYIPEQFNVSEEIYDQLLIELQELFEELKEEFKLGNQDIWTNLTLKLENTGKFSIDYNDDDVLSSELDDLQRRDVWKYQNLGILPADEEDRKFIEEYLNI
>NZ_CP017775.1|WP_071181619.1|738236_738686_-|antitoxin-YezG-family-protein
METEKMGVLYQKISEQINEIIPSEWEKVALYAEILDDSSEVYFFFTTPQNQEYIYSHDIPEHFNVDEDIYDELLYELHDYFEELRDEFKTNNEDLWTNLTLHLERSGKFSIDYDYTDVIASDLNGTQRQVVWEYQNLGILLKMRTTKNL
>NZ_CP017775.1|WP_025649905.1|736922_737798_+|ABC-transporter-permease
MKSLSSLISRNIKIYFRDRTLLLLSLLSVFIVILLYAVFLQQTQLDAIKALVGSTDDSKAMVNEWMVAGLLSITAVTTTLGAFGIMVKDKESKRTYDFLTAPLSRATIQLSYVIHSFVIGLIFSFIAFLGCEIFLVSTGSKLLSGTDILEVLGIIILSVALSSSINLFLTLFIHTQNAFSTLSTIVGTAIGFLCGVYVPIGGVPVFVQKIIMYFPISHTAVLFRKAFMTDSVDKVFKHASTTQIQEYEKHYGIVYKLNGHFISTAASLWVIVITAIIFTVISIVIFKKQNK
>NZ_CP017775.1|WP_017419060.1|746715_747585_+|aminoglycoside-6-adenylyltransferase
MRSEDEMMKLILDIAMKDERIRLVTLEGSRTNKNVPRDRFQDYDISYFVTDMDSFTSDDSWLDQFGERMMMQKPEDMELFPPELGDWFSYLMLFKDHHKIDLTLIPLSQTEDYFTQSDGLAEIVLDKDDRINHKIIASDEQYHIKKPTPREFDDCCNEFWMVSTYVIKGLMRKEILFALDHMNDILRPNVLRMIAWNIGIENQFSLSVGKNYKYIQHYMNAKDWEILLNTYVGNTYESVWKALFDCQGLFRAYSKSVAVLLRYEYPEYDQQITEYTLKHYQRFQSDFSL
>NZ_CP017775.1|WP_003155704.1|747718_747967_+|spore-coat-associated-protein-CotJA
MKENQPFTPVKSYKPFHSRFDPCPPIGRKYYRTPPHLYMRFQPYHLEQFSPMEALRKGTLWKDLYDFYDNPYRGGIEYGEKD
>NZ_CP017775.1|WP_007408934.1|747950_748214_+|spore-coat-protein-CotJB
MAKKIDDEYYRLLEQIQAADFVLVELTLYLDTHPHDRLALQQFHEYSRYSRQLRKRFEPEYGPLLQFGVSQVGAQWDWGRGPWPWQV
>NZ_CP017775.1|WP_003155700.1|748228_748798_+|spore-coat-protein-CotJC
MWVYEKKLQYPVKVSTCNPMLAKFLIEQYGGADGELAAALRYLNQRYTIPDKVIGLLTDIGTEEFAHLEMIATMIYKLTKDATPEQLRDAGLSDHYVNHDSALFYHNAAGVPFTASYIQAKGDPIADLYEDIAAEEKARATYQWIIDISDDPDLNDSLRFLREREIVHSMRFREAVEILKEERDKKKIF
>NZ_CP017775.1|WP_017419061.1|748886_749420_+|GNAT-family-N-acetyltransferase
MTPFTITEEKAGAFRVTSARKDDEEEVMDLLVQAAEWLRDKGSNQWSGLLQGEDTHNMREAIATGYVFLFRQNEELAGVVMLLPEASGWDRRLWGDEGHEESVYLHRLAINRRFAGERLGRTIMTWAETGVSCPGKTKIRLDCVSENKALQSFYSGMGYESKGLAPGYHLFEKKMSK
>NZ_CP017775.1|WP_087614160.1|749477_750628_-|IS3-family-transposase
MGTRVSYPVEVKQKAVEMRLAGVPMKEIMQELNIKNNTQIKTWVRWYKAGDTHRFEQPVGKQYTYGKGPEYSSELEKLQAENRYLRQQNEVFKKVQRIGKEVDSQTSVELVEELHSTMTVQDICIHLGISRSSYYRWKKNLKKDHPKRHLEKQIGTLCREHQYRYGYRKITAILKKRMCINHKTVQRIMQKNQWQCRVKVKKRKKNGQPYAVVDNILDRNFQSDHPLEKLVTDITYLPYGQKQLYLSSILDVYNGEVIAFTIGDKQDTDFVLHTLDQLPTLPENCVLHSDQGSVYTSYEYQKAVKTKGITMSMSRKGTPADNASIESFHSSLKSETFYLNSIDRTTTAIVERTVIEYIHYYNNIRIQTKLNNQSPINYRQLAV
>NZ_CP017775.1|WP_017419062.1|750730_751009_+|YesK-like-family-protein
MGFFYLICLAAFCLNFAVSAVLRKKWPKKMWPECLLAVLGLTAFGTVVYSIFGVGGWEGMGLGLAAMFAGSGAAAGYAAEVCLRVVRSNQKQ
>NZ_CP017775.1|WP_017419063.1|751122_751812_+|DUF421-domain-containing-protein
MGHLLTVAWELVCGLGILFVILKLLGKTQFSQITPFDFISALILGELVGNAVYDKNVRIIEIIFASLLWGVLIYLIELITQKVKSTRKLLEGEPSIIIHKGKLKYDVLKKNKLDINQLQSLLRQANCFSIQEAEYAILETNGMVSVLPKFQYDTTKNGDMQIKPKQVSLPVTLIIDGEVLYENLKEAGLEEKQLNQELKKLNIKKTEDVLYAEWKPDKPLFVLPYEEKK
>NZ_CP017775.1|WP_003155696.1|751844_752171_-|heme-degrading-oxygenase-HmoA
MFVQIRKMTVKEGHADKVIERFSSEGVIEKQEGLIDVTVLEKKVRRGDEEVVVLIRWESEDHWKQWEKSEDHIAAHKANQGKPKPDYMLGTDVGMYHVRAVKTGVHEK
>NZ_CP017775.1|WP_007408938.1|752255_752618_-|VOC-family-protein
MIKKIATVAVYTDDQQKAKTFWTEKAGFETVAEHPMGPGAFWLEVAPKGAATHLVIYPKSMMKGAEHMKASIVFECEDVFAAYEQMKKNGITFLDEPKQMEWGSFVQFKDEDGHVFLLKS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

532381 : 636609

122

uncultured_Caudovirales_phage(37.04%)

capsid,integrase,protease,terminase,portal,transposase,tail,coat,holin,head,tRNA

attL 591660:591678|attR 634143:634161

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014417026.1\|532381_532681_-\|coat	spore coat protein	NA	NA	NA	NA
WP_014417027.1\|532688_532895_-	hypothetical protein	NA	NA	NA	NA
WP_014417028.1\|532913_534050_-	glutathione-dependent formaldehyde dehydrogenase	E3SJ82	Synechococcus_phage	1.0e-14	26.7
WP_014417029.1\|534068_534437_-\|coat	spore coat protein	NA	NA	NA	NA
WP_007409324.1\|534454_534700_-	hypothetical protein	NA	NA	NA	NA
WP_050586614.1\|535169_536330_+	sensor histidine kinase	NA	NA	NA	NA
WP_014417035.1\|536322_536958_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.2e-10	29.3
WP_071181559.1\|537056_539210_+	MMPL family transporter	NA	NA	NA	NA
WP_025650282.1\|539243_539966_-	gamma-glutamyl-gamma-aminobutyrate hydrolase family protein	NA	NA	NA	NA
WP_017419179.1\|540092_541721_-	ABC-F type ribosomal protection protein	Q6DMX7	Streptococcus_phage	1.1e-49	28.3
WP_017419178.1\|541997_542525_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003156057.1\|542640_543498_-	YitT family protein	NA	NA	NA	NA
WP_065180736.1\|543780_544914_+	glycerol dehydrogenase	NA	NA	NA	NA
WP_017419177.1\|545058_546270_+	Bcr/CflA family efflux MFS transporter	NA	NA	NA	NA
WP_065180737.1\|546298_547534_-	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_014417044.1\|547642_548482_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_017419175.1\|548524_549268_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_021495023.1\|549425_549884_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003156048.1\|550015_550837_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_071181560.1\|551052_551925_+	DMT family transporter	NA	NA	NA	NA
WP_071181561.1\|552088_552706_+	NUDIX hydrolase	NA	NA	NA	NA
WP_017419171.1\|552741_553524_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_017419170.1\|553571_554630_-	tartrate dehydrogenase	NA	NA	NA	NA
WP_025650286.1\|554812_555499_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_012116955.1\|555641_556835_+	UDP-glucosyltransferase	O89808	Epiphyas_postvittana_nucleopolyhedrovirus	5.1e-09	27.1
WP_071181562.1\|556892_557147_-	hypothetical protein	NA	NA	NA	NA
WP_015388621.1\|557380_557650_+	hypothetical protein	NA	NA	NA	NA
WP_071181563.1\|557783_559142_+	serine hydrolase	G1DUA7	Mycobacterium_virus	8.9e-10	23.8
WP_007409301.1\|559194_559368_-	hypothetical protein	NA	NA	NA	NA
WP_017419166.1\|559564_560131_+	YdhK family protein	NA	NA	NA	NA
WP_007409299.1\|560182_561343_-	MFS transporter	NA	NA	NA	NA
WP_017419165.1\|561674_562391_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_014417058.1\|562511_563198_+	FadR family transcriptional regulator	NA	NA	NA	NA
WP_017419164.1\|563187_564402_+	MFS transporter	NA	NA	NA	NA
WP_003156024.1\|564461_564776_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_003156023.1\|564775_565105_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_007409294.1\|565181_565763_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_017419163.1\|565879_567442_-	APC family permease	NA	NA	NA	NA
WP_014417059.1\|567679_568534_-	manganese catalase family protein	NA	NA	NA	NA
WP_017419162.1\|568645_569113_-	SRPBCC domain-containing protein	NA	NA	NA	NA
WP_025650290.1\|569240_570242_+	acryloyl-CoA reductase	NA	NA	NA	NA
WP_094246999.1\|570357_571507_+\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	2.7e-39	61.9
WP_022552683.1\|571963_573382_+	sugar porter family MFS transporter	NA	NA	NA	NA
WP_025649874.1\|579190_580168_+	thiamine-phosphate kinase	NA	NA	NA	NA
WP_014417064.1\|580183_580660_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_007408854.1\|580640_581330_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_003155993.1\|581340_581796_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_017418986.1\|581788_582829_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.2e-62	42.0
WP_017418987.1\|583051_584980_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	3.3e-58	32.1
WP_003155986.1\|585119_585632_+	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
WP_087614160.1\|586061_587211_+\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
WP_003155981.1\|587584_587755_+	twin-arginine translocase TatA/TatE family subunit	NA	NA	NA	NA
WP_007609791.1\|587761_588520_+	twin-arginine translocase subunit TatC	NA	NA	NA	NA
WP_003155975.1\|588558_588750_-	YdiK family protein	NA	NA	NA	NA
WP_003155972.1\|588746_589481_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003155970.1\|589717_590002_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	2.2e-19	51.6
WP_003155941.1\|590043_591678_+	chaperonin GroEL	A0A219YK78	uncultured_virus	3.7e-159	57.5
591660:591678	attL	NA	NA	NA	NA
WP_071181564.1\|591756_592968_-\|integrase	site-specific integrase	S6C485	Thermus_phage	2.4e-78	42.0
WP_071181565.1\|592979_593453_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	8.7e-21	33.8
WP_071181566.1\|593636_594197_-	DUF4352 domain-containing protein	A0A2H4PQN2	Staphylococcus_phage	2.1e-29	46.7
WP_071181568.1\|594486_594864_-	helix-turn-helix domain-containing protein	A0A0A7RTK4	Clostridium_phage	3.5e-12	55.9
WP_071181569.1\|595029_595281_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_071181570.1\|595293_595599_+	hypothetical protein	NA	NA	NA	NA
WP_071181571.1\|595595_596324_+	phage regulatory protein/antirepressor Ant	A0A2H4J4N4	uncultured_Caudovirales_phage	2.4e-86	63.3
WP_071181572.1\|596381_596954_+	helix-turn-helix transcriptional regulator	A0A2H4J884	uncultured_Caudovirales_phage	7.5e-59	55.0
WP_044803182.1\|596950_597208_+	hypothetical protein	A0A2H4J4M9	uncultured_Caudovirales_phage	1.1e-09	41.8
WP_044803181.1\|597204_597423_+	hypothetical protein	NA	NA	NA	NA
WP_044803180.1\|597382_597580_+	hypothetical protein	NA	NA	NA	NA
WP_071181573.1\|597681_597867_+	hypothetical protein	NA	NA	NA	NA
WP_071181574.1\|597866_598817_+	YqaJ viral recombinase family protein	A0A2H4JA52	uncultured_Caudovirales_phage	2.1e-130	71.4
WP_053574365.1\|598819_599662_+	recombinase RecT	A0A2H4JCY8	uncultured_Caudovirales_phage	2.7e-126	83.7
WP_071181575.1\|599826_600546_+	DnaD domain protein	A0A2H4J6G9	uncultured_Caudovirales_phage	1.6e-42	45.2
WP_013351199.1\|600430_601402_+	ATP-binding protein	A6XMI1	Bacillus_virus	4.1e-57	51.2
WP_013351200.1\|601398_601542_+	hypothetical protein	NA	NA	NA	NA
WP_013351202.1\|602126_602585_+	DUF1064 domain-containing protein	A0A2H4J891	uncultured_Caudovirales_phage	6.0e-59	79.3
WP_013351203.1\|602704_602857_+	hypothetical protein	A0A2H4J4N7	uncultured_Caudovirales_phage	1.2e-08	65.9
WP_003155894.1\|602938_603142_+	XtrA/YqaO family protein	A0A2H4J4M6	uncultured_Caudovirales_phage	3.4e-22	75.4
WP_013351204.1\|603173_603515_+	hypothetical protein	NA	NA	NA	NA
WP_013351205.1\|603511_603766_+	hypothetical protein	A0A2H4JA61	uncultured_Caudovirales_phage	1.1e-06	39.8
WP_013351206.1\|603770_605147_+	DNA cytosine methyltransferase	A0A1I9KFD6	Aeromonas_phage	1.2e-142	49.3
WP_071181576.1\|605158_605482_+	hypothetical protein	M5ABU9	Bacillus_phage	6.0e-05	33.7
WP_063636454.1\|605478_606156_+	dUTP diphosphatase	R9TQ23	Paenibacillus_phage	4.3e-37	46.7
WP_139850287.1\|606085_606460_+	hypothetical protein	NA	NA	NA	NA
WP_063636452.1\|606456_606684_+	hypothetical protein	A0A217EQZ3	Bacillus_phage	2.0e-23	63.5
WP_071181577.1\|606699_606882_+	hypothetical protein	A0A1P8CWX9	Bacillus_phage	5.0e-09	52.2
WP_071181578.1\|606886_607198_+	hypothetical protein	NA	NA	NA	NA
WP_071181579.1\|607197_607632_+	hypothetical protein	A0A2H4J8A0	uncultured_Caudovirales_phage	1.1e-49	71.4
WP_164461502.1\|607642_607819_+	hypothetical protein	NA	NA	NA	NA
WP_071181581.1\|608563_609079_+	sigma-70 family RNA polymerase sigma factor	A0A1L2JY33	Aeribacillus_phage	1.2e-26	42.6
WP_014304494.1\|609183_609321_+	hypothetical protein	NA	NA	NA	NA
WP_003155868.1\|609619_609832_+	helix-turn-helix domain-containing protein	A0A1Z1LZP5	Bacillus_phage	9.6e-12	52.9
WP_071181582.1\|609928_610276_+	hypothetical protein	NA	NA	NA	NA
WP_071181583.1\|610452_611208_+	hypothetical protein	A0A2H4J4R0	uncultured_Caudovirales_phage	1.6e-61	53.8
WP_071182109.1\|611194_612403_+\|terminase	PBSX family phage terminase large subunit	A0A2H4J8B0	uncultured_Caudovirales_phage	4.7e-204	85.0
WP_071181584.1\|612402_613818_+\|portal	phage portal protein	A0A2H4J4Q7	uncultured_Caudovirales_phage	2.4e-151	59.1
WP_071181585.1\|613804_614728_+\|head	phage head morphogenesis protein	A0A1Q1PVS0	Bacillus_phage	6.0e-82	51.8
WP_014304499.1\|614731_615013_+	hypothetical protein	NA	NA	NA	NA
WP_014304500.1\|615103_615685_+	DUF4355 domain-containing protein	A0A2H4J4P4	uncultured_Caudovirales_phage	1.8e-52	53.7
WP_014304501.1\|615699_616617_+\|capsid	phage major capsid protein	A0A2H4JCG0	uncultured_Caudovirales_phage	9.0e-115	68.9
WP_071181586.1\|616621_616957_+	hypothetical protein	NA	NA	NA	NA
WP_071181587.1\|616958_617231_+	hypothetical protein	NA	NA	NA	NA
WP_071181588.1\|617239_617548_+\|head,tail	phage head-tail connector protein	Q4ZC67	Staphylococcus_virus	1.3e-12	40.2
WP_071181589.1\|617544_617883_+\|head	phage head closure protein	NA	NA	NA	NA
WP_071181590.1\|617875_618292_+	HK97 gp10 family phage protein	O48447	Bacillus_phage	1.6e-31	54.2
WP_015239630.1\|618310_618709_+	DUF3168 domain-containing protein	W8EK61	Geobacillus_phage	4.9e-25	44.6
WP_071181591.1\|618722_619235_+\|tail	phage major tail protein, TP901-1 family	Q0PDK9	Bacillus_phage	5.0e-30	45.3
WP_079979749.1\|619176_619491_+	fibronectin type III domain-containing protein	Q0PDK9	Bacillus_phage	1.3e-25	75.3
WP_076983423.1\|619504_619747_+	fibronectin type III domain-containing protein	NA	NA	NA	NA
WP_053574170.1\|619804_620311_+	hypothetical protein	I6T7F0	Staphylococcus_virus	1.5e-10	32.7
WP_041481949.1\|620358_620667_+	hypothetical protein	NA	NA	NA	NA
WP_071181593.1\|620671_625813_+	hypothetical protein	M9NRJ5	Staphylococcus_phage	1.9e-36	26.5
WP_071181594.1\|625809_626574_+\|tail	phage tail family protein	NA	NA	NA	NA
WP_071181595.1\|626586_629970_+\|tail	phage tail protein	Q5YA57	Bacillus_phage	1.3e-131	46.1
WP_071181596.1\|629983_630373_+	hypothetical protein	NA	NA	NA	NA
WP_003155837.1\|630511_630679_+	XkdX family protein	NA	NA	NA	NA
WP_017417520.1\|630691_630913_+	hypothetical protein	NA	NA	NA	NA
WP_013351240.1\|630975_631254_+	hemolysin XhlA family protein	A0A2H4JD40	uncultured_Caudovirales_phage	1.1e-28	71.7
WP_014470539.1\|631269_631533_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	2.0e-27	69.0
WP_071181597.1\|631587_632748_+	N-acetylmuramoyl-L-alanine amidase	A0A1P8CWN6	Bacillus_phage	3.3e-69	65.1
WP_053574165.1\|632774_633644_-	Abi family protein	A3QSC6	Clostridium_virus	5.5e-45	36.4
WP_053574164.1\|633766_633955_-	hypothetical protein	A0A2H4J4T3	uncultured_Caudovirales_phage	4.7e-18	71.0
WP_017418988.1\|635379_636609_+	5-aminolevulinate synthase	G9E4Q1	Emiliania_huxleyi_virus	1.2e-40	30.1
634143:634161	attR	NA	NA	NA	NA

DBSCAN-SWA_2

695332 : 705223

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014417100.1\|695332_696625_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.5e-19	27.3
WP_007609852.1\|696700_697420_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3FUQ7	Synechococcus_phage	1.3e-47	44.7
WP_017419024.1\|697419_697674_+	phosphoribosylformylglycinamidine synthase subunit PurS	M4QPE7	Synechococcus_phage	2.1e-05	34.6
WP_017419025.1\|697670_698354_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_071181616.1\|698337_700566_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.2e-158	40.7
WP_007609856.1\|700541_701972_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	6.2e-54	32.7
WP_007609857.1\|702063_703104_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	6.3e-64	41.4
WP_007408902.1\|703100_703688_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-26	38.8
WP_017419028.1\|703684_705223_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.9e-77	50.5

DBSCAN-SWA_3

895053 : 992447

107

Bacillus_phage(53.49%)

capsid,integrase,protease,terminase,portal,transposase,tail,coat,holin,head,tRNA,plate

attL 921076:921096|attR 962376:962396

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025650228.1\|895053_895965_-\|protease	serine protease	NA	NA	NA	NA
WP_003155495.1\|896109_896262_-	small, acid-soluble spore protein K	NA	NA	NA	NA
WP_003155492.1\|896385_896655_+	YfhJ family protein	NA	NA	NA	NA
WP_017419151.1\|896786_897314_+	SH3 domain-containing protein	NA	NA	NA	NA
WP_017419152.1\|897399_897735_+	SdpI family protein	NA	NA	NA	NA
WP_017419153.1\|897727_898588_+	alpha/beta hydrolase	A0A0S2MV32	Mycobacterium_phage	6.5e-06	25.6
WP_003155484.1\|898798_899779_+	glycosyltransferase family 2 protein	A8CG95	Salmonella_phage	1.5e-59	39.3
WP_063636896.1\|899815_902401_+	YfhO family protein	NA	NA	NA	NA
WP_071181649.1\|902397_903381_-	metal-dependent hydrolase	NA	NA	NA	NA
WP_071181650.1\|903606_904704_+	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_017419157.1\|904710_904935_-	hypothetical protein	NA	NA	NA	NA
WP_017419158.1\|905016_905769_+	enoyl-[acyl-carrier-protein] reductase FabL	NA	NA	NA	NA
WP_007408564.1\|905834_906005_+	gamma-type small acid-soluble spore protein	NA	NA	NA	NA
WP_003155476.1\|906165_906432_+	hypothetical protein	NA	NA	NA	NA
WP_003155475.1\|906567_907098_+	DUF402 domain-containing protein	NA	NA	NA	NA
WP_017419159.1\|907180_908923_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.4e-49	28.3
WP_017419160.1\|909002_910067_-	aromatic acid exporter family protein	NA	NA	NA	NA
WP_007408567.1\|910276_911566_-	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_003155466.1\|911723_912197_+	thioredoxin-dependent thiol peroxidase	NA	NA	NA	NA
WP_003155465.1\|912321_912759_+	peroxide-responsive transcriptional repressor PerR	NA	NA	NA	NA
WP_007408568.1\|912793_913147_-	YgzB family protein	NA	NA	NA	NA
WP_014417244.1\|913349_914234_+	hypothetical protein	NA	NA	NA	NA
921076:921096	attL	NA	NA	NA	NA
WP_017417250.1\|921231_922347_-\|integrase	site-specific integrase	Q5YAA6	Bacillus_phage	1.6e-121	59.5
WP_101287896.1\|924066_924483_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_032864202.1\|924666_924855_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_017417255.1\|924897_925221_+	DUF771 domain-containing protein	Q9MBW7	Lactococcus_phage	2.0e-13	39.8
WP_017417257.1\|925461_926328_+	hypothetical protein	D2XR43	Bacillus_phage	1.1e-50	62.4
WP_017417258.1\|926311_927145_+	ATP-binding protein	Q2I8C8	Bacillus_phage	3.5e-33	34.8
WP_017417259.1\|927159_927309_+	hypothetical protein	NA	NA	NA	NA
WP_017417260.1\|927305_927464_+	hypothetical protein	A8ATM6	Listeria_phage	2.9e-05	57.8
WP_017417261.1\|927460_928009_+	hypothetical protein	A0A0K2CYJ0	Paenibacillus_phage	7.8e-05	34.9
WP_015387918.1\|928117_928258_+	BH0509 family protein	NA	NA	NA	NA
WP_015387919.1\|928270_928426_+	hypothetical protein	NA	NA	NA	NA
WP_014721584.1\|928505_928709_+	XtrA/YqaO family protein	A0A2H4J4M6	uncultured_Caudovirales_phage	9.8e-14	56.9
WP_017417264.1\|928849_929230_+	hypothetical protein	NA	NA	NA	NA
WP_017417265.1\|929226_929634_+	hypothetical protein	W8CYU3	Bacillus_phage	2.5e-24	45.0
WP_015387923.1\|929630_929888_+	hypothetical protein	F8WQ54	Bacillus_phage	9.6e-06	42.3
WP_014471503.1\|929892_931269_+	DNA cytosine methyltransferase	A0A1I9KFD6	Aeromonas_phage	4.5e-142	48.9
WP_017417266.1\|931280_931604_+	hypothetical protein	M5ABU9	Bacillus_phage	2.1e-05	34.7
WP_017417267.1\|931600_932284_+	dUTP diphosphatase	R9TQ23	Paenibacillus_phage	4.8e-36	43.3
WP_017417268.1\|932285_932546_+	hypothetical protein	NA	NA	NA	NA
WP_017417269.1\|932542_933001_+	hypothetical protein	M4ZRL6	Bacillus_phage	3.5e-51	64.3
WP_017417270.1\|933000_933219_+	hypothetical protein	NA	NA	NA	NA
WP_017417271.1\|933206_933392_+	hypothetical protein	NA	NA	NA	NA
WP_017417272.1\|933388_933592_+	hypothetical protein	A0A1P8CWX9	Bacillus_phage	2.1e-08	44.8
WP_017417274.1\|933781_934090_+	hypothetical protein	NA	NA	NA	NA
WP_026092239.1\|934086_934332_+	hypothetical protein	A0A217ERB6	Bacillus_phage	9.4e-11	46.2
WP_017417276.1\|934334_934769_+	hypothetical protein	A0A2H4J8A0	uncultured_Caudovirales_phage	4.1e-49	70.7
WP_017417277.1\|934874_935051_+	hypothetical protein	NA	NA	NA	NA
WP_017417278.1\|935069_935522_+	ArpU family transcriptional regulator	S6AVV9	Thermus_phage	3.7e-37	55.9
WP_017417279.1\|935518_936061_+\|integrase	site-specific integrase	D2XR58	Bacillus_phage	1.8e-54	59.4
WP_017417280.1\|936537_936852_+	hypothetical protein	NA	NA	NA	NA
WP_017417281.1\|936853_937135_+	hypothetical protein	NA	NA	NA	NA
WP_017417282.1\|937131_937446_+	hypothetical protein	NA	NA	NA	NA
WP_017417283.1\|937493_937862_+	hypothetical protein	NA	NA	NA	NA
WP_017417284.1\|937851_938217_+	HNH endonuclease	A0A1U7Q1S7	Geobacillus_virus	2.1e-30	55.0
WP_017417285.1\|938445_938961_+\|terminase	phage terminase small subunit P27 family	A6M947	Geobacillus_virus	7.5e-34	44.6
WP_014418487.1\|938957_940667_+\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	2.1e-205	62.6
WP_017417287.1\|940855_942136_+\|portal	phage portal protein	D6R3Y6	Bacillus_phage	2.0e-152	63.3
WP_017417288.1\|942098_942728_+\|head,protease	HK97 family phage prohead protease	Q9ZXF7	Bacillus_phage	6.3e-83	76.3
WP_071181651.1\|942766_944059_+\|capsid	phage major capsid protein	A0A0A7RTL2	Clostridium_phage	3.7e-90	46.9
WP_071181652.1\|944086_944485_+	collagen-like protein	D6R3Z0	Bacillus_phage	8.1e-12	44.2
WP_071181653.1\|944502_944805_+\|head,tail	phage gp6-like head-tail connector protein	A0A0S2GLH6	Bacillus_phage	3.6e-12	45.2
WP_071181654.1\|944794_945112_+\|head	phage head closure protein	A0A2H4JCB1	uncultured_Caudovirales_phage	1.1e-11	36.3
WP_014418479.1\|945108_945507_+	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_015387944.1\|945503_945887_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_014305137.1\|945901_946516_+\|tail	tail protein	A0A2H4J8F3	uncultured_Caudovirales_phage	2.9e-24	34.4
WP_014305136.1\|946574_946943_+	hypothetical protein	NA	NA	NA	NA
WP_017417292.1\|951630_952470_+\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	1.1e-93	57.9
WP_046559937.1\|952484_954188_+\|tail	phage tail protein	D6R400	Bacillus_phage	4.6e-181	56.7
WP_071181655.1\|954238_956803_+	peptidase G2	D6R401	Bacillus_phage	1.2e-289	57.5
WP_071181656.1\|956815_958093_+\|plate	BppU family phage baseplate upper protein	D6R402	Bacillus_phage	3.2e-142	82.8
WP_061574015.1\|958089_958473_+	hypothetical protein	Q9ZXE0	Bacillus_phage	2.0e-28	55.8
WP_017417296.1\|958474_958630_+	XkdX family protein	A0A1W6JQ64	Staphylococcus_phage	7.5e-06	53.5
WP_015239640.1\|958665_959088_+\|holin	phage holin family protein	D6R405	Bacillus_phage	3.8e-60	89.5
WP_017417297.1\|959135_960299_+	N-acetylmuramoyl-L-alanine amidase	A0A1P8CWN6	Bacillus_phage	6.6e-70	50.2
WP_017417298.1\|960312_960528_-	hypothetical protein	NA	NA	NA	NA
WP_017417299.1\|960609_961110_+	hypothetical protein	NA	NA	NA	NA
WP_017417300.1\|961252_961915_-	hypothetical protein	NA	NA	NA	NA
WP_186230137.1\|962709_963588_+	hypothetical protein	NA	NA	NA	NA
962376:962396	attR	NA	NA	NA	NA
WP_017417304.1\|963668_964376_+	hypothetical protein	NA	NA	NA	NA
WP_017417305.1\|964356_967572_+	AAA family ATPase	NA	NA	NA	NA
WP_017417306.1\|968309_968507_+	hypothetical protein	NA	NA	NA	NA
WP_079891342.1\|968460_968715_-\|coat	spore coat protein	NA	NA	NA	NA
WP_025650301.1\|968818_969511_+	Type 1 glutamine amidotransferase-like domain-containing protein	NA	NA	NA	NA
WP_065180684.1\|969812_971585_+	phosphomethylpyrimidine synthase ThiC	NA	NA	NA	NA
WP_003155431.1\|973240_973420_+	FbpB family small basic protein	NA	NA	NA	NA
WP_071181657.1\|973422_975144_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_007610211.1\|975212_976169_+	ABC transporter permease	NA	NA	NA	NA
WP_014417251.1\|976181_977087_+	ABC transporter permease	NA	NA	NA	NA
WP_025650305.1\|977083_978070_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-15	28.3
WP_014417253.1\|978062_979028_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_087614160.1\|979175_980325_+\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
WP_071181658.1\|980389_981835_-	catalase	A0A2K9L0T1	Tupanvirus	1.8e-109	41.5
WP_025650306.1\|982093_983029_+	amidohydrolase family protein	NA	NA	NA	NA
WP_014417255.1\|983251_984019_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.6e-32	36.8
WP_025650307.1\|984034_985024_+	aliphatic sulfonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_017417314.1\|985023_985857_+	ABC transporter permease	NA	NA	NA	NA
WP_071181659.1\|985881_987018_+	FMNH2-dependent alkanesulfonate monooxygenase	NA	NA	NA	NA
WP_050556568.1\|987359_987668_+	hypothetical protein	NA	NA	NA	NA
WP_007610245.1\|987759_988029_+	30S ribosomal protein S14	NA	NA	NA	NA
WP_071181660.1\|988049_988517_-	hypothetical protein	NA	NA	NA	NA
WP_003155407.1\|988513_988717_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_071181661.1\|989071_989695_-	hypothetical protein	NA	NA	NA	NA
WP_029973233.1\|989779_990940_+\|tRNA	tRNA epoxyqueuosine(34) reductase QueG	NA	NA	NA	NA
WP_071182114.1\|991016_991928_+	amidase domain-containing protein	NA	NA	NA	NA
WP_104843201.1\|991964_992447_+\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA

DBSCAN-SWA_4

1215832 : 1249423

Planktothrix_phage(16.67%)

coat,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014417415.1\|1215832_1216825_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_014417416.1\|1217568_1219203_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_014417417.1\|1219309_1220245_+	ABC transporter permease	NA	NA	NA	NA
WP_007409113.1\|1220248_1221166_+	oligopeptide ABC transporter permease OppC	NA	NA	NA	NA
WP_003155039.1\|1221178_1222255_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-16	29.9
WP_017417453.1\|1222247_1223165_+	oligopeptide ABC transporter ATP-binding protein OppF	M1HP82	Acanthocystis_turfacea_Chlorella_virus	1.5e-05	24.6
WP_079979752.1\|1223271_1224450_+	putative glycoside hydrolase	NA	NA	NA	NA
WP_003155035.1\|1224567_1225146_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003155034.1\|1225324_1225720_+	transcriptional regulator Spx	NA	NA	NA	NA
WP_014417421.1\|1225775_1226432_-	TerC family protein	W8EBD0	Pseudomonas_phage	2.2e-30	41.9
WP_003155032.1\|1226707_1227364_+	adaptor protein MecA	NA	NA	NA	NA
WP_071181701.1\|1227514_1228675_+	competence protein CoiA	NA	NA	NA	NA
WP_106067880.1\|1228902_1230732_+	oligoendopeptidase F	NA	NA	NA	NA
WP_003155026.1\|1230769_1230937_-	hypothetical protein	NA	NA	NA	NA
WP_003155024.1\|1231222_1232125_-\|protease	protease adaptor protein SpxH	NA	NA	NA	NA
WP_025649585.1\|1232121_1232520_-	thiol management oxidoreductase	NA	NA	NA	NA
WP_025649586.1\|1232748_1233435_-	lytic transglycosylase domain-containing protein	A0A1P8CWQ1	Bacillus_phage	1.8e-38	70.3
WP_014417426.1\|1233439_1234012_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_012117290.1\|1234136_1234502_+	hypothetical protein	NA	NA	NA	NA
WP_003155019.1\|1234529_1235165_+	GTP diphosphokinase	NA	NA	NA	NA
WP_003155018.1\|1235182_1235983_+	NAD kinase	NA	NA	NA	NA
WP_025649587.1\|1235997_1236891_+	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	1.4e-06	29.3
WP_017417460.1\|1236923_1237673_-	bis(5'-nucleosyl)-tetraphosphatase PrpE	A0A1V0SJW2	Klosneuvirus	3.4e-11	26.7
WP_007610641.1\|1237900_1239745_+	monovalent cation:proton antiporter family protein	NA	NA	NA	NA
WP_015417218.1\|1239994_1240702_+	thiaminase II	NA	NA	NA	NA
WP_025649590.1\|1240679_1241297_+	thiazole tautomerase TenI	NA	NA	NA	NA
WP_071181702.1\|1241280_1242390_+	glycine oxidase ThiO	NA	NA	NA	NA
WP_007409096.1\|1242386_1242590_+	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_007610655.1\|1242586_1243357_+	thiazole synthase	NA	NA	NA	NA
WP_025649592.1\|1243353_1244364_+	thiazole biosynthesis adenylyltransferase ThiF	NA	NA	NA	NA
WP_015417222.1\|1244386_1245199_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_003155001.1\|1245329_1246106_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_164461505.1\|1246197_1246812_+\|coat	spore coat protein	NA	NA	NA	NA
WP_003154997.1\|1246869_1247313_-\|coat	spore coat protein	NA	NA	NA	NA
WP_003154995.1\|1247458_1247941_-\|coat	spore coat protein	NA	NA	NA	NA
WP_015239583.1\|1248091_1248592_-\|coat	spore coat protein	NA	NA	NA	NA
WP_015239584.1\|1248684_1248999_-	hypothetical protein	NA	NA	NA	NA
WP_003154992.1\|1249036_1249423_-\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_5

1261180 : 1298075

Bacillus_phage(50.0%)

integrase,portal,transposase,tail,head

attL 1261069:1261113|attR 1305092:1305136

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1261069:1261113	attL	NA	NA	NA	NA
WP_071181703.1\|1261180_1262311_-\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	4.5e-55	36.8
WP_017417528.1\|1262332_1262995_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_017417529.1\|1263198_1263423_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_017417530.1\|1263612_1264575_+	hypothetical protein	NA	NA	NA	NA
WP_017417531.1\|1264611_1264746_+	lysogeny pheromone AimP family peptide	NA	NA	NA	NA
WP_017417532.1\|1264846_1265764_+	hypothetical protein	A0A1P8CWU6	Bacillus_phage	6.6e-142	89.9
WP_017417533.1\|1265765_1265948_+	hypothetical protein	NA	NA	NA	NA
WP_017417534.1\|1265944_1266490_+	hypothetical protein	NA	NA	NA	NA
WP_017417535.1\|1266486_1266999_+	hypothetical protein	NA	NA	NA	NA
WP_017417536.1\|1267008_1268064_+	hypothetical protein	NA	NA	NA	NA
WP_079979753.1\|1268296_1271284_+	hypothetical protein	O64076	Bacillus_phage	8.6e-223	47.0
WP_014417453.1\|1271611_1271830_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_014417454.1\|1272243_1272390_+	hypothetical protein	NA	NA	NA	NA
WP_017417539.1\|1272417_1272894_+	hypothetical protein	O64060	Bacillus_phage	1.7e-32	45.5
WP_017417540.1\|1272893_1273607_+	hypothetical protein	A0A1P8CWQ7	Bacillus_phage	7.4e-48	42.4
WP_071181704.1\|1273630_1274416_+	hypothetical protein	A0A1P8CWR0	Bacillus_phage	5.0e-37	49.0
WP_017417542.1\|1274424_1275012_+	hypothetical protein	A0A1P8CWQ5	Bacillus_phage	1.3e-37	47.8
WP_014417458.1\|1275011_1275239_+	hypothetical protein	NA	NA	NA	NA
WP_014417459.1\|1275273_1275747_+	hypothetical protein	A0A1P8CWQ6	Bacillus_phage	6.5e-24	38.7
WP_017417543.1\|1275950_1276100_+	hypothetical protein	NA	NA	NA	NA
WP_014721012.1\|1276339_1276552_+	helix-turn-helix domain-containing protein	A0A1Z1LZP5	Bacillus_phage	4.5e-09	51.6
WP_071181705.1\|1276635_1277049_+\|transposase	transposase	NA	NA	NA	NA
WP_031600262.1\|1277135_1278383_+\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
WP_014417461.1\|1278436_1279000_-	recombinase family protein	A0A0A8WIK3	Clostridium_phage	3.7e-42	50.5
WP_014417462.1\|1279352_1281110_+	hypothetical protein	A0A1V0DZW7	Clostridioides_phage	3.5e-147	46.5
WP_014417463.1\|1281124_1282459_+\|portal	phage portal protein	I1TJV4	Clostridium_phage	2.3e-42	31.1
WP_014417464.1\|1282566_1283166_+	DUF4355 domain-containing protein	A0A2H4J4P4	uncultured_Caudovirales_phage	4.0e-31	44.5
WP_014417465.1\|1283194_1284013_+	hypothetical protein	E5DV53	Deep-sea_thermophilic_phage	3.8e-56	43.3
WP_014417466.1\|1284074_1284221_+	hypothetical protein	NA	NA	NA	NA
WP_025649600.1\|1284220_1284538_+\|head,tail	phage head-tail connector protein	NA	NA	NA	NA
WP_025649601.1\|1284548_1284887_+	hypothetical protein	NA	NA	NA	NA
WP_031600262.1\|1289260_1290508_+\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
WP_031600262.1\|1293011_1294259_-\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
WP_154019386.1\|1295044_1295191_+	hypothetical protein	NA	NA	NA	NA
WP_025649603.1\|1295180_1295633_+	putative toxin-antitoxin system toxin component, PIN family	NA	NA	NA	NA
WP_014417468.1\|1295948_1296680_+	hypothetical protein	NA	NA	NA	NA
WP_031600262.1\|1296827_1298075_-\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
1305092:1305136	attR	NA	NA	NA	NA

DBSCAN-SWA_6

1366069 : 1380909

uncultured_Caudovirales_phage(37.5%)

terminase,portal,holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_094246999.1\|1366069_1367219_+\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	2.7e-39	61.9
WP_025649636.1\|1367276_1368041_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_017417598.1\|1368189_1368657_-	DinB family protein	NA	NA	NA	NA
WP_087920760.1\|1368861_1369998_+	S9 family peptidase	A0A1P8CWN8	Bacillus_phage	1.3e-94	47.9
WP_003154881.1\|1369987_1370122_+	PhrA family phosphatase inhibitor	NA	NA	NA	NA
WP_017417599.1\|1370264_1371218_+	N-acetylmuramoyl-L-alanine amidase	A0A218KC88	Bacillus_phage	2.4e-62	69.3
WP_017417600.1\|1371255_1371633_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	1.1e-15	38.5
WP_017417601.1\|1371742_1372348_+	poly-gamma-glutamate hydrolase family protein	A0A0Y0AJU6	Bacillus_phage	6.1e-43	48.3
WP_003154873.1\|1372502_1373093_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	3.0e-39	51.7
WP_013351934.1\|1373241_1373580_-	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	9.9e-19	49.2
WP_013351935.1\|1373770_1373950_+	hypothetical protein	NA	NA	NA	NA
WP_071181721.1\|1373939_1374767_+\|portal	phage portal protein	S6BFM4	Thermus_phage	1.6e-17	47.1
WP_017417604.1\|1374666_1375467_+	ATP-binding protein	A6XMI1	Bacillus_virus	2.3e-58	44.9
WP_003154863.1\|1375466_1375634_+	hypothetical protein	NA	NA	NA	NA
WP_039251797.1\|1375731_1376073_+	hypothetical protein	NA	NA	NA	NA
WP_003154859.1\|1376062_1376266_+	XtrA/YqaO family protein	A0A2H4J4M6	uncultured_Caudovirales_phage	5.4e-12	48.5
WP_007407279.1\|1376371_1376884_+	sigma-70 family RNA polymerase sigma factor	A0A0K2CNQ1	Brevibacillus_phage	3.8e-22	44.6
WP_071181722.1\|1376996_1377656_+\|terminase	terminase	A0A1B1P867	Bacillus_phage	1.2e-07	34.2
WP_038457736.1\|1378033_1378405_+	YomQ/XkdW protein, phage-like element PBSX	NA	NA	NA	NA
WP_007610833.1\|1378409_1378607_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	7.3e-14	61.8
WP_063636818.1\|1378663_1379425_+	hypothetical protein	NA	NA	NA	NA
WP_021493821.1\|1379476_1379740_+	hemolysin XhlA family protein	A0A2H4JD40	uncultured_Caudovirales_phage	2.1e-24	65.5
WP_003154813.1\|1379753_1380017_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	2.3e-23	65.5
WP_007407257.1\|1380030_1380909_+	N-acetylmuramoyl-L-alanine amidase	Q9ZXD7	Bacillus_phage	3.7e-81	60.5

DBSCAN-SWA_7

1864996 : 1958354

Bacillus_phage(52.17%)

integrase,transposase,coat,holin,tRNA

attL 1860330:1860345|attR 1954564:1954579

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1860330:1860345	attL	NA	NA	NA	NA
WP_025649446.1\|1864996_1866526_+\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
WP_003154113.1\|1866528_1866960_+	RicAFT regulatory complex protein RicA family protein	NA	NA	NA	NA
WP_003154111.1\|1867212_1867758_+\|coat	outer spore coat protein CotE	NA	NA	NA	NA
WP_025649445.1\|1867876_1870462_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	5.1e-38	24.2
WP_017417802.1\|1870477_1872355_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	2.4e-69	31.5
WP_025649444.1\|1873397_1874129_+	hypothetical protein	NA	NA	NA	NA
WP_021493661.1\|1874552_1874762_-	hypothetical protein	NA	NA	NA	NA
WP_014721196.1\|1875251_1875464_+	hypothetical protein	NA	NA	NA	NA
WP_003154103.1\|1875447_1876125_+	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	1.4e-11	26.3
WP_017417808.1\|1877444_1878419_+	acyltransferase domain-containing protein	NA	NA	NA	NA
WP_025649443.1\|1878420_1880661_+	ACP S-malonyltransferase	NA	NA	NA	NA
WP_014417817.1\|1880726_1880975_+	acyl carrier protein	NA	NA	NA	NA
WP_017417811.1\|1881026_1882289_+	hydroxymethylglutaryl-CoA synthase family protein	NA	NA	NA	NA
WP_025649442.1\|1882285_1883059_+	enoyl-CoA hydratase/isomerase	NA	NA	NA	NA
WP_087614160.1\|1885812_1886962_+\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
WP_071181772.1\|1903335_1919637_+	non-ribosomal peptide synthetase	D0R7J2	Paenibacillus_phage	7.2e-122	58.5
WP_071181773.1\|1919650_1927108_+	polyketide synthase dehydratase domain-containing protein	D0R7J2	Paenibacillus_phage	5.0e-38	30.1
WP_025649439.1\|1927243_1928455_-	cytochrome P450	NA	NA	NA	NA
WP_007611576.1\|1928743_1929178_+	sporulation protein	F8WPS9	Bacillus_phage	5.5e-38	55.7
WP_003154084.1\|1929237_1929993_+	DUF1275 domain-containing protein	NA	NA	NA	NA
WP_007410383.1\|1930026_1930389_-	hypothetical protein	NA	NA	NA	NA
WP_065180799.1\|1930580_1931909_-	S8 family peptidase	A0A1B0T6A2	Bacillus_phage	8.4e-29	34.2
WP_021493648.1\|1932087_1932321_+	hypothetical protein	NA	NA	NA	NA
WP_014417828.1\|1932577_1933285_+	poly-gamma-glutamate hydrolase family protein	F8WQ53	Bacillus_phage	5.4e-51	54.6
WP_014305039.1\|1933344_1933797_+	OsmC family protein	NA	NA	NA	NA
WP_032865393.1\|1933834_1934164_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_003154071.1\|1934180_1934495_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_017417820.1\|1934632_1934923_-	hypothetical protein	NA	NA	NA	NA
WP_014417831.1\|1935024_1935429_+	hypothetical protein	NA	NA	NA	NA
WP_017417822.1\|1935527_1936472_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_003154064.1\|1936511_1936733_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_017417823.1\|1936829_1937105_+	hypothetical protein	NA	NA	NA	NA
WP_003154062.1\|1937187_1937403_+	hypothetical protein	NA	NA	NA	NA
WP_071181774.1\|1937662_1938055_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	1.1e-29	59.1
WP_007611605.1\|1938014_1940117_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	85.7
WP_012117608.1\|1940134_1941124_+	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.1e-155	83.0
WP_017417824.1\|1941172_1941790_+	hypothetical protein	A0A127AYS1	Bacillus_phage	2.1e-46	47.9
WP_087614160.1\|1941853_1943004_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
WP_017417825.1\|1943132_1943891_-	N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	3.1e-52	50.0
WP_017417826.1\|1944197_1945166_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	8.0e-53	40.9
WP_071181775.1\|1945295_1946558_+	GTPase HflX	NA	NA	NA	NA
WP_017417828.1\|1946574_1947840_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_007611631.1\|1947949_1948354_+	transcriptional repressor GlnR	NA	NA	NA	NA
WP_025649426.1\|1948411_1949746_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_013352364.1\|1949865_1951011_-\|integrase	site-specific integrase	A0A0M5M609	Bacillus_phage	8.8e-67	38.7
WP_071182120.1\|1951267_1952023_+	hypothetical protein	NA	NA	NA	NA
WP_031600262.1\|1952095_1953343_+\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
WP_071181776.1\|1953602_1954577_-	thermonuclease family protein	A0A1P8CWK6	Bacillus_phage	2.5e-78	77.7
WP_071181777.1\|1954751_1956467_+	ribonuclease YeeF family protein	O64023	Bacillus_phage	1.7e-252	76.2
1954564:1954579	attR	NA	NA	NA	NA
WP_071181778.1\|1956475_1956973_+	SMI1/KNR4 family protein	O64024	Bacillus_phage	1.3e-86	87.9
WP_076982784.1\|1957207_1957297_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_063636675.1\|1957521_1957989_+	DUF4879 domain-containing protein	O64027	Bacillus_phage	8.0e-43	56.5
WP_021493945.1\|1957994_1958354_+	hypothetical protein	O64028	Bacillus_phage	7.5e-33	61.4

DBSCAN-SWA_8

1961698 : 1970702

Bacillus_phage(100.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065180792.1\|1961698_1962031_+	YolD-like family protein	A0A1P8CWP2	Bacillus_phage	3.4e-40	72.7
WP_062623501.1\|1962023_1963274_+	UV damage repair protein UvrX	O64031	Bacillus_phage	1.5e-221	91.1
WP_079891309.1\|1963437_1964598_-	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	3.8e-33	26.3
WP_041482578.1\|1964749_1965010_-	hypothetical protein	NA	NA	NA	NA
WP_014417851.1\|1965365_1965617_-\|holin	phage holin	A0A1P8CWN5	Bacillus_phage	5.2e-33	86.7
WP_045208155.1\|1965629_1966001_-	hypothetical protein	NA	NA	NA	NA
WP_045207998.1\|1966107_1967151_-	N-acetylmuramoyl-L-alanine amidase family protein	A0A1J0MS59	Bacillus_phage	6.1e-91	56.1
WP_079979758.1\|1967323_1969873_-	hypothetical protein	D6R401	Bacillus_phage	1.8e-141	36.0
WP_071181779.1\|1969886_1970702_-	hypothetical protein	A0A1P8CWP7	Bacillus_phage	4.6e-94	62.8

DBSCAN-SWA_9

1974839 : 1991939

Bacillus_phage(90.91%)

integrase,tail

attL 1981997:1982014|attR 2001768:2001785

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071181780.1\|1974839_1981739_-\|tail	phage tail tape measure protein	A0A1P8CWQ1	Bacillus_phage	0.0e+00	74.5
WP_071181781.1\|1981802_1982429_-	hypothetical protein	A0A0H3UZD5	Geobacillus_virus	4.7e-22	31.9
1981997:1982014	attL	NA	NA	NA	NA
WP_071181782.1\|1982585_1983017_-	protein-export chaperone SecB	NA	NA	NA	NA
WP_071181783.1\|1983018_1983285_-	hypothetical protein	NA	NA	NA	NA
WP_071181784.1\|1983241_1983832_-	hypothetical protein	NA	NA	NA	NA
WP_046560223.1\|1984059_1984275_-	hypothetical protein	NA	NA	NA	NA
WP_014472041.1\|1984319_1985321_-\|integrase	site-specific integrase	A0A1P8CWP6	Bacillus_phage	2.2e-170	86.7
WP_014472040.1\|1985334_1985751_-	hypothetical protein	A0A1P8CWQ4	Bacillus_phage	1.4e-46	68.3
WP_014472039.1\|1985750_1986236_-	hypothetical protein	A0A1P8CWQ6	Bacillus_phage	8.3e-59	72.3
WP_071181785.1\|1986318_1987167_-	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_014470095.1\|1987185_1987338_-	XkdX family protein	NA	NA	NA	NA
WP_057080548.1\|1987338_1987614_-	hypothetical protein	M4ZR44	Bacillus_phage	4.0e-10	37.2
WP_071181787.1\|1987627_1988959_-	hypothetical protein	A0A1P8CWR7	Bacillus_phage	3.1e-23	41.4
WP_022553073.1\|1988958_1989315_-	hypothetical protein	O64055	Bacillus_phage	8.2e-48	79.7
WP_071181788.1\|1989386_1989854_-	hypothetical protein	NA	NA	NA	NA
WP_071181789.1\|1989874_1990672_-	hypothetical protein	A0A1P8CWR0	Bacillus_phage	4.4e-17	35.5
WP_071181790.1\|1990710_1991436_-	hypothetical protein	A0A1P8CWQ7	Bacillus_phage	7.3e-27	32.7
WP_071181791.1\|1991432_1991939_-	hypothetical protein	O64060	Bacillus_phage	2.6e-63	67.3
2001768:2001785	attR	NA	NA	NA	NA

DBSCAN-SWA_10

2427621 : 2433874

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007409428.1\|2427621_2428215_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.6e-14	36.6
WP_007409427.1\|2428204_2428960_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	2.9e-10	25.7
WP_003153376.1\|2429167_2429257_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_025649807.1\|2429344_2429866_+	DUF309 domain-containing protein	NA	NA	NA	NA
WP_003153373.1\|2429931_2430306_-	GNAT family N-acetyltransferase RibT	NA	NA	NA	NA
WP_003153372.1\|2430422_2430887_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.2e-43	59.3
WP_003153371.1\|2430919_2432116_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.1e-116	54.9
WP_029973636.1\|2432130_2432778_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	8.8e-40	44.3
WP_029973635.1\|2432758_2433874_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	5.7e-55	36.3

DBSCAN-SWA_11

2796116 : 2904237

113

Bacillus_phage(64.15%)

capsid,protease,terminase,portal,tail,coat,holin,head,tRNA,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071181868.1\|2796116_2796881_-\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	A0A291ATS8	Pandoravirus	1.4e-20	33.0
WP_071181869.1\|2797206_2798985_-\|tRNA	aspartate--tRNA ligase	A0A1V0SIS0	Klosneuvirus	8.7e-13	29.1
WP_017418229.1\|2798999_2800274_-\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
WP_094247699.1\|2800630_2800801_-	YrzK family protein	NA	NA	NA	NA
WP_071181870.1\|2800931_2802494_+	SH3 domain-containing protein	E5DV68	Deep-sea_thermophilic_phage	1.2e-13	33.3
WP_007408194.1\|2802521_2802965_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_071181871.1\|2802977_2805182_-	GTP diphosphokinase	A0A2I2L310	Orpheovirus	1.5e-09	34.8
WP_003152714.1\|2805339_2805852_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	5.5e-29	47.2
WP_025649678.1\|2805857_2808218_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.5e-89	34.6
WP_003152709.1\|2808273_2808600_-	DUF1049 domain-containing protein	NA	NA	NA	NA
WP_012118088.1\|2808663_2809161_-	cation:proton antiporter regulatory subunit	NA	NA	NA	NA
WP_071181872.1\|2809291_2811514_-	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	2.0e-27	31.7
WP_007408189.1\|2811550_2811847_-	post-transcriptional regulator	NA	NA	NA	NA
WP_025649680.1\|2811962_2813519_+	stage V sporulation protein B	NA	NA	NA	NA
WP_003152699.1\|2813526_2814183_-	DUF421 domain-containing protein	NA	NA	NA	NA
WP_003152697.1\|2814349_2814736_+	TIGR04086 family membrane protein	NA	NA	NA	NA
WP_007408187.1\|2814787_2815048_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.9e-06	46.9
WP_071181873.1\|2815078_2816224_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.6e-89	45.1
WP_003152692.1\|2816251_2817280_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_003152687.1\|2817305_2817506_-	DUF2905 domain-containing protein	NA	NA	NA	NA
WP_003152685.1\|2817498_2818503_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	4.0e-07	30.0
WP_003152683.1\|2818513_2819119_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_012118093.1\|2819253_2819763_-	intercompartmental signaling factor BofC	NA	NA	NA	NA
WP_071181874.1\|2819895_2820135_-	hypothetical protein	NA	NA	NA	NA
WP_014721606.1\|2820147_2820741_-	YhcN/YlaJ family sporulation lipoprotein	NA	NA	NA	NA
WP_071181875.1\|2820888_2822094_-\|coat	SafA/ExsA family spore coat assembly protein	NA	NA	NA	NA
WP_071181876.1\|2822220_2823324_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_071181877.1\|2823325_2824174_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_071181878.1\|2824155_2825721_-	L-aspartate oxidase	NA	NA	NA	NA
WP_017418243.1\|2825827_2826979_+	IscS subfamily cysteine desulfurase	A0A141ZJV0	Faustovirus	2.3e-30	29.6
WP_014418541.1\|2827028_2827571_+	transcription repressor NadR	NA	NA	NA	NA
WP_003152668.1\|2827596_2828454_-	prephenate dehydratase	NA	NA	NA	NA
WP_007408173.1\|2828467_2828911_-	transcriptional regulator ThrR	NA	NA	NA	NA
WP_017418244.1\|2828964_2830251_-	GTPase ObgE	NA	NA	NA	NA
WP_014418543.1\|2830282_2830861_-	sporulation initiation phosphotransferase B	NA	NA	NA	NA
WP_003152662.1\|2831178_2831463_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_012118103.1\|2831475_2831817_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_003152660.1\|2831819_2832128_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_017418245.1\|2832273_2833140_-	M50 family metallopeptidase	NA	NA	NA	NA
WP_017418246.1\|2833132_2833936_-	M23 family metallopeptidase	NA	NA	NA	NA
WP_003152655.1\|2834063_2834867_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_003152653.1\|2834869_2835550_-	septum site-determining protein MinC	NA	NA	NA	NA
WP_007408167.1\|2835603_2836122_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_016938781.1\|2836118_2836982_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_003152647.1\|2837012_2838026_-	rod shape-determining protein MreB	NA	NA	NA	NA
WP_164967575.1\|2838702_2838852_-	PhrK family phosphatase-inhibitory pheromone	Q9ZXD2	Bacillus_phage	1.8e-09	91.9
WP_071181879.1\|2838852_2839965_-	tetratricopeptide repeat protein	D6R410	Bacillus_phage	6.3e-203	96.5
WP_071181880.1\|2840264_2841845_+	hypothetical protein	A0A1P8CWI7	Bacillus_phage	1.4e-67	54.8
WP_071181881.1\|2841859_2842249_+	hypothetical protein	NA	NA	NA	NA
WP_071181882.1\|2842487_2843321_+	hypothetical protein	NA	NA	NA	NA
WP_071181883.1\|2843353_2844325_-	peptidoglycan-binding protein	A0A218KC88	Bacillus_phage	1.2e-64	69.7
WP_013353490.1\|2844372_2844795_-\|holin	phage holin family protein	D6R405	Bacillus_phage	2.7e-58	87.9
WP_071181884.1\|2844845_2845034_-	XkdX family protein	Q9ZXD9	Bacillus_phage	2.6e-29	95.2
WP_071181885.1\|2845030_2845393_-	hypothetical protein	Q9ZXE0	Bacillus_phage	1.6e-54	91.6
WP_071181886.1\|2845389_2846622_-\|plate	phage baseplate upper protein	D6R402	Bacillus_phage	9.9e-141	84.6
WP_071181887.1\|2846634_2849199_-	peptidase G2	D6R401	Bacillus_phage	5.9e-289	57.1
WP_071181888.1\|2849249_2850953_-\|tail	phage tail protein	D6R400	Bacillus_phage	8.7e-180	56.5
WP_071181889.1\|2850967_2851807_-\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	4.0e-93	57.6
WP_071181890.1\|2851800_2856288_-\|tail	phage tail tape measure protein	A0A1Q1PVX7	Staphylococcus_phage	1.1e-64	42.5
WP_049627390.1\|2856493_2856862_-	hypothetical protein	NA	NA	NA	NA
WP_014418477.1\|2856920_2857535_-\|tail	tail protein	A0A2H4J8F3	uncultured_Caudovirales_phage	1.1e-23	33.9
WP_049627391.1\|2857549_2857933_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_014305139.1\|2857929_2858328_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_071181891.1\|2858324_2858642_-\|head	phage head closure protein	A0A2H4JCB1	uncultured_Caudovirales_phage	4.2e-11	34.3
WP_071181892.1\|2858631_2858934_-\|head,tail	phage gp6-like head-tail connector protein	A0A0S2GLH6	Bacillus_phage	6.8e-11	40.5
WP_046559943.1\|2858951_2859359_-	phage protein	D6R3Z0	Bacillus_phage	9.8e-13	48.2
WP_046559944.1\|2859386_2860679_-\|capsid	phage major capsid protein	A0A0A7RTL2	Clostridium_phage	1.7e-90	47.8
WP_071181893.1\|2860717_2861344_-\|head,protease	HK97 family phage prohead protease	Q9ZXF7	Bacillus_phage	1.1e-82	77.2
WP_015387940.1\|2861306_2862587_-\|portal	phage portal protein	D6R3Y6	Bacillus_phage	3.4e-152	63.3
WP_071181894.1\|2862775_2864485_-\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	2.1e-205	62.6
WP_071181895.1\|2864481_2864997_-\|terminase	phage terminase small subunit P27 family	A6M947	Geobacillus_virus	2.0e-34	45.2
WP_015387938.1\|2865223_2865589_-	HNH endonuclease	A0A1U7Q1S7	Geobacillus_virus	7.9e-30	54.2
WP_015387937.1\|2865578_2865947_-	hypothetical protein	NA	NA	NA	NA
WP_071181896.1\|2865994_2866309_-	hypothetical protein	NA	NA	NA	NA
WP_071181897.1\|2866305_2866587_-	hypothetical protein	NA	NA	NA	NA
WP_071181898.1\|2866733_2867177_-	hypothetical protein	NA	NA	NA	NA
WP_071181899.1\|2867193_2868069_-	hypothetical protein	NA	NA	NA	NA
WP_046559952.1\|2868209_2868422_-	helix-turn-helix domain-containing protein	A0A1Z1LZP5	Bacillus_phage	8.4e-08	45.0
WP_164967576.1\|2868677_2868827_-	hypothetical protein	NA	NA	NA	NA
WP_019260088.1\|2869250_2869628_-	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	9.0e-61	99.2
WP_071181901.1\|2870141_2870657_-	hypothetical protein	D6R425	Bacillus_phage	5.3e-96	98.2
WP_071181902.1\|2870686_2871226_-	ERCC4 domain-containing protein	Q9ZXC2	Bacillus_phage	3.8e-97	99.4
WP_071181903.1\|2871222_2871660_-	hypothetical protein	Q9ZXC3	Bacillus_phage	6.3e-74	93.1
WP_071181904.1\|2871859_2874277_-	DNA primase	D6R422	Bacillus_phage	0.0e+00	93.1
WP_046559959.1\|2874338_2874776_-	DUF669 domain-containing protein	Q9ZXC5	Bacillus_phage	1.1e-78	96.6
WP_071181905.1\|2874796_2875108_-	hypothetical protein	Q9ZXC6	Bacillus_phage	3.5e-34	73.1
WP_071181906.1\|2875097_2876033_-	AAA family ATPase	Q9ZXC7	Bacillus_phage	1.5e-173	99.0
WP_071181907.1\|2876036_2876591_-	host-nuclease inhibitor Gam family protein	Q9ZXC8	Bacillus_phage	2.6e-93	95.7
WP_071181908.1\|2876792_2877062_-	hypothetical protein	Q9ZXC9	Bacillus_phage	1.2e-43	96.6
WP_164967577.1\|2877048_2877219_-	hypothetical protein	Q9ZXD0	Bacillus_phage	3.0e-24	96.4
WP_046559963.1\|2877287_2877560_-	helix-turn-helix transcriptional regulator	D6R414	Bacillus_phage	2.3e-42	100.0
WP_046559964.1\|2877821_2878256_+	helix-turn-helix transcriptional regulator	Q786F1	Bacillus_phage	3.0e-68	99.3
WP_015968241.1\|2878269_2878716_+	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	2.4e-81	100.0
WP_015968240.1\|2878761_2880186_+	recombinase family protein	Q9T200	Bacillus_phage	1.5e-270	100.0
WP_071181909.1\|2880637_2881207_-	septum formation inhibitor Maf	NA	NA	NA	NA
WP_071181910.1\|2881347_2882349_-	SPOR domain-containing protein	NA	NA	NA	NA
WP_071181911.1\|2882475_2883228_-	prepilin peptidase	NA	NA	NA	NA
WP_025649688.1\|2883368_2884661_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_017418286.1\|2884719_2887362_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	2.8e-161	42.3
WP_003152639.1\|2887814_2888006_+	hypothetical protein	NA	NA	NA	NA
WP_025649689.1\|2888020_2889043_-\|coat	spore coat protein YsxE	NA	NA	NA	NA
WP_025649690.1\|2889076_2890960_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_014418553.1\|2891092_2892382_-	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_025649692.1\|2892410_2893385_-	porphobilinogen synthase	NA	NA	NA	NA
WP_017418290.1\|2893390_2894170_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_012118114.1\|2894159_2895101_-	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_007408154.1\|2895135_2895966_-	cytochrome c biogenesis protein	NA	NA	NA	NA
WP_003152628.1\|2895973_2897341_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_017418292.1\|2897534_2898026_+	hypothetical protein	NA	NA	NA	NA
WP_003152626.1\|2898058_2898646_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_007612896.1\|2898642_2900967_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.4e-183	44.2
WP_014418557.1\|2901165_2902824_-\|protease	ATP-dependent protease LonB	A0A167RA83	Powai_lake_megavirus	1.9e-14	32.7
WP_007408149.1\|2902974_2904237_-\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	4.2e-147	65.3

DBSCAN-SWA_12

3315341 : 3408329

103

Bacillus_phage(35.56%)

capsid,integrase,protease,terminase,portal,transposase,tail,coat,holin,head,plate

attL 3349350:3349367|attR 3386165:3386182

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087634931.1\|3315341_3316358_-\|coat	spore coat protein YutH	NA	NA	NA	NA
WP_003151934.1\|3316512_3317013_+	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	6.8e-40	58.4
WP_017419456.1\|3317039_3317810_-	TIGR01457 family HAD-type hydrolase	NA	NA	NA	NA
WP_017419457.1\|3317843_3318278_-	DUF86 domain-containing protein	NA	NA	NA	NA
WP_003151928.1\|3318303_3318579_-	YutD family protein	NA	NA	NA	NA
WP_003151923.1\|3318796_3319693_-	lipoyl synthase	NA	NA	NA	NA
WP_071181957.1\|3319894_3320872_+	M23 family metallopeptidase	A0A1J0MFP9	Staphylococcus_phage	3.5e-08	36.9
WP_017419459.1\|3320909_3321668_-	sporulation protein YunB	NA	NA	NA	NA
WP_025650194.1\|3321800_3323189_-	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_007613562.1\|3323206_3324028_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_071181958.1\|3324047_3324899_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_007408736.1\|3324925_3325279_-	hypothetical protein	NA	NA	NA	NA
WP_071181959.1\|3325351_3326716_-	allantoinase	NA	NA	NA	NA
WP_071181960.1\|3326895_3328491_+	PucR family transcriptional regulator	NA	NA	NA	NA
WP_071181961.1\|3328628_3329546_+	hypothetical protein	NA	NA	NA	NA
WP_071181962.1\|3329662_3329857_-	hypothetical protein	NA	NA	NA	NA
WP_071181963.1\|3329889_3331086_-	MFS transporter	A0A2H4UVM2	Bodo_saltans_virus	4.5e-05	20.5
WP_061862543.1\|3331207_3332461_-	alanine--glyoxylate aminotransferase family protein	NA	NA	NA	NA
WP_017418979.1\|3332479_3333721_-	allantoate deiminase	NA	NA	NA	NA
WP_025650316.1\|3333920_3334790_+	endonuclease	NA	NA	NA	NA
WP_025650317.1\|3334839_3335946_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	Q6GZ03	Mycoplasma_phage	7.3e-18	46.1
WP_014418812.1\|3336101_3336830_+	transcriptional regulator PhoB	NA	NA	NA	NA
WP_063637106.1\|3336854_3337709_-	fructoselysine 6-kinase	NA	NA	NA	NA
WP_063637105.1\|3337722_3338607_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_023357120.1\|3338610_3339489_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_025650319.1\|3339525_3340791_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_025650320.1\|3340864_3341851_-	SIS domain-containing protein	A0A2L2DN46	Acanthamoeba_polyphaga_mimivirus	7.7e-11	24.8
WP_071181964.1\|3342047_3342974_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_071181965.1\|3343007_3343598_-	sporulation delaying protein family toxin	NA	NA	NA	NA
WP_017418970.1\|3343590_3344535_-	membrane protein	NA	NA	NA	NA
WP_017418969.1\|3344531_3345062_-	SdpA family antimicrobial peptide system protein	NA	NA	NA	NA
WP_007410095.1\|3345187_3345460_+	DUF1648 domain-containing protein	NA	NA	NA	NA
WP_007410094.1\|3345498_3345873_-	nucleotide excision repair endonuclease	NA	NA	NA	NA
WP_071181966.1\|3345939_3347055_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_025650321.1\|3347092_3347794_-	class I SAM-dependent methyltransferase	A0A097BYE1	Leuconostoc_phage	1.6e-10	28.0
WP_071181967.1\|3347867_3348329_+	DUF2691 family protein	NA	NA	NA	NA
WP_029325847.1\|3348465_3349302_+	chitosanase	A0A223LHY0	Streptomyces_phage	3.4e-20	31.4
3349350:3349367	attL	NA	NA	NA	NA
WP_071181968.1\|3349745_3349988_-	helix-turn-helix domain-containing protein	A0A2H4JDR0	uncultured_Caudovirales_phage	1.4e-19	62.0
WP_071181969.1\|3350424_3351396_-	peptidoglycan-binding protein	A0A218KC88	Bacillus_phage	1.3e-63	65.3
WP_071181970.1\|3351441_3351864_-\|holin	holin family protein	D6R405	Bacillus_phage	2.3e-65	98.5
WP_064115584.1\|3351915_3352104_-	XkdX family protein	Q9ZXD9	Bacillus_phage	1.2e-29	95.2
WP_013353492.1\|3352100_3352463_-	hypothetical protein	Q9ZXE0	Bacillus_phage	5.1e-53	89.1
WP_071181971.1\|3352459_3353641_-\|plate	phage baseplate upper protein	D6R402	Bacillus_phage	4.5e-143	73.4
WP_071181972.1\|3353653_3356218_-	peptidase G2	D6R401	Bacillus_phage	4.7e-286	56.9
WP_017418250.1\|3356250_3357969_-\|tail	phage tail protein	D6R400	Bacillus_phage	7.6e-224	69.2
WP_017418251.1\|3357981_3358818_-\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	3.0e-109	69.0
WP_017418252.1\|3358832_3362579_-\|tail	phage tail tape measure protein	A0A2H4JA91	uncultured_Caudovirales_phage	4.4e-107	64.2
WP_017418253.1\|3362641_3362824_-	hypothetical protein	NA	NA	NA	NA
WP_017418254.1\|3362835_3363198_-	hypothetical protein	NA	NA	NA	NA
WP_017418255.1\|3363255_3363834_-	UDP-N-acetylmuramoylalanine--D-glutamate ligase	J7KKC8	Streptococcus_phage	1.8e-31	41.0
WP_017418256.1\|3363852_3364242_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_017418257.1\|3364238_3364628_-	HK97 gp10 family phage protein	I7A9A4	Enterococcus_phage	2.6e-10	36.7
WP_013353503.1\|3364627_3364954_-\|head	phage head closure protein	NA	NA	NA	NA
WP_014472232.1\|3364943_3365237_-\|head,tail	phage gp6-like head-tail connector protein	A0A2H4JB77	uncultured_Caudovirales_phage	8.6e-11	39.6
WP_014472233.1\|3365287_3365737_-	hypothetical protein	D6R3Z0	Bacillus_phage	1.6e-11	62.0
WP_014472234.1\|3365764_3366961_-\|capsid	phage major capsid protein	A0A2H4J312	uncultured_Caudovirales_phage	2.2e-76	49.7
WP_047936177.1\|3367009_3367606_-\|head,protease	HK97 family phage prohead protease	A0A1J0MFL1	Staphylococcus_phage	4.7e-48	53.6
WP_047936178.1\|3367598_3368825_-\|portal	phage portal protein	A0A2H4J331	uncultured_Caudovirales_phage	5.5e-67	38.0
WP_071181973.1\|3368829_3369036_-	hypothetical protein	NA	NA	NA	NA
WP_014472237.1\|3369052_3370759_-\|terminase	terminase large subunit	A0A2H4JC16	uncultured_Caudovirales_phage	2.4e-121	42.4
WP_014472238.1\|3370751_3371246_-\|terminase	phage terminase small subunit P27 family	A0A1Q1PVW3	Staphylococcus_phage	2.6e-20	35.5
WP_013353512.1\|3372330_3372711_-	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	1.0e-43	75.6
WP_041915583.1\|3372707_3374063_-	DEAD/DEAH box helicase	S5MA26	Brevibacillus_phage	1.4e-180	66.3
WP_071181974.1\|3374022_3374337_-	VRR-NUC domain-containing protein	A0A2K5B272	Erysipelothrix_phage	2.4e-19	57.8
WP_079979764.1\|3374619_3377034_-	hypothetical protein	A0A0A7RTG3	Clostridium_phage	5.8e-278	56.0
WP_167555497.1\|3377056_3377221_-	hypothetical protein	NA	NA	NA	NA
WP_071181975.1\|3377589_3379536_-	DNA polymerase	S5M5X4	Brevibacillus_phage	7.5e-252	67.2
WP_071181976.1\|3379532_3380084_-	hypothetical protein	Q38587	Bacillus_phage	4.0e-25	62.8
WP_071181977.1\|3380143_3380713_-	DUF2815 family protein	S5MC21	Brevibacillus_phage	6.1e-77	75.4
WP_013353518.1\|3380743_3381922_-	DUF2800 domain-containing protein	S5MUB5	Brevibacillus_phage	1.5e-133	61.4
WP_013353519.1\|3381918_3382314_-	hypothetical protein	NA	NA	NA	NA
WP_013353520.1\|3382326_3382728_-	hypothetical protein	NA	NA	NA	NA
WP_041481670.1\|3382918_3383188_-	hypothetical protein	Q9ZXC9	Bacillus_phage	1.3e-18	47.7
WP_164848962.1\|3383184_3383331_-	hypothetical protein	NA	NA	NA	NA
WP_013353523.1\|3383574_3383760_-	helix-turn-helix transcriptional regulator	A0A0M3ULF9	Bacillus_phage	6.8e-14	68.9
WP_013353524.1\|3384028_3384457_+	helix-turn-helix transcriptional regulator	Q5YAA4	Bacillus_phage	6.9e-41	58.9
WP_041481672.1\|3384465_3384888_+	ImmA/IrrE family metallo-endopeptidase	A0A0S2SXM3	Bacillus_phage	8.0e-42	60.9
WP_013353525.1\|3384932_3386090_+\|integrase	site-specific integrase	S5MBZ0	Brevibacillus_phage	2.6e-151	67.8
WP_007410090.1\|3386152_3387550_-	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
3386165:3386182	attR	NA	NA	NA	NA
WP_003151877.1\|3387569_3388013_-	iron-sulfur cluster assembly scaffold protein SufU	A0A2P1CJL8	Mycobacterium_phage	1.8e-15	39.4
WP_014418823.1\|3388002_3389223_-	cysteine desulfurase SufS	Q2XUY6	environmental_halophage	4.0e-118	48.6
WP_017418965.1\|3389222_3390536_-	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_003151872.1\|3390553_3391339_-	Fe-S cluster assembly ATPase SufC	W8CYL7	Bacillus_phage	6.5e-05	23.6
WP_003151857.1\|3391515_3391668_-	hypothetical protein	NA	NA	NA	NA
WP_017418963.1\|3392331_3393147_-	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_014418826.1\|3393160_3393829_-	ABC transporter permease	NA	NA	NA	NA
WP_071181978.1\|3393821_3394847_-	methionine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.2e-32	37.0
WP_007410085.1\|3395170_3395521_-	SCP2 sterol-binding domain-containing protein	NA	NA	NA	NA
WP_071181979.1\|3395617_3395938_-	thioredoxin family protein	NA	NA	NA	NA
WP_017418962.1\|3395940_3396306_-	toprim domain-containing protein	NA	NA	NA	NA
WP_003151845.1\|3396375_3396612_-	YusG family protein	NA	NA	NA	NA
WP_003151844.1\|3396666_3397050_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_003151843.1\|3397109_3397466_-	arsenate reductase family protein	M1PLC0	Streptococcus_phage	2.9e-21	51.9
WP_017418961.1\|3397579_3399364_-	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_017418960.1\|3399383_3400559_-	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_071181980.1\|3400569_3402939_-	3-hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_003151836.1\|3403129_3403270_+	YuzL family protein	NA	NA	NA	NA
WP_017418958.1\|3403299_3404208_-	proline dehydrogenase family protein	NA	NA	NA	NA
WP_003151832.1\|3404297_3404555_+	hypothetical protein	NA	NA	NA	NA
WP_017418957.1\|3404566_3404899_+\|coat	spore coat protein	NA	NA	NA	NA
WP_003151828.1\|3405037_3405499_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_063637101.1\|3405519_3407115_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_094246999.1\|3407178_3408329_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	2.7e-39	61.9

DBSCAN-SWA_13

3889151 : 3941166

Bacillus_phage(36.36%)

lysis,coat,holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017418677.1\|3889151_3890087_-	sensor histidine kinase	W8CYF6	Bacillus_phage	3.4e-24	28.9
WP_014419158.1\|3890088_3890787_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.2e-35	35.8
WP_017418676.1\|3890978_3891845_-	DUF4097 family beta strand repeat protein	NA	NA	NA	NA
WP_017418675.1\|3891865_3892570_-	ABC transporter permease	NA	NA	NA	NA
WP_025649399.1\|3892634_3893561_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-43	45.9
WP_003150986.1\|3893919_3894375_-	dTDP-4-dehydrorhamnose 3,5-epimerase family protein	NA	NA	NA	NA
WP_025649400.1\|3894371_3895220_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	7.0e-37	37.3
WP_025649401.1\|3895240_3896188_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	2.3e-68	42.6
WP_025649402.1\|3896190_3896928_-	NTP transferase domain-containing protein	G3MA50	Bacillus_virus	5.0e-47	42.7
WP_071182051.1\|3896955_3897960_-\|coat	spore coat protein	NA	NA	NA	NA
WP_014472356.1\|3897961_3898702_-\|coat	spore coat protein	NA	NA	NA	NA
WP_013354002.1\|3898694_3899816_-	N-acetylneuraminate synthase family protein	NA	NA	NA	NA
WP_013354003.1\|3899815_3900679_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_013354004.1\|3900679_3901849_-	DegT/DnrJ/EryC1/StrS family aminotransferase	NA	NA	NA	NA
WP_013354005.1\|3901871_3903296_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_013354006.1\|3903300_3904071_-	glycosyltransferase family 2 protein	A0A0F7L2F7	uncultured_marine_virus	7.6e-06	30.7
WP_013354007.1\|3904351_3904903_+\|coat	spore coat protein GerQ	NA	NA	NA	NA
WP_013354008.1\|3904949_3905321_-	DUF423 domain-containing protein	NA	NA	NA	NA
WP_013354009.1\|3905384_3906704_-	purine/pyrimidine permease	NA	NA	NA	NA
WP_013354010.1\|3906722_3907145_-	YwdI family protein	NA	NA	NA	NA
WP_013354011.1\|3907203_3907887_-	uracil-DNA glycosylase	A0A172DS90	Canid_alphaherpesvirus	3.2e-48	44.7
WP_071182052.1\|3907901_3908708_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_017418661.1\|3908793_3909321_-	hypothetical protein	NA	NA	NA	NA
WP_017418660.1\|3909365_3910001_-	hypothetical protein	NA	NA	NA	NA
WP_003150960.1\|3909993_3910332_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_003150959.1\|3910481_3911294_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_007407702.1\|3911324_3911564_-	hypothetical protein	NA	NA	NA	NA
WP_025649407.1\|3911663_3913103_-	sucrose-6-phosphate hydrolase	F8WPR5	Bacillus_phage	8.3e-22	25.0
WP_014419178.1\|3913099_3914482_-	PTS sucrose transporter subunit IIBC	NA	NA	NA	NA
WP_025649408.1\|3914701_3915532_-	transcription antiterminator	NA	NA	NA	NA
WP_017418658.1\|3915555_3915870_-	hypothetical protein	NA	NA	NA	NA
WP_025649409.1\|3916395_3918807_+	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	3.8e-19	36.8
WP_017418656.1\|3918848_3919850_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_099721935.1\|3920091_3921241_+\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.1e-37	59.7
WP_017418655.1\|3921302_3922052_-	oxygen-insensitive NADPH nitroreductase	NA	NA	NA	NA
WP_017418654.1\|3922154_3923342_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_071182053.1\|3923543_3924041_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_007614574.1\|3924296_3924557_+	spore morphogenesis/germination protein YwcE	NA	NA	NA	NA
WP_014419185.1\|3924600_3924969_-	cytochrome aa3 quinol oxidase subunit IV	NA	NA	NA	NA
WP_003150930.1\|3924970_3925585_-	cytochrome aa3 quinol oxidase subunit III	NA	NA	NA	NA
WP_007614578.1\|3925599_3927549_-	cytochrome aa3 quinol oxidase subunit I	NA	NA	NA	NA
WP_012118744.1\|3927576_3928542_-	cytochrome aa3 quinol oxidase subunit II	NA	NA	NA	NA
WP_003150926.1\|3929044_3929290_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_071182054.1\|3929306_3930848_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_071182055.1\|3930837_3932022_-	galactokinase	NA	NA	NA	NA
WP_042635745.1\|3932073_3932460_-	GtrA family protein	NA	NA	NA	NA
WP_014419191.1\|3932539_3933163_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003150917.1\|3933498_3933660_+	anti-repressor SinI family protein	NA	NA	NA	NA
WP_014306063.1\|3933877_3934558_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_025649415.1\|3934557_3935232_+	streptomycin biosynthesis protein StrF	NA	NA	NA	NA
WP_025649416.1\|3935252_3935855_-	DsbA family oxidoreductase	NA	NA	NA	NA
WP_021494738.1\|3935942_3937199_-	deferrochelatase/peroxidase EfeB	NA	NA	NA	NA
WP_003150911.1\|3937217_3937412_-	hypothetical protein	NA	NA	NA	NA
WP_063636529.1\|3937613_3938288_-	thiamine phosphate synthase	NA	NA	NA	NA
WP_071182056.1\|3938284_3939103_-	hydroxyethylthiazole kinase	NA	NA	NA	NA
WP_003150908.1\|3939105_3940014_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_007407725.1\|3940120_3940507_+\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA
WP_017418642.1\|3940488_3941166_+\|lysis	CidB/LrgB family autolysis modulator	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP017776

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP017775

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection