CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP017562	Paraburkholderia sprentiae WSM5005 chromosome 2, complete sequence	0 crisprs	csa3,cas3,DinG,RT	0	2
NZ_CP017564	Paraburkholderia sprentiae WSM5005 plasmid pl3WSM5005, complete sequence	0 crisprs	NA	0	0
NZ_CP017561	Paraburkholderia sprentiae WSM5005 chromosome 1, complete sequence	2 crisprs	DEDDh,csa3,DinG,WYL,cas3	0	3
NZ_CP017563	Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence	1 crisprs	csa3	2	0
NZ_CP017565	Paraburkholderia sprentiae WSM5005 plasmid pl2WSM5005, complete sequence	0 crisprs	RT,PD-DExK	0	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP017561_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017561_1

325743-325839

Orphan

Consensus_repeat	Method
GCTTGCGGCATTGGCATCGGACGCG	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP017561_1

>merge|NZ_CP017561|1|325743-325839|CRISPRCasFinder
GCTTGCGGCATTGGCATCGGACGCGGTTCGACACGCGGTTGCTGCGCCTGCTGGAACTGCGGCTCGGGCCGAGCTTGCGGCATCGGCATCGGACGCG

>NZ_CP017561|1|1|325743-325839|CRISPRCasFinder
GCTTGCGGCATTGGCATCGGACGCG	GTTCGACACGCGGTTGCTGCGCCTGCTGGAACTGCGGCTCGGGCCGA
GCTTGCGGCATCGGCATCGGACGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017561.1\|WP_051374482.1\|331449_333051_-\|phospholipase-D-family-protein	unknown	unknown	gnl\|CDD\|197210
NZ_CP017561.1\|WP_027198390.1\|321762_322239_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017561.1\|WP_027198389.1\|322776_324171_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
NZ_CP017561.1\|WP_027198384.1\|330036_331434_-\|class-II-fumarate-hydratase	unknown	unknown	gnl\|CDD\|234779
NZ_CP017561.1\|WP_027198385.1\|329427_329934_+\|acyl-CoA-thioesterase	unknown	unknown	gnl\|CDD\|224523
NZ_CP017561.1\|WP_167544140.1\|329167_329308_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017561.1\|WP_027198392.1\|320478_321147_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017561.1\|WP_027198378.1\|337243_337507_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017561.1\|WP_027198381.1\|334401_335817_-\|MATE-family-efflux-transporter	unknown	unknown	gnl\|CDD\|240536
NZ_CP017561.1\|WP_027198391.1\|321143_321644_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017561.1\|WP_027198394.1\|318230_318944_-\|C39-family-peptidase	unknown	unknown	gnl\|CDD\|239103
NZ_CP017561.1\|WP_027198393.1\|319060_320452_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017561.1\|WP_027198379.1\|336634_337153_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237171
NZ_CP017561.1\|WP_027198395.1\|317413_318223_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017561.1\|WP_027198382.1\|333295_334255_-\|bile-acid:sodium-symporter-family-protein	unknown	unknown	gnl\|CDD\|223462
NZ_CP017561.1\|WP_027198386.1\|328245_328959_-\|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|223713
NZ_CP017561.1\|WP_027198388.1\|324443_325415_+\|thymidylate-synthase	unknown	unknown	gnl\|CDD\|184347
NZ_CP017561.1\|WP_027198396.1\|315867_317319_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236090
NZ_CP017561.1\|WP_167544151.1\|314364_315729_-\|sigma-54-interacting-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
NZ_CP017561.1\|WP_027198380.1\|336088_336307_-\|RNA-binding-S4-domain-containing-protein	unknown	unknown	gnl\|CDD\|379097

Protein	Function_ID	Function_description	E-value
NZ_CP017561.1\|WP_051374482.1\|331449_333051_-\|phospholipase-D-family-protein	gnl\|CDD\|197210	cd09111, PLDc_ymdC_like_1, Putative catalytic domain, repeat 1, of Escherichia coli uncharacterized protein ymdC and similar proteins. Putative catalytic domain, repeat 1, of Escherichia coli uncharacterized protein ymdC and similar proteins. In Escherichia coli, there are two genes, f413 (ybhO) and o493 (ymdC), which are homologous to gene cls that encodes the Escherichia coli cardiolipin (CL) synthase. The prototype of this subfamily is an uncharacterized protein ymdC specified by the o493 (ymdC) gene. Although the functional characterization of ymdC and similar proteins remains unknown, members of this subfamily show high sequence homology to bacterial CL synthases, which catalyze the reversible phosphatidyl group transfer between two phosphatidylglycerol molecules to form CL and glycerol. Moreover, ymdC and its similar proteins contain two HKD motifs (H-x-K-x(4)-D, where x represents any amino acid residue) that characteriszes the phospholipase D (PLD) superfamily. The two motifs may be part of the active site and may be involved in phosphatidyl group transfer.	9.35419e-81
NZ_CP017561.1\|WP_027198379.1\|336634_337153_+\|hypothetical-protein	gnl\|CDD\|237171	PRK12678, PRK12678, transcription termination factor Rho; Provisional.	0.000435017
NZ_CP017561.1\|WP_027198389.1\|322776_324171_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	2.06936e-144
NZ_CP017561.1\|WP_027198385.1\|329427_329934_+\|acyl-CoA-thioesterase	gnl\|CDD\|224523	COG1607, COG1607, Acyl-CoA hydrolase [Lipid metabolism].	2.52823e-51
NZ_CP017561.1\|WP_027198384.1\|330036_331434_-\|class-II-fumarate-hydratase	gnl\|CDD\|234779	PRK00485, fumC, fumarate hydratase; Reviewed.	0
NZ_CP017561.1\|WP_027198381.1\|334401_335817_-\|MATE-family-efflux-transporter	gnl\|CDD\|240536	cd13131, MATE_NorM_like, Subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins similar to Vibrio cholerae NorM. The integral membrane proteins from the MATE family are involved in exporting metabolites across the cell membrane and are responsible for multidrug resistance (MDR) in many bacteria and animals. This subfamily includes Vibrio cholerae NorM and functions most likely as a multidrug efflux pump, removing xenobiotics from the interior of the cell. The pump utilizes a cation gradient across the membrane to facilitate the export process. NorM appears to bind monovalent cations in an outward-facing conformation and may subsequently cycle through an inward-facing and outward-facing conformation to capture and release its substrate.	1.28655e-145
NZ_CP017561.1\|WP_027198394.1\|318230_318944_-\|C39-family-peptidase	gnl\|CDD\|239103	cd02423, Peptidase_C39G, A sub-family of peptidase family C39. Peptidase family C39 mostly contains bacteriocin-processing endopeptidases from bacteria. The cysteine peptidases in family C39 cleave the "double-glycine" leader peptides from the precursors of various bacteriocins (mostly non-lantibiotic). The cleavage is mediated by the transporter as part of the secretion process. Bacteriocins are antibiotic proteins secreted by some species of bacteria that inhibit the growth of other bacterial species. The bacteriocin is synthesized as a precursor with an N-terminal leader peptide, and processing involves removal of the leader peptide by cleavage at a Gly-Gly bond, followed by translocation of the mature bacteriocin across the cytoplasmic membrane. Most endopeptidases of family C39 are N-terminal domains in larger proteins (ABC transporters) that serve both functions. The proposed protease active site is conserved in this sub-family of proteins with a single peptidase domain, which are lacking the nucleotide-binding transporter signature.	1.05813e-55
NZ_CP017561.1\|WP_027198382.1\|333295_334255_-\|bile-acid:sodium-symporter-family-protein	gnl\|CDD\|223462	COG0385, COG0385, Predicted Na+-dependent transporter [General function prediction only].	2.19893e-88
NZ_CP017561.1\|WP_027198380.1\|336088_336307_-\|RNA-binding-S4-domain-containing-protein	gnl\|CDD\|379097	pfam13275, S4_2, S4 domain. The S4 domain is a small domain consisting of 60-65 amino acid residues that was detected in the bacterial ribosomal protein S4.	3.0402e-26
NZ_CP017561.1\|WP_027198386.1\|328245_328959_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|223713	COG0640, ArsR, Predicted transcriptional regulators [Transcription].	2.07715e-13
NZ_CP017561.1\|WP_027198388.1\|324443_325415_+\|thymidylate-synthase	gnl\|CDD\|184347	PRK13821, thyA, thymidylate synthase; Provisional.	0
NZ_CP017561.1\|WP_027198396.1\|315867_317319_-\|hypothetical-protein	gnl\|CDD\|236090	PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated.	0.0034694
NZ_CP017561.1\|WP_167544151.1\|314364_315729_-\|sigma-54-interacting-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	3.43451e-141

>NZ_CP017561.1|WP_027198388.1|324443_325415_+|thymidylate-synthase
MKQYLDLVRTILDTGTWQENRTGIRTISMPGAMLRFDLQQGFPAVTTKKLAFKSAIGELVGFLRASRSAADFRELGCKVWDGNANQNAQWLANPYREGPDDLGDVYGVQWRKWPAYKVLDAGASAQLADAQARGFRVITQFDEAGRSKVLLYKAIDQLRQCLDTIMQNPADRRILFHAWNPAVLDQIALPACHLLYQFLPNVTRREISLCLYIRSNDVGLGTPFNLTEGAALLHLVGRLTGYTPRWFSYFIGDAHIYENQLDMLHQQLKREPYESPRLAIADRVPDYAMTGVYEPEWLEKIEPADFSLIGYRHHEPLTAPMAI
>NZ_CP017561.1|WP_027198389.1|322776_324171_+|sigma-54-dependent-Fis-family-transcriptional-regulator
MEPATRQLIYVSRDPSAELNTRFLQRGWHVEVVGSARDARRAVRTGSAAGGLLDLSSDFQPHEIAAFESCLTMPNVGWVAATTPGQLQDAALRRLVRDYCFDYVTVPYSGDRIVDSVGHAYGMISLSETASNDGSQGAEGEMVGSCDAMLALFRSIRKVAMTDAPVFISGESGTGKELTAVAIHERSARRNAPFVPINCGAIPPHLLQSELFGYERGAFTGANQRKIGRVEAANGGTLFLDEIGDLPLESQASLLRFLQERKVERLGGHTAIDVDVRIISATHVDMTAAMIEGRFRSDLYHRLCVLQIDEPPLRARGKDIELLARHMLERFKKDASRRLRGFAPDAIAALHNYGWPGNVRELINRVRRAIVMSEGRAITARDLELAEYVEIVPVSLAQAREAAERQAIELALLRHRGRLGDAAQELGISRVTLYRLLCSHGMRHMEGEPMSAPHRELPASVQHL
>NZ_CP017561.1|WP_027198390.1|321762_322239_-|hypothetical-protein
MRLAFRIDLISRRASYFALCSALAFSALPASAGTSTAQAAPASSASLADSSEAAVPASASLQATTPIAAQDVSQSTAKGWNPAADAASMNDISLDDQVLSRQRGGAVGMLMVATTPQLMQHSDNQVTLWDEIAPPLPLPVPVDAARAAQGNLATYQRK
>NZ_CP017561.1|WP_027198391.1|321143_321644_-|hypothetical-protein
MTSHRHTPRAACARAALLASVLVTICFASHADAGQLANPGDIIVERSVTPRDAFVPVPRDQDPVAVRATTFPANSFDPTIATLVGDADLTNAHGSNGVAAGGALGGTGMQAVTQILSGKPTGNTIPLNSGGIGGPAAGVGGTISSSVTGALAPLSNVLGGALGALK
>NZ_CP017561.1|WP_027198392.1|320478_321147_-|hypothetical-protein
MSTLLRPSLQSLQVASARPALRVCRCLCIGVAALVAGAAHAQSQAVPVVGATATIGTAAGMGVTGAFAVNQTAGLDNAQANQITVTKGAAAGNANASVQSTAVVANVPRAQASIEANALSNTSGAVLVNQSAGAGNLQRNSTELGAAALGVETVSDGELSATAPKNGSPGQSSALHGMREASISSDALRNASGIVQINQAAGAGNATANSFVLRPPAGTFFN
>NZ_CP017561.1|WP_027198393.1|319060_320452_-|hypothetical-protein
MKRTLIAAAVLVTASGSVLAASPKAYLFNSTAVGEMIGVEGLVGLFGCVHVSSTAGAVINNDQSVNVNASLVPQAQTYTTGAVTTTLNNSRTSVRGAGTAFAFTTQNHTSSSSSSQGFEASGGYAYGSHSASLTGGGYETSQQAAGIAGSFSHTSQNSGGHLSAGGSIGGSYTYQDHNALSHGSGSFSARGGLQAGYRESSYSNSSGVAGGFEASEASGQHRTWGFSASEGSGYAMVGEHSSGYSRSRASSTDSYRAAWGVDAGMSSTDVTTRGSITQHIDNQAAGTLTATTGASAANNVSGNLGINIAEGISNAQSNDVALASVDIGNVFGNAQDFNTQSSSGNARINNFNLNASVGNGSLSGVTGNVGVNIASGIGNVQNNSLAGAVTTTNPREALTTAMNATDSNAQTAGMTVHGQFQGTASLGANTLYGASGNIGVNIAGGAGNLQHNGLAIAALNSGK
>NZ_CP017561.1|WP_027198394.1|318230_318944_-|C39-family-peptidase
MTGFKGFPALPFAVALAGCALCADHAAAQSRIDTSTFVGVPLTKTVRSMKDLRYNHIVNQQFDYSCGAAALATLLKYGYGIDIPETELIGRMMAFSTPEVVVSNGFSMLDMKHFVQTIGLRGRGFRVNVDALHHLQIPVMVLMNIDGYEHFVLVKHAQDGRVFIADPALGNRIVLEEDFAKTWNGLVFAVLGKPFREDSPLLQDNESLALKLRAAALAAGTAATPFFEYGLNKADMF
>NZ_CP017561.1|WP_027198395.1|317413_318223_-|hypothetical-protein
MKSHFTQLGFVLCAIACGASGLAQASEPAASPAATELSIPSAPGAPPVRVQLVGDDVLATQTGKYAGATMISGFVLNVISQWQLPNGASALAQGSLSAVHDGSGQLTRSVSTFARVNDGALGHAGDSGADPNALARGGQSIGVNGVSQVTQVAGDRNSGINSALIDFDNNAVTLTGSANAPSASASNSTGSVKAGISFGSNGVSVALQTPAGLATQTIAPSNGQIAQLLQIAGNNQQVANALQLHLQTQQMSASMLRQSGVLQALQNRR
>NZ_CP017561.1|WP_027198396.1|315867_317319_-|hypothetical-protein
MKKVSSTRAPRIALAAIPAAAMLWAVSPSASAQALAGQSVEDRLNTLMRVVDEQQRQIHSLERQVTELEMAQRGRGVPGTGAPAGNETVAEQSGADGLPVPLPPLAQIAPGAPAPTGTTGTATGVPVKPPTPDGGNAASAGAGGLPAATDGSGAVGQTQRASEPVRTQAEQAVVQREHAPLFDHKLTMDFGISDTYYDRRQLQLSGFLALDAIFLGNINLGQTKSHQVMADLDTRYGVSDRINVDVDVPYVYRRSTFIVGGAGGAASTLSDATVSSHDIGDVNFGIYYQFLKETNAMPDVVGSLRVKAPTGSSPFGQKVVQVDADNTNLVAPTELPTGTGFWNITAGLSVLKTYDPVVLFGSVSYTYNLARSFADISSVQGQTEPATVKLGDIVQFGGGVALAFSDKDSASVSFTMALEPESQTKAPGGTYQKVPGSETTAAAMNFGLNHVVNKHLTINGSVSIGLTPDAPNFVVGVRFPYTF
>NZ_CP017561.1|WP_167544151.1|314364_315729_-|sigma-54-interacting-transcriptional-regulator
MYVAHTPDETLIAHLKSRGWPVAVARSAHELGRLVKPDIACAGVVDLASFAPRDIGGLEASLRQQQVGWIALATDERLNDPLVRRLVRHYCFDFVKPPVAHATIDYLAGHAFGMVTLCDPELTPPASEAGDEEMVGTCEAIQQLFRTIRKVANTDASVFIAGESGTGKELTALAIHERSPRRKAPFMPINCGAIPPHLLQSELFGYERGAFTGANQRKIGRVEAANGGTLFLDEIGDLPLESQASLLRFLQEGKIERLGGRESIPVDVRIISATHVDLDSAMREGQFRADLFHRLCVLRVDAPPLRARGRDIEILAYHILRKFKTDNARKIRGFTPSAIEALYNYSWPGNVRELINRVRRAIVMAENKLISADDLDLAQYAEQQTTTLSEAREAAEKRAIETALLRHRHRLNEAAADLNISRVTLYRLMGVHGLRDQGGADDNGAPAADGPAQG
>NZ_CP017561.1|WP_027198386.1|328245_328959_-|helix-turn-helix-transcriptional-regulator
MTAPLADDQNHFPGLSRIGALLADPGRAAMLWALMDGSARPAGELTMIAGLSPSAASAHLGRLTDGGLLALEVRGRHRYFRIASPDIAASIEALATVAQVSAPQRAVPRPARTVPLEMRYARTCYDHMAGELSVRLFERMLERGLLTQNGASLEATAQGAARFADWGIDVAAQQTRRRRFACTCLDWSMRRPHLGGALGAALLDAWSSQGWVERTLRPRVLRVTPAGQQHFDAFLAG
>NZ_CP017561.1|WP_167544140.1|329167_329308_+|hypothetical-protein
MKTLLAVVAAVLLLSACAGGGAGSGSAGSGSINMYGIIDEGISVHN
>NZ_CP017561.1|WP_027198385.1|329427_329934_+|acyl-CoA-thioesterase
MSTVAAAPLDRSETTFRFLAEPTSVNFGGKVHGGALMKWIDETAYACAAVWSGRYCVTVSVGNIRFRRPILVGNLVELRARIVATGRTSMHIHVSVYAGDPKGGELLQTTDCLVVMVAVNENGHPVPVPAFVPQTEEQKRLARYAMDVKEALDAIVELKPEEVAQGKI
>NZ_CP017561.1|WP_027198384.1|330036_331434_-|class-II-fumarate-hydratase
MTEDVRMERDTFGEIAVPNARLWGAQTQRSLQNFKISTEKQSPELITALAVIKRAAAEVNLGLGVLDEQKARAIMQAADEIIDGKHPGEFPLAVWQTGSGTQTNMNLNEVIANRASELLGGERGEARKVHPNDDVNRGQSSNDVFPTAMHVAAAQAIVKHLLPALKTLRDTLDGKAKAFADVVKIGRTHLQDATPLTLGQEFSGYVAQLEQGIRHVESTLPHLYELAQGGTAVGTGLNAHPKFADSVAAAIGKLTGLPFVSAPNKFEVMAAADALVFAHGALKTVAASLNKIANDIRWLASGPRCGLGELSIPENEPGSSIMPGKVNPTQAEALTMLCAQVFGNDVAVNIGGASGNFELNVFRPMIAHNVLQSVRLLADGAHSFNENCAVGIEANHARIDSLLNESLMLVTALNPHIGYDKAAQIAKKAHKEGTTLKASALALGYVTEQQFDEWVQPKDMVGRTT
>NZ_CP017561.1|WP_051374482.1|331449_333051_-|phospholipase-D-family-protein
MISTTRQLFLLSCAAACLTACATRPPATAFDRAVTHALPATAATPLREALAPLEAKHPRQSAFRVLPNGTDALQLRIALARAATKTLDMQYYIANEDTTGKLLLGAALYAADHGVRVRMLVDDLNFKDIDRIMAGLNTHENIEIRVFNPFGSAQEGMFERTTNLFTQIDHFTRRMHNKAMIVDNQLAIVGGRNLGDEYFSASETLQFRDLDVLAAGPIVADVSASFDDYWNSDLAYPLRALNKQQFDRKELDQTRDDLRHHWRTNADPYNAKPLNATPLAAQITSGQLGLTWASAEFKADLPEKIAHPSPDYVSPPLARLRELMRDAHHDFLIVSPYFVPHASGVQAASELTHRGIRIAVLTNSLAATDAVAVQAGYSPFRVPLLKAGVELYELRPYQDTPNVALVGSQSRASLHAKAYVIDHQILVIGSMNLDPRSANLNTELALVIHSPELAKQVARIFERATQPDHSYHVTLADSTQLAYLRSIGAPLSPLVWTDVENGQIRTYIFDPQAGFYRNALTGLFSLLPVNSEL
>NZ_CP017561.1|WP_027198382.1|333295_334255_-|bile-acid:sodium-symporter-family-protein
MLARITRLFPLWAVLVSVAAYCSPASFSGVAPHVTALLTIIMLAMGVTLSTADFLRVFTRPAPVIAGIVLHYLVMPLAAWGIAKALRMPPDLTAGMVLVGSVASGTASNVMIYLARGDVALSVTISALSTLVGVFATPLLTRLYVDASIVVDVRGMLTSIAQIVALPIVVGLIVNRLFGKLVRKIEPILPLVSMVAIVLIIGAVVGGTQKSIASVGLLVMVGVVLHNGIGLLGGYWGGRLLGFDEAVCRTLAIEVGMQNSGLAATLGKLYFTPLAALPGALFSVWHNLSGSLLAGVWAGRPAKGSTHADGERALHAERV
>NZ_CP017561.1|WP_027198381.1|334401_335817_-|MATE-family-efflux-transporter
MTQPSFARTASRPPTLSRHAVDTARLAAPLAIAQLSQMAMSVTDTILLGSLGPDALAAGGLGANLFFVVVTLLQGVLTSVSVSVAHARGAQDDSRVPHIYWTGFVLSVLLSVPAFILLSFASHILGAFGEPGLLAHNVGQYAAVLRWGAPASLIGVGLMRSFLPAIGAARRLLWVSIVSVGVNGFLNYGLIHGAYGLPRLGFLGSAAATTITVWLTALVLMALLHLRPRFRHFVVATRPKLPLMGELFGIGWPVAITYGVESTLFLATGLMVGLLGESQLAAHQIALNVASVAFMVPLSIGQAANVRVGYWAGAGQPLAARHAGFVALALGVGFMSMSGLVLITAPRWIVGLYLHLDDPANAPTIALASSLLGVAAIFQIVDGMQAVGSGCLRGLKDTRVPMIAAAFGYWVIGFPTGYLLAFHAGLGARGLWWGLAAGLASVALLMTLRFHRLSLRRTPTAASVTPPARSV
>NZ_CP017561.1|WP_027198380.1|336088_336307_-|RNA-binding-S4-domain-containing-protein
MPNLNFTLTGEYVELHNLLKITGLADSGGSAKMMVADGAVMVDGRVETRKTCKIRAGQVVLLGDTRIAVHEA
>NZ_CP017561.1|WP_027198379.1|336634_337153_+|hypothetical-protein
MTQIRSLLIGTALTAFTATAAVAQTAQPAAGPGAQAQIQTQGTAEMAPPSAAGAQRLQAPPAAQGMQQVPGAPAAQGVEAPPPARLTASGSTDPLVQRRDADAKANAEYRAAKKSSKAELKAQQKAAKDQYKEQVRGAKLNQKADRQTANDEMKMNMQGQAAAQADGADVKH
>NZ_CP017561.1|WP_027198378.1|337243_337507_+|hypothetical-protein
MNINHSTRNRIYAALIVGCLSSAGFAQTATPAAAPTTHADKKAAKEQAKADKKAAVAQAKADKTKTDAQADADKASAEANVKDAKKQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP017561_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017561_2

3273351-3273458

Orphan

Consensus_repeat	Method
GCGAGTATGGCGCTCGGTTTAGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP017561_2

>merge|NZ_CP017561|2|3273351-3273458|CRISPRCasFinder
GCGAGTATGGCGCTCGGTTTAGCCTCATTGGCGAACTTCCCGGATACAGTCGCGCTCGGTCACTCGGCGTCCGCTGGCGCTTCGGCAAGTATGGCGCTCGGTTTAGCC

>NZ_CP017561|2|2|3273351-3273458|CRISPRCasFinder
GCGAGTATGGCGCTCGGTTTAGCC	TCATTGGCGAACTTCCCGGATACAGTCGCGCTCGGTCACTCGGCGTCCGCTGGCGCTTCG
GCAAGTATGGCGCTCGGTTTAGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017561.1\|WP_027198971.1\|3265427_3266024_+\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|234675
NZ_CP017561.1\|WP_027198968.1\|3267748_3268534_-\|indole-3-glycerol-phosphate-synthase-TrpC	unknown	unknown	gnl\|CDD\|234710
NZ_CP017561.1\|WP_027198954.1\|3290164_3291991_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|276809
NZ_CP017561.1\|WP_027198967.1\|3268552_3269584_-\|anthranilate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|234682
NZ_CP017561.1\|WP_034479721.1\|3270837_3271197_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP017561.1\|WP_027198956.1\|3288144_3289263_+\|DUF2827-domain-containing-protein	unknown	unknown	gnl\|CDD\|371305
NZ_CP017561.1\|WP_027198965.1\|3271794_3272577_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|376350
NZ_CP017561.1\|WP_154671863.1\|3271346_3271505_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017561.1\|WP_162162799.1\|3282035_3284993_+\|YadA-like-family-protein	unknown	unknown	gnl\|CDD\|380308
NZ_CP017561.1\|WP_051374440.1\|3276043_3276541_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017561.1\|WP_027198972.1\|3263446_3265237_+\|M61-family-metallopeptidase	unknown	unknown	gnl\|CDD\|226483
NZ_CP017561.1\|WP_027198970.1\|3266150_3266972_-\|uracil-DNA-glycosylase	unknown	unknown	gnl\|CDD\|235376
NZ_CP017561.1\|WP_082194667.1\|3277207_3277786_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017561.1\|WP_027198955.1\|3289283_3290168_+\|peptidyl-prolyl-cis-trans-isomerase	unknown	unknown	gnl\|CDD\|379040
NZ_CP017561.1\|WP_027198958.1\|3285868_3287008_+\|DUF2827-domain-containing-protein	unknown	unknown	gnl\|CDD\|371305
NZ_CP017561.1\|WP_027198957.1\|3287004_3288108_+\|DUF2827-domain-containing-protein	unknown	unknown	gnl\|CDD\|371305
NZ_CP017561.1\|WP_027198969.1\|3267068_3267695_-\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|143624
NZ_CP017561.1\|WP_027198962.1\|3278509_3279160_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017561.1\|WP_027198966.1\|3269603_3270221_-\|aminodeoxychorismate/anthranilate-synthase-component-II	unknown	unknown	gnl\|CDD\|235552
NZ_CP017561.1\|WP_027198959.1\|3285106_3285805_+\|OmpA-family-protein	unknown	unknown	gnl\|CDD\|143586

Protein	Function_ID	Function_description	E-value
NZ_CP017561.1\|WP_027198971.1\|3265427_3266024_+\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|234675	PRK00170, PRK00170, azoreductase; Reviewed.	7.56763e-87
NZ_CP017561.1\|WP_027198968.1\|3267748_3268534_-\|indole-3-glycerol-phosphate-synthase-TrpC	gnl\|CDD\|234710	PRK00278, trpC, indole-3-glycerol phosphate synthase TrpC.	4.0522e-142
NZ_CP017561.1\|WP_027198954.1\|3290164_3291991_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	3.63464e-18
NZ_CP017561.1\|WP_027198967.1\|3268552_3269584_-\|anthranilate-phosphoribosyltransferase	gnl\|CDD\|234682	PRK00188, trpD, anthranilate phosphoribosyltransferase; Provisional.	0
NZ_CP017561.1\|WP_034479721.1\|3270837_3271197_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	5.36187e-12
NZ_CP017561.1\|WP_027198956.1\|3288144_3289263_+\|DUF2827-domain-containing-protein	gnl\|CDD\|371305	pfam10933, DUF2827, Protein of unknown function (DUF2827). This is a family of uncharacterized proteins found in Burkholderia.	3.01633e-170
NZ_CP017561.1\|WP_027198965.1\|3271794_3272577_+\|EAL-domain-containing-protein	gnl\|CDD\|376350	pfam00563, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues. The EAL domain is a good candidate for a diguanylate phosphodiesterase function. The domain contains many conserved acidic residues that could participate in metal binding and might form the phosphodiesterase active site.	1.73259e-31
NZ_CP017561.1\|WP_027198958.1\|3285868_3287008_+\|DUF2827-domain-containing-protein	gnl\|CDD\|371305	pfam10933, DUF2827, Protein of unknown function (DUF2827). This is a family of uncharacterized proteins found in Burkholderia.	1.19169e-155
NZ_CP017561.1\|WP_162162799.1\|3282035_3284993_+\|YadA-like-family-protein	gnl\|CDD\|380308	NF033477, EmaA_autotrans, collagen-binding adhesin autotransporter EmaA. EmaA (extracellular matrix protein adhesin ) is an outer membrane protein first described in Aggregatibacter (Actinobacillus) actinomycetemcomitans, a member of the Gammaproteobacteria. It is a glycoprotein, and has a C-terminal beta-barrel domain that marks it as an autotransporter. It serves as an adhesin that binds collagen, the most abundant material in the host extracellular matrix. It shares homology with the collagen-binding protein YadA of Yersinia enterocolitica.	8.51049e-12
NZ_CP017561.1\|WP_027198972.1\|3263446_3265237_+\|M61-family-metallopeptidase	gnl\|CDD\|226483	COG3975, COG3975, Predicted protease with the C-terminal PDZ domain [General function prediction only].	0
NZ_CP017561.1\|WP_027198970.1\|3266150_3266972_-\|uracil-DNA-glycosylase	gnl\|CDD\|235376	PRK05254, PRK05254, uracil-DNA glycosylase; Provisional.	1.43669e-140
NZ_CP017561.1\|WP_027198955.1\|3289283_3290168_+\|peptidyl-prolyl-cis-trans-isomerase	gnl\|CDD\|379040	pfam13145, Rotamase_2, PPIC-type PPIASE domain.	8.1813e-11
NZ_CP017561.1\|WP_027198957.1\|3287004_3288108_+\|DUF2827-domain-containing-protein	gnl\|CDD\|371305	pfam10933, DUF2827, Protein of unknown function (DUF2827). This is a family of uncharacterized proteins found in Burkholderia.	0
NZ_CP017561.1\|WP_027198969.1\|3267068_3267695_-\|CYTH-domain-containing-protein	gnl\|CDD\|143624	cd07756, CYTH-like_Pase_CHAD, Uncharacterized subgroup of the CYTH-like superfamily having an associated CHAD domain. This subgroup belongs to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily. Members of this superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). A number of proteins in this subgroup also contain a C-terminal CHAD (Conserved Histidine Alpha-helical Domain) domain which may participate in metal chelation or act as a phosphor-acceptor. The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup have not been characterized.	5.87102e-63
NZ_CP017561.1\|WP_027198966.1\|3269603_3270221_-\|aminodeoxychorismate/anthranilate-synthase-component-II	gnl\|CDD\|235552	PRK05670, PRK05670, anthranilate synthase component II; Provisional.	1.97371e-138
NZ_CP017561.1\|WP_027198959.1\|3285106_3285805_+\|OmpA-family-protein	gnl\|CDD\|143586	cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA. OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. Well-studied members of this family include the Escherichia coli outer membrane protein OmpA, the Escherichia coli lipoprotein PAL, Neisseria meningitdis RmpM, which interact with the outer membrane, as well as the Escherichia coli motor protein MotB, and the Vibrio flagellar motor proteins PomB and MotY, which interact with the inner membrane.	1.39314e-41

>NZ_CP017561.1|WP_027198965.1|3271794_3272577_+|EAL-domain-containing-protein
MNDMDVAGEVFSAMLDARVTLNREPVCSVASAESVLYHVCQTSVLNSRGHTLQPVQFIPALERASLIRLFDRHVVKQAISSLRARPDSRLGVEVSAQSSVADVVWEAIFQLIEQTPDVAERLVIEIPEAAWFDAHERVQRFTQSLKHAGCKIAIADFGIETAIGVRSPDIIKIDASFTAAARHGRVHVEHLAQLIRRAAKQAETVVVEGVDEPVDIMHVRECGAQWAQGQLVTALFSDGPKSASACSTSSALAARTQIAS
>NZ_CP017561.1|WP_154671863.1|3271346_3271505_+|hypothetical-protein
MATPRLPTATFDAGGIDMTETVARKQRKGSSDDRKRSYDDLMEFSILSQLFA
>NZ_CP017561.1|WP_034479721.1|3270837_3271197_-|helix-turn-helix-transcriptional-regulator
MSSTAQLAKTIGEIIAARRKALGMTQVQLADLLQIEQPVLSRIERGSMPSLERLAAIAEVLECRVVDLLGVSATGSIDRAMRIHDRLAKLSPDQQEAFEKMMDNAFTLVEAPQEKKKKT
>NZ_CP017561.1|WP_027198966.1|3269603_3270221_-|aminodeoxychorismate/anthranilate-synthase-component-II
MLLMIDNYDSFTYNLVQYFGELGEDVRTYRNDEITLDEIAKLNPERICLSPGPSNPQHAGITLDVLREFAGKTPILGVCLGHQAIGEAFGGRVVRAQTIMHGKVSTIETDCKGVFEDLPKHFTITRYHSLAIERESLPDCLEVSAWTEDGEIMGVRHKELAVEGVQFHPESILSEHGHALLENFVKQSKLAVAGKASHHAAPRNA
>NZ_CP017561.1|WP_027198967.1|3268552_3269584_-|anthranilate-phosphoribosyltransferase
MSITPQEALQRTIEHREIFHDEMLHLMRLIMRGELSPVMSAAIITGLRVKKETIGEITAAATVMREFARHVEVQDNSNFVDIVGTGGDGAHTFNISTATMFVSAAAGAKVAKHGNRGVSSKSGSADVLEALGVNIDLQPEQVAASIAETGMGFMFAPNHHPAMKNVAPVRRELGVRTIFNILGPLTNPAGAPNQLMGVFHPDLVGIQVRVMQRLGAKHVLVVYGMDGMDEVSLGGATLVGELRDGEIREYEIHPEDFGMQMVSNRTLKVADAGESKVMLLDALSNKPGVAREIVTLNAGTALYSANVAATIADGIELAREAIASGKARAKVDELVRFTQQFKQ
>NZ_CP017561.1|WP_027198968.1|3267748_3268534_-|indole-3-glycerol-phosphate-synthase-TrpC
MSDILDRIIAVKREEVRAAEQSVPLEELRLEASSRDIRDFVAALRGKHTAGLAAVIAEVKKASPSKGVLREHFAPADIARSYEKHGAACLSVLTDVQFFQGSVAYLQQAREACQLPVLRKDFIVDPYQVVEARAMGADAILLIAAALDTAQMQDLEALAHSLGLAVLVEVHDSDELNEALTLKTPLIGINNRNLRTFDTSLDTTLGMLDAIPDDRIVVTESGILSRDAVERMRARNVHTFLVGEAFMRANEPGVELARMFF
>NZ_CP017561.1|WP_027198969.1|3267068_3267695_-|CYTH-domain-containing-protein
MGMEREIKLALPASQVQAATRWFVARAGHDGHAIKLVNIYFDTPQLTLASSKSALRLRQTPDGWLQTFKTLGHATNGLHSRHEWELPVADAKLDIDALLSACDEPAAADALKQAAPTLIALFRTNFTRTLWLLDTDGAQIEAAIDQGDVLAEVDGEARRAPISEIELELKAGDEAALHTFAAELGKRIAGLAPDDISKAQRGYRLRAG
>NZ_CP017561.1|WP_027198970.1|3266150_3266972_-|uracil-DNA-glycosylase
MTTASRTRSSSPQASLFGDAAPVDAEASADTAAAPPTLEAQFAALPAAWRAHLKPFIDSDTYAPLCRFVDGERAAGKTIYPADVFRALRLTSPDDVKVVILGQDPYHGEDRGTPQAHGLAFSVAPHVRPPPSLRNVFKEIAASLGHETPQHGCLDSWAKQGVLLLNTVLTVERDSAASHAKRGWEKCTDTLIHELATRHQHLVFMLWGAHAQAKRALLDGKSHCVLEAPHPSPLSAHRGFLGCGHFAKANEYLLQHGRQPIDWRLPDDAQMLA
>NZ_CP017561.1|WP_027198971.1|3265427_3266024_+|NAD(P)H-dependent-oxidoreductase
MTTILQINSAARSQGANSTLLVNELTAKLQQSNPGAQVVVRNLQAEPLPHLDDAVLGAFFTPADQRTPEQAAIAARSDALVAELQAADVIVIGAPMYNFGISSQLKTYFDFIARAGITFRYTANGPEGLVTGKKVYVVSARGGKYLGTPNDSQTPYLKSFLGFLGMTDVNFIYAEGLNMGPDAANAALSSAREAIAAV
>NZ_CP017561.1|WP_027198972.1|3263446_3265237_+|M61-family-metallopeptidase
MKPIRYTIVPSHPAAHLFQVTVTVADPDPAGQRFMLPVWIPGSYMVREFARNIVTLRAVNDAGRKVRVEKIDKHTWQAAPVKGALTLHYEVYAWDMSVRAAHLDDTIGFFNGTSVFLSPLGHEDAQCVVDIQKPQGAAYRGWRVATALPEARGTKRYSFGEYRAQNYDELIDHPVTLGEFALATFNAHGVPHDVVIGGRVIGLDMDRLCKDLKRICEAQIALFEPKSKKAPVERYVFMTQAVTDGYGGLEHRASTALICNRADLPVQGREAMSEGYRTYLGLCSHEYFHTWNVKRIKPAVFAPYDLGVENYTSMLWLFEGFTSYYDDLMLVRSGVISLDDYFGLLGKVIGGVQRGSGRLKQSVAESSFDAWVKYYRQDENAPNAIVSYYTKGSLIALAFDLTIRAQTGNRKSLDDVMRLLWKRFGRDFYRGQPVGVDESEIEAIFAEASGAQLDELFAEGVRGTRDLPLDALLAPFGVALAADVDKNGKPSLGVRLRGGADCTLATVHEGSAAQKAGLSAGDVLLALDGLRVTGGNIDALLSRYQPGAKVEVHAFRRDELRVTQVKLDGPEVARYKLALSDHRPAARKARKRWLAQ
>NZ_CP017561.1|WP_051374440.1|3276043_3276541_-|hypothetical-protein
MFASTTVLSDDTLLFVVERPVDKEPMPVDALVLSDDKPVDADVLSDERPVDSELFTVDALVLNESSPLATVEIDPDNCDAPVLSEEMPVDAEVESDDRPVESELTPVESDDTPVESDDTPVLKLEMPVLVDVLSASTARFVAFNCEPFTASVLSAVSRPAATFVI
>NZ_CP017561.1|WP_082194667.1|3277207_3277786_-|hypothetical-protein
MFASTTVLNDDTLLFVVERPVDRLPMPVDALVLSDDKPVDADVLNEFSPLATVEIEPDSCDAPVLSEEMPVDAEVLNDDTPVLSDDTPVDSEPTLLATVDTEFDSELMPVEADVDSEETPVLSDDTPVLRLDTPVLSEDTPVLNEETPVLSDEATVDRLEVPVDVLVESESTARLVAFSCEPLTASVLSVVS
>NZ_CP017561.1|WP_027198962.1|3278509_3279160_-|hypothetical-protein
MLAEIAVDSELAAVEAEVLSDETPVLRLPTPVESEPMPVDALVLSDAILLIAPDRPVESELFAVDMDVLKELRPVLNDDTPVESEATLLATVETEFDNELIPVEAEVERLDTPVESELTPVDRLEIPVDALVLNEETLVLNDDTPVDNEPTLLATVDTEFDNDEIPVEAEVLSDDTPVLSDDTPVESDEATVDRLETPVLNDEIPVEVLVESESTA
>NZ_CP017561.1|WP_162162799.1|3282035_3284993_+|YadA-like-family-protein
MSTSTGLSTVTSNVGSLSTGVSSLSTGVSSLSTSTSTGISSLSTSTSTAIEAAKTHYYSVNDNGVQQGNYDNDGATGLNAIAAGTNATAAGASSVAIGDGANAANDNSVALGAGSLTDVSHPTPSAVIGGATYQFAGANPVGVVSVGAPGSERQVTNVAAGQVTASSTDAINGSQLYQTNQAIDTLSTSTSTGIVSLSTSTSTAVSSLSTGVSSLSTSTSTGLSSLSTGLSTVVSNVDSLSTSTSTGLSSLSTSTSTGLSSLSTSASTGISSLSTGLSTVVSNVDSLSTSTSTAIGSLSTSTSTGLSSLSTSTSTGLSSLSTGVSSLSTGLSTVTSSVDSLSTSTSTGISSLSTGVSSLSTGLSSLSTGVSSLSSSTSTAISSLSTSTSTGLSSLSTGVSSLSTSTSTGISSLSTGVSSLSTSTSTAVSSLSTGLSTVTSSVDSLSTSTSTAVSSLSTGVSSLSTSTSTGISSLSTGISSLSTSTSTAVSSLSTGISSLSTGVSSLSTSTSTGISSLSTGLSTVTSSVDSLSTSTSTGLSTVTSSVDSLSTSTSTGIGSLSTGLSSLSTGLSTATSGIDSLSTSTSTGISSLSTGVSSLSTGLSSLSTSTSTGIGSLSTGVSSLSTSTSTALSSLSTSTSTGLSSLSTGMSSLSTSTSTGMSSLSTGLSTVSSSVDSLSTSSSTATSSLSTATSSLSTGLSSLSTSTSTGLSSLSTSTSTGLSTATSAISSLSTGLSTTDTNVSSLSTAITNLKPQHYVSINDDGVQGGNYNNDGATGFNAVAVGANATAGGANASAYGDKANAAGSAATALGYNANATGTNTTAVGVGSTASGTNATALGAGAVASAPNSVALGTNSVASEANTVSIGSEGNERRLTNVAPGVNPTDGVNMSQLQGVQNSLNNSINTVARKAYGGIAAATALTMIPDVDQGKTLAVGIGGAGYQGYGATAIGFTARITNNLKVRGGVGISSAGTSYGAGVSYQW
>NZ_CP017561.1|WP_027198959.1|3285106_3285805_+|OmpA-family-protein
MSAKLLLVAFATALLAACSTAQGPTWNAYRVGMPNGQQAYRVDCHGLFEGQSTCFAQANEICGQKQVQPIEQVAPLGDDQNPRDVRVLTFQCATPTQPAQPVVAKPAPAPAPVVAPAAPPKRITLDSDANFDTDKSTLKADARERLNVLIEAANGTVFRAITINGYTDSTGSVEHNQALSERRAQAVATYLREHGLKAQKFDVRGYGESSPVASNATVEGRAKNRRVDITLE
>NZ_CP017561.1|WP_027198958.1|3285868_3287008_+|DUF2827-domain-containing-protein
MKIGISVLTHEGQSIWENGLGQNIFYFVQLLRGLPFVKEIVLLNCGDQPRLPPEAEALAQGVPLVAPRDLAELPDVIVEMGGGLDVEWLDYARAQGKKVVFFCCGQPYVGLIEPSVFQRDGYFSRATRCDEIWVLGKDRALMPMLRTLHRCPVFEVPFLWDSTFIEQRIAAVEQVGLKFGYQSRSALGESVRRSLRVAVFEPNISVVKCCVIPMLIGEAAFRAEPDAVKSLHLLNSVQMRDHPSFSFLLGSMDLHRQERVRLDGRHDFAGFMSQHADAVIAHHWQNDQNILYLDALYGGYPLIHNSPWLEGYGYYYPDSDIETGAAQLLRARQHDTHHKYYLQRTRSFLASLSPREPANISAYARRLLALTGKKSGMAA
>NZ_CP017561.1|WP_027198957.1|3287004_3288108_+|DUF2827-domain-containing-protein
MKKLKVGVTIYLRNGQQSIWENGIFQNCYFLAMLLKHAPNVEAAYLVNGGDGDPAASAHFLEFAPVPVIDLDAAREKLDVVIELSAQLNPDWARSFREKGGHVIGMRVANDYVIDIERMMFGLPHGMLVSGTPYSAIWTLPAFEKTCASYYETALRAPVKAMQHLWSPALVERSATAAFGYEPGRSRWRLAVLEPNICMVKTSHIPMLLADLAHRQQPHFIEYLRVFNTLQLKSDAQFVGFARSLDLVTQGRATFEPRLPVHEILTQQADAIVSHTWENTQNYVYYEALHGGYPLVHNSDLLGGCGYRYADFDCEGGALALREAFALHDATLEDYRAKARAFLTTLDPLGPANVEQYSAAIAAVVSG
>NZ_CP017561.1|WP_027198956.1|3288144_3289263_+|DUF2827-domain-containing-protein
MNRKLRIGITIGLHHEAESLWVNGIKQNALYLSKLFQHSPLHHEVTLVNTTNVAVTSALPWDLKRFPTRAFEDAKDRLDVLIELGGQISNEQTAYLKSRNTKIVSYCCGPEYVQMTEAMIFGRRLTDHVFINQHYDQVWVIPQVMETSAGFLGVLRRQKVVPVPFVWDPMCLAMRTKGMPFAGEYRPRKGPARISIMEPNIDVLKFCLNPLLIAESAYRQVGEKLGYVHVTNAEHLARTCPEFVGIAHYLDLVRDSKVSFVGRHDTPQFLAEHTDVVVSHQWGLALNYFYFDACWNGYALVHNAHLCKDVGYYYPQSDLDAGTQKLVHAIENHNGDWESYRVRQRAAIKPFLATHEPLIARYDELLAALVAA
>NZ_CP017561.1|WP_027198955.1|3289283_3290168_+|peptidyl-prolyl-cis-trans-isomerase
MRKTHMQNVRISRVTGFTFLAMVAAALHMPVALAVKPSVPAALPDTDDVVASVNGVAVHRAELYEAMIGRQESARPEILQGLVARELLRQAAEREGLGNTESVRAAMQKAKVDTENRLYVARHLSAEAVTDAQVRERYDAIVSELGPYQYQVSQMTFADEPTARFALMLLQNGESFAQVAARAQTSAAQTSWVSFKTPITDGHTQGVPVPLAHVITTLKTGEITRAPVRVGDSYMVARLDDRRDTVIPTYDEARESMRRTMQGKKNDDAFAGLVSRLAEKAVIRPQQAFRSASQ
>NZ_CP017561.1|WP_027198954.1|3290164_3291991_+|tetratricopeptide-repeat-protein
MKWLAEVEMQITRSDLIGASRLLDTHRAMESAEPRVLVACSRLLILRARLVEAQGLLEKALSVEPANVDALVERARLAVRLGDDAGAQDWFRRAWTTGARGDGWLIDWFDSASRLGRTNDAAEVAVILCRNFAADAGNWFRLGLAHQQERRHAQALDAYQHAANLNPHLPMLRNNMGAAHLELNRFEEARELFEATIADDPDHALAWTNLASVLLKTRKINDSLVAAERACALAPNYISALQTYSYVLREFQQFPTALQIAQRALSLQPDNASIVWTVAMLQLLLGDYENGWRNHEARWSGSPELRDVVPNIPAPRWNGESLGGKTLFVWGEQGHGDALQFVRFVPAVAEYVKQQGGKLVYCCFSSLQTLFARSLGDAVQTIVPHDLRPLPAFDFHLPIASLPLVLGVTLKDLPGQPYLKADPKKVQRPTLPGLSRDRKLRVGIAWSGSKTHQRNGLRSVDPMDYARAFAGIGNVTFVNLQMDAQAEVQRLRDSGLAVVDPTPEFSSFDDTAAVVSGLDLVMTVCTSIAHLAGGLGVPTWVQLDVNPHWIWMTERTDSPWYPQTRLYRQSTYGDWAPVFEALARDLAVLAFNHQTQVEQTENAMGSLH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

24310 : 36649

Streptococcus_phage(12.5%)

protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027198632.1\|24310_26416_-	elongation factor G	E4ZFJ7	Streptococcus_phage	3.5e-61	27.2
WP_027198631.1\|26575_27094_-	DUF192 domain-containing protein	A0A1B1IUW8	uncultured_Mediterranean_phage	5.6e-13	38.2
WP_082194658.1\|27239_27431_-	hypothetical protein	NA	NA	NA	NA
WP_027198630.1\|27928_28498_-	pseudouridine synthase	NA	NA	NA	NA
WP_027198629.1\|28863_30120_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	5.7e-11	63.0
WP_007180614.1\|30303_30510_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	2.4e-23	81.8
WP_008919570.1\|31066_31381_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	5.8e-13	44.6
WP_018421594.1\|31377_33675_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.2e-168	41.6
WP_027198628.1\|33819_34266_-	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	8.7e-47	61.6
WP_027198627.1\|34332_35349_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_027198626.1\|35431_36649_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	1.1e-43	34.0

DBSCAN-SWA_2

2213716 : 2221699

Escherichia_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027196860.1\|2213716_2214493_-	ABC transporter ATP-binding protein	Q66093	Chlorella_virus	2.9e-05	24.7
WP_027196859.1\|2214497_2215316_-	ABC transporter permease	NA	NA	NA	NA
WP_027196858.1\|2215317_2216733_-	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	1.7e-56	30.0
WP_027196857.1\|2216942_2217869_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.1e-30	34.2
WP_027196856.1\|2217878_2218430_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	9.4e-51	54.1
WP_027196855.1\|2218414_2219308_-	glucose-1-phosphate thymidylyltransferase RfbA	A0A291LA53	Escherichia_phage	2.9e-94	57.4
WP_027196854.1\|2219318_2220380_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	2.7e-86	47.6
WP_027196853.1\|2220787_2221699_-	GDP-mannose 4,6-dehydratase	E5ES47	Bathycoccus_sp._RCC1105_virus	1.1e-06	23.9

DBSCAN-SWA_3

2329516 : 2338560

unidentified_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027196763.1\|2329516_2331130_+	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	2.0e-24	30.2
WP_027196762.1\|2331181_2331724_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_027196761.1\|2331720_2332401_+	deoxynucleoside kinase	A0A249XZR7	Enterococcus_phage	3.3e-05	28.9
WP_027196760.1\|2332437_2333253_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	2.8e-35	29.6
WP_027196759.1\|2333301_2335188_-	aminodeoxychorismate synthase component I	S4VNU7	Pandoravirus	1.4e-53	36.9
WP_027196758.1\|2335206_2336343_-	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	3.7e-25	40.5
WP_027196757.1\|2336610_2338560_-	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	4.5e-148	49.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP017562

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

422910 : 477652

Streptococcus_phage(20.0%)

plate,transposase,integrase

attL 465691:465708|attR 485736:485753

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027194100.1\|422910_423645_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	3.8e-23	31.7
WP_071336681.1\|426778_426943_-	DUF2934 domain-containing protein	NA	NA	NA	NA
WP_027194102.1\|427421_427625_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	4.9e-21	76.1
WP_034477058.1\|429568_430492_+	sterol desaturase family protein	NA	NA	NA	NA
WP_027194104.1\|431097_432555_-	serine/threonine protein kinase	A0A2P1EMR8	Moumouvirus	1.5e-18	35.0
WP_027194105.1\|432595_433474_-	DUF3365 domain-containing protein	NA	NA	NA	NA
WP_027194106.1\|433530_434553_-	hypothetical protein	NA	NA	NA	NA
WP_027194107.1\|434718_435270_-	hypothetical protein	NA	NA	NA	NA
WP_027194108.1\|435314_436241_-	hypothetical protein	NA	NA	NA	NA
WP_027194109.1\|436262_436868_-	OmpA family protein	NA	NA	NA	NA
WP_051374155.1\|437028_437745_-	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_027194110.1\|437741_441287_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_027194111.1\|441333_442623_-	DotU family type VI secretion system protein	NA	NA	NA	NA
WP_027194112.1\|442646_443981_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_027194113.1\|444001_445747_-	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
WP_027194114.1\|445778_447770_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	5.7e-37	26.0
WP_018422989.1\|447771_448161_-	DUF4280 domain-containing protein	NA	NA	NA	NA
WP_027194115.1\|448184_450971_-	type VI secretion system ATPase TssH	H6X3M6	Enterobacteria_phage	1.3e-79	31.3
WP_027194116.1\|450975_452055_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_027194117.1\|452039_453935_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_018422993.1\|453939_454452_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_027194118.1\|454444_455281_-	virulence protein SciE type	NA	NA	NA	NA
WP_027194119.1\|455376_455865_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_027194120.1\|455910_457407_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_026226255.1\|457432_457933_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_027194121.1\|458026_459058_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_051374156.1\|459838_460615_+	hypothetical protein	NA	NA	NA	NA
WP_027194123.1\|460649_461447_+	serine/threonine-protein phosphatase	NA	NA	NA	NA
WP_027194124.1\|461478_462282_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_027194125.1\|462278_466838_-	filamentous hemagglutinin N-terminal domain-containing protein	NA	NA	NA	NA
465691:465708	attL	NA	NA	NA	NA
WP_027194126.1\|466909_468583_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_027194127.1\|468603_470790_-	CHAT domain-containing protein	NA	NA	NA	NA
WP_034477070.1\|471095_473081_+	DUF4384 domain-containing protein	NA	NA	NA	NA
WP_027194130.1\|475417_476275_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_027194131.1\|477088_477652_+\|integrase	site-specific integrase	NA	NA	NA	NA
485736:485753	attR	NA	NA	NA	NA

DBSCAN-SWA_2

2558657 : 2594238

Stx2-converting_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162162785.1\|2558657_2559044_+\|transposase	transposase	NA	NA	NA	NA
WP_027196540.1\|2559040_2559388_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	4.3e-33	62.9
WP_027196541.1\|2559439_2561038_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	3.7e-156	56.0
WP_034478420.1\|2562356_2563286_-	HTH-type transcriptional regulator ArgP	NA	NA	NA	NA
WP_051374323.1\|2563296_2564634_-	EAL domain-containing protein	NA	NA	NA	NA
WP_051374324.1\|2565491_2568509_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_027196544.1\|2568510_2569539_-	DUF1338 domain-containing protein	NA	NA	NA	NA
WP_027196545.1\|2569765_2571199_-	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_027196546.1\|2571593_2571962_-	DUF861 domain-containing protein	NA	NA	NA	NA
WP_027196547.1\|2572162_2572765_-	nitroreductase family protein	NA	NA	NA	NA
WP_027196548.1\|2572924_2573842_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_034478424.1\|2574140_2574641_-	flavin reductase family protein	NA	NA	NA	NA
WP_027196549.1\|2574669_2575995_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_027196550.1\|2576926_2578219_+	MFS transporter	Q6JIH2	Burkholderia_virus	9.3e-65	37.4
WP_034478427.1\|2578236_2579526_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_034478794.1\|2580429_2581689_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.7e-23	29.8
WP_154671775.1\|2582386_2583142_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	1.1e-20	40.4
WP_179950646.1\|2583150_2583948_-	DUF2968 domain-containing protein	NA	NA	NA	NA
WP_027196555.1\|2584237_2585389_-	porin	NA	NA	NA	NA
WP_027196556.1\|2585918_2587340_-	amidohydrolase	NA	NA	NA	NA
WP_027196557.1\|2587400_2588729_-	MFS transporter	NA	NA	NA	NA
WP_154671776.1\|2590027_2590507_-\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_154671777.1\|2591482_2592604_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.9e-38	35.6
WP_027196560.1\|2592721_2592901_-	hypothetical protein	NA	NA	NA	NA
WP_027196561.1\|2593212_2594238_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	2.2e-61	36.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP017563

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP017563_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017563_1

839836-840032

Orphan

Consensus_repeat	Method
GCGCAAAGGTGAGGTTGATTGTGCTTGA	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP017563_1

>merge|NZ_CP017563|1|839836-840032|PILER-CR
GCGCGAAGGTGAGGTGGATTGTGCTTGCGCGGTGATTCGCTGCTGAGCGGGCTTTTCACGTGGCGGCGGCTGATCGTTGGAGCGCGGCGTATATGGCTTTGTAGGTGAGGTTGATTGTGCAGTCACGCTCTGGGTCAGCCGCGAACTCGCTGGGAGCCGCGGAATCCCGGCTGAATGGTGAGGTTGATTGTGCTTTA

>NZ_CP017563|1|1|839836-840032|PILER-CR
GCGCGAAGGTGAGGTGGATTGTGCTTGCGCGGTGATTCGCTG	CTGAGCGGGCTTTTCACGTGGCGGCGGCTGATCGTTGGAGCGCGGCGTATATGGCTTTGTAGGTGAG
GTTGATTGTGCAGTCACGCTCTGGGTCAGCCGCGAACTCGCT	GGGAGCCGCGGAATCCCGGCTGAATGGTGAGGTTGATTGTGCTTTAGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017563.1\|WP_027194632.1\|847977_851037_+\|efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|223911
NZ_CP017563.1\|WP_027194634.1\|845269_845608_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017563.1\|WP_034477510.1\|856974_857511_+\|type-1-fimbrial-protein	unknown	unknown	gnl\|CDD\|226069
NZ_CP017563.1\|WP_027194646.1\|829206_830466_-\|arginine-deiminase	unknown	unknown	gnl\|CDD\|234949
NZ_CP017563.1\|WP_027194647.1\|828540_828876_-\|RcnB-family-protein	unknown	unknown	gnl\|CDD\|378715
NZ_CP017563.1\|WP_027194630.1\|852613_854050_+\|amino-acid-permease	unknown	unknown	gnl\|CDD\|163522
NZ_CP017563.1\|WP_027194633.1\|847006_847981_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273776
NZ_CP017563.1\|WP_071336712.1\|843655_843910_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017563.1\|WP_027194645.1\|830522_831944_-\|amino-acid-permease	unknown	unknown	gnl\|CDD\|163522
NZ_CP017563.1\|WP_027194640.1\|836347_837844_+\|GntP-family-permease	unknown	unknown	gnl\|CDD\|225330
NZ_CP017563.1\|WP_027194648.1\|827184_828441_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929
NZ_CP017563.1\|WP_027194642.1\|834442_834814_-\|GFA-family-protein	unknown	unknown	gnl\|CDD\|226314
NZ_CP017563.1\|WP_027194639.1\|837878_839282_-\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP017563.1\|WP_027194627.1\|856069_856720_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP017563.1\|WP_027194641.1\|835301_836345_+\|patatin-like-phospholipase-family-protein	unknown	unknown	gnl\|CDD\|224666
NZ_CP017563.1\|WP_027194637.1\|841529_842504_+\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|319251
NZ_CP017563.1\|WP_027194643.1\|833575_834316_-\|response-regulator	unknown	unknown	gnl\|CDD\|181883
NZ_CP017563.1\|WP_034477516.1\|832235_833579_-\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|236531
NZ_CP017563.1\|WP_027194638.1\|840321_841533_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|274585
NZ_CP017563.1\|WP_027194631.1\|851033_852512_+\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|273830

Protein	Function_ID	Function_description	E-value
NZ_CP017563.1\|WP_027194632.1\|847977_851037_+\|efflux-RND-transporter-permease-subunit	gnl\|CDD\|223911	COG0841, AcrB, Cation/multidrug efflux pump [Defense mechanisms].	0
NZ_CP017563.1\|WP_034477510.1\|856974_857511_+\|type-1-fimbrial-protein	gnl\|CDD\|226069	COG3539, FimA, P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion].	4.51628e-24
NZ_CP017563.1\|WP_027194646.1\|829206_830466_-\|arginine-deiminase	gnl\|CDD\|234949	PRK01388, PRK01388, arginine deiminase; Provisional.	0
NZ_CP017563.1\|WP_027194647.1\|828540_828876_-\|RcnB-family-protein	gnl\|CDD\|378715	pfam11776, RcnB, Nickel/cobalt transporter regulator. RcnB is a family of Proteobacteria proteins. RcnB is required for maintaining metal ion homeostasis, in conjunction with the efflux pump RcnA, family NicO, pfam03824.	7.44661e-15
NZ_CP017563.1\|WP_027194630.1\|852613_854050_+\|amino-acid-permease	gnl\|CDD\|163522	TIGR03810, arginine-ornithine_antiporter, arginine-ornithine antiporter. Members of this protein family are the arginine/ornithine antiporter, ArcD. This exchanger of ornithine for arginine occurs in a system with arginine deiminase, ornithine carbamoyltransferase, and carbamate kinase, with together turn arginine to ornithine with the generation of ATP and release of CO2. [Transport and binding proteins, Amino acids, peptides and amines].	4.62278e-156
NZ_CP017563.1\|WP_027194633.1\|847006_847981_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273776	TIGR01730, COG0845:_Membrane-fusion_protein, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. [Transport and binding proteins, Unknown substrate].	8.20186e-47
NZ_CP017563.1\|WP_027194627.1\|856069_856720_+\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	1.24992e-51
NZ_CP017563.1\|WP_027194645.1\|830522_831944_-\|amino-acid-permease	gnl\|CDD\|163522	TIGR03810, arginine-ornithine_antiporter, arginine-ornithine antiporter. Members of this protein family are the arginine/ornithine antiporter, ArcD. This exchanger of ornithine for arginine occurs in a system with arginine deiminase, ornithine carbamoyltransferase, and carbamate kinase, with together turn arginine to ornithine with the generation of ATP and release of CO2. [Transport and binding proteins, Amino acids, peptides and amines].	2.0506e-174
NZ_CP017563.1\|WP_027194640.1\|836347_837844_+\|GntP-family-permease	gnl\|CDD\|225330	COG2610, GntT, H+/gluconate symporter and related permeases [Carbohydrate transport and metabolism / Amino acid transport and metabolism].	5.15904e-53
NZ_CP017563.1\|WP_027194648.1\|827184_828441_+\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.23014e-90
NZ_CP017563.1\|WP_027194642.1\|834442_834814_-\|GFA-family-protein	gnl\|CDD\|226314	COG3791, COG3791, Uncharacterized conserved protein [Function unknown].	3.22547e-27
NZ_CP017563.1\|WP_027194639.1\|837878_839282_-\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	3.72048e-09
NZ_CP017563.1\|WP_027194641.1\|835301_836345_+\|patatin-like-phospholipase-family-protein	gnl\|CDD\|224666	COG1752, RssA, Predicted esterase of the alpha-beta hydrolase superfamily [General function prediction only].	9.62288e-39
NZ_CP017563.1\|WP_027194637.1\|841529_842504_+\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|319251	cd16393, SPO0J_N, Thermus thermophilus stage 0 sporulation protein J-like N-terminal domain, ParB family member. Spo0J (stage 0 sporulation protein J) is a ParB family member, a critical component of the ParABS-type bacterial chromosome segregation system. The Spo0J N-terminal region acts in protein-protein interaction and is adjacent to the DNA-binding domain that binds to parS sites. Two Spo0J bind per parS site, and Spo0J interacts with neighbors via the N-terminal domain to form oligomers via an Arginine-rich patch (RRXR). This superfamily represents the N-terminal domain of ParB, a DNA-binding component of the prokaryotic parABS partitioning system. parABS contributes to the efficient segregation of chromosomes and low-copy number plasmids to daughter cells during prokaryotic cell division. The process includes the parA (Walker box) ATPase, the ParB DNA-binding protein and a parS cis-acting DNA sites. Binding of ParB to centromere-like parS sites is followed by non-specific binding to DNA ("spreading", which has been implicated in gene silencing in plasmid P1) and oligomerization of additional ParB molecules near the parS sites. It has been proposed that ParB-ParB cross-linking compacts the DNA, binds to parA via the N-terminal region, and leads to parA separating the ParB-parS complexes and the recruitment of the SMC (structural maintenance of chromosomes) complexes. The ParB N-terminal domain of Bacillus subtilis and other species contains a Arginine-rich ParB Box II with residues essential for bridging of the ParB-parS complexes. The arginine-rich ParB Box II consensus (I[VIL]AGERR[FYW]RA[AS] identified in several species is partially conserved with this family and related families. Mutations within the basic columns particularly debilitate spreading from the parS sites and impair SMC recruitment. The C-terminal domain contains a HTH DNA-binding motif and is the primary homo-dimerization domain, and binds to parS DNA sites. Additional homo-dimerization contacts are found along the N-terminal domain, but dimerization of the N-terminus may only occur after concentration at ParB-parS foci.	8.15998e-42
NZ_CP017563.1\|WP_027194643.1\|833575_834316_-\|response-regulator	gnl\|CDD\|181883	PRK09468, ompR, osmolarity response regulator; Provisional.	1.82396e-80
NZ_CP017563.1\|WP_034477516.1\|832235_833579_-\|HAMP-domain-containing-protein	gnl\|CDD\|236531	PRK09467, envZ, osmolarity sensor protein; Provisional.	2.22402e-43
NZ_CP017563.1\|WP_027194638.1\|840321_841533_+\|AAA-family-ATPase	gnl\|CDD\|274585	TIGR03453, partition_RepA, plasmid partitioning protein RepA. Members of this family are the RepA (or ParA) protein involved in replicon partitioning. All known examples occur in bacterial species with two or more replicons, on a plasmid or the smaller chromosome. Note that an apparent exception may be seen as a pseudomolecule from assembly of an incompletely sequenced genome. Members of this family belong to a larger family that also includes the enzyme cobyrinic acid a,c-diamide synthase, but assignment of that name to members of this family would be in error. [Mobile and extrachromosomal element functions, Plasmid functions].	2.23345e-45
NZ_CP017563.1\|WP_027194631.1\|851033_852512_+\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	5.93345e-66

>NZ_CP017563.1|WP_027194639.1|837878_839282_-|replication-initiation-protein
MAADNPEEGRSKATSRQMALALFEDMFDQGLRINEANREIGYQRNDFFTEIVNMGLPARRFLDAAYFIVAQETEQRDQYDVELNYFKWLMRYDSRNLKHLRTIADEAQNAKVRVTNTPANRDPNEDDLWVQVQLIGMVGFHRGRMRFDVHPRLVPHIRDPQKSHWLSLRISTAFTRSLARAIYDKVLPHVPAGRTDWIQLEEMRNWPGKMGANAAIFKYFKRDWLEPAVREINEVSDVELSYETRTASTTSKKIDRIRFLLKRKDTADAVLASLADASHLYKILTDEFGLSTNQFSEISENRELWTDERIQQAVEYTRFRIKRGQVKKSPAGYLMRALRDNWKISDAERTMVDVQAKLLADEAQEQAVKTETRKTVAHSIATREEEVRARMNEDSRKGRDHFNAADAKTRKELMHAWTTSREGKLMLRRMKLEPSTVTEDAIFANTELVWYLGQFVFGRMNAARAAA
>NZ_CP017563.1|WP_027194640.1|836347_837844_+|GntP-family-permease
MDVIALSPLAIGLGLFGMLASLALLIGFAYRGWTVLLLAPFAAMLAAAISGEPILAHWTQTFMLSAARFLAQFFPLFLLGALFGKLMEDSGSVKAIASYMTQKLGAHRAILAVVIGGALVTYGGVSLFVAFFVLAPMATALFQAANVPRRLMPAAIALGTSTFTMSALPGTPAIQNAIPMPFFGTTPFAAPGLGIIASIVMVAFGLWWLSLQQSRARAANEGFDGLGAAAISARAPASENLVRERASVSQSFDPEEAKRGRLSEDLPPFVVALTPLVLVVLMNFVMNVIVLPRIDADYLADVRWGETSLAAVGGVWGVCVALTVAIVVLVLLNRRRLPALRETIDAGANASVLPVLSVASLVGYGAVIAALPAFALVREWVLGVGGGPLVSLAVATNLLAGLTGSASGGLTIALDALGSTYLQLAAQYGIDPALLHRVAVISSGTLDSLPHNGAVVTLLAVCGSTHRESYRDIVIVAILGALLALVVVIVLGSLVGSF
>NZ_CP017563.1|WP_027194641.1|835301_836345_+|patatin-like-phospholipase-family-protein
MAATKTQPARREPIRIDLALQGGGSHGAFTWGVLDRLLEESWLQIEGISGTSAGAMNAAVLVSGYQVDGAAGARAALEAFWRRVFEASVLSPFRRSPLDVMMGRWTLDFSPLFIAMDLAARLFSPYDLNPRGVHPLAKILQDSIDFAHLRDSPIKLFITATRVRTGQARVFRNADLTPDVLLASGCLPTLFQAVKIDGEDYWDGGYVGNPTITPLVRECTSSDTLLIQVNPVERKETPRTARDIISRLNEVAFNSPLLKELRMIALLRRAADAGSDEGRHWAAMRIHRISSEMMTELGYSSKLNAEWSFLTMLRDEGRRAADTFLTEHGESIGVRSSLDLDTLLDGV
>NZ_CP017563.1|WP_027194642.1|834442_834814_-|GFA-family-protein
MSAELLQGSCHCGAVKFEVRTEIVPAGRCNCSLCRRKGALMTPRFPASQLKILTGEDALTLYQFNTQVAKHYFCKHCGIYPFHQTRTDPQQWRVNIGCLDGVDPYALEAGVADGASLSLLEDA
>NZ_CP017563.1|WP_027194643.1|833575_834316_-|response-regulator
METSDHVLIVDDDRGIRELLAGYLEKNGVRISLAANGRQMRAALENGAPDLIVLDLMLPGEDGLALCRELRSGKFRTVPILMLTARSEEADRIVGLEMGADDYLTKPFAARELLARIRSVLRRARMLPPGMEVTESAPMLCFGDWRLDTTARHLLDADGTEVALSGAEYRLLRVFLDHPQRVLTRDQLLNLTQGRQADPFDRSIDLMVSRLRQRLRDGAREPRYIKTLRSEGYVFSAAVTATGDPA
>NZ_CP017563.1|WP_034477516.1|832235_833579_-|HAMP-domain-containing-protein
MNASPSASPVRWPHWPRTLFARLAVILFVGLALAQALSVWLTMTERDQTMTNIMMGYIEREVASSVALLDHLPADERAQWLPRLARRSYEFMLGPGVPGAPVDASVSARVARSIGDAIGTRYPLTVNAVPGAREHLQVHLKLSDGTPLTIDLRPMAGAPLSRWLPLVLTLQLLVLAGCCWLAVRLATRPLNQLAVAADTLGPDLKAARLPEAGPSEVARAARAFNAMQDRIATYMTERMQILAAISHDLQTPITRMRLRVDTMDHESEAAKLRQDLQEMEALVKEGVTYARTMHGTTEVPRRIDPDALFDSLVCDYVDAGQPVSLQGRFGQSLTMRPQALKRIVGNLVDNALKFGGAAQIEIGALHDGELTVSVLDRGPGIPAESLETVFEPFVRLEGSRNRQTGGTGLGLAIARQLALAMDATLTLHNRVGGGLEARLTLRKLSES
>NZ_CP017563.1|WP_027194645.1|830522_831944_-|amino-acid-permease
MASTPQKMSKMQLTGMVVGGMVGAGIFSLPRTFANATGPLGAVIAWLIAGTGMYMLARVFQALAERKPELDAGVFAYAKAGFGDYPGFLSAFGYWIGSCIGNVSYWVLIKSTLGAFFPAFGDGNTVVAIVVASIGIWLFHFMILKGVQQAAFINSIVTVAKIIPILVFILILIFGFRMDLFQANLYGGGLEGNILEQVRATMLVTVFVFIGIEGASVYSRYAKKRSDVGQATILGFVLVTALMVLVTMLPYAVLQRADVAAMRQPSMAAVLEAVVGHWGAVFVSIGLLISVLGAYLAWSLICAEVLFTAARTEDMPAVFARENANKVPANALWLTNIVVQLLVISTYFSRDAFALMLNLTSAMSLIPYLFVAVYGCMTANRGDGYDVRPEERRRDLIMAAIASIYTVFMIWAGGLKFILLSAVLYAPGTALYIWARRERSKNVFVASDWIIFIVAVIGAIIGIHGLVTGRIAL
>NZ_CP017563.1|WP_027194646.1|829206_830466_-|arginine-deiminase
MANTDAKAGELGVYSEVGQLRKVMVCAPGLAHQRLTPSNCDELLFDDVLWVENAKRDHFDFVTKMRDRGVEVVEMHNLLAETVAVPEGKKWILDNQVVPNQVGLGFIDELRSYLEGLDNRKLAETLIGGLSTHDFPEAHGGKALEVAKEAAGGTEYLLPPLPNTLYTRDTTCWIYGGVTLNALYWPARHEETILTTAIYKFHPDFAGKVNVWWGDPTRDHGLATLEGGDVMPIGKGVVLIGMSERTSRQAISQLAATLFKKGAAERVIVAAMPKIRAAMHLDTVFTFADRDCVLVAPDFMAKTRTYSYRPSSHPSGVELHADNKPFTDVVAEALGLKQLRVVEAGGSDYQRERTQWDSGANLVCASPGVVYAYDRNTYTNTLLRKQGIEVITIVGAELGRGRGGGHCMTCPIIRDAVDY
>NZ_CP017563.1|WP_027194647.1|828540_828876_-|RcnB-family-protein
MNNRIVVQLVALSFAGMSALAIAAGPPQGEGGGQMAGMGRQQVMPSIPHRDWHKGQRVPAEYRHYNFIMDDWRGHGLNAPPRGHKWLGVNGDYVLVTTNNWTISNIVAGTE
>NZ_CP017563.1|WP_027194648.1|827184_828441_+|MFS-transporter
MKTPSDVQPYQAATHPTVSQGRWLLVFVLGYLALIADGADVMMYGLTLSRIKDDFGLTNVEAGALGSLTLLGMAIGGIVGGWASDRLGRVRVVAWALALFSLGAGMLGFTHSFVEFAAVRFISSLGIGCMVLVTTLVAEYVPTERRSLVLGMLQTGISAGYIVVIALSNWILPQYGWRTLYYVSAVPVVLAFAIKFAVPEPAAWVASRAADRNNTARLVDNRYAQIFRDRQTRTMFILWTFASIFVLSGFYGLNNWLPTYLEKELHIKFSSLTGYMIGTYVVAFIGKIFAGWLGDRWSRRGVYVLGCIGAALFLPVIIFWHTRDNISTLMLFFGFLYGVPLGTIGTFMSESFATSVRGTAVGGSYNLGRFCSGAAPIIIGYIATQFSIGLGFLVVGAVFFLSGVTALFIPDRLYDTQR
>NZ_CP017563.1|WP_027194638.1|840321_841533_+|AAA-family-ATPase
MVRTSQLPAVDRTVHFEQISQFAEKVTIFTNELRDTILAPRPRKTAPVFKTGEIAEMCNVSHSQVQYLATKGDGDLPSGTAAGTGRTRTFTLEEARIWVQKISDIYQTPLVTRLKEPDGKIIITAQLKGGSAKTTTTMCLAQGLSLRGRKVLVVDLDPQASLSELCGLYAEKDVTPEDTVLPYVYEQDIEGGLEGRVQSTYWDGIDVIPAHTELIGAEFHLPAMQKVRPGFRFWTVLRQGLEPLRKKYDYILMDTSPSLSYLNLNALMAADAMVMPMVPENLDFISSLSFWRLFSDVSKSFIKFEKDKKYDFVSLVLSRVDYGRTSSAPIVRAWAQSAYENWLHSIEVPASSVMSTGALAFSTVFDISSNHSAAKSLQRVRQPLVDYCRWIDEIYSEKWRNAQ
>NZ_CP017563.1|WP_027194637.1|841529_842504_+|ParB/RepB/Spo0J-family-partition-protein
MSNMREQLLAKTSGIRKTSSINEDEVKRSNRTQTAPGLAGALAVAQLRVQELESTGIASQLPVAGILPNPWQPRRVFNEAKLAELAESIREVGLMQPIVVRRLADDYQIVAGERRWRAHKMLGLDSIKAVVADCSDSDMAVLAMVENISRDDLADYEIGVAIRRSETEFPNRKRLAEAMGLSRAGLYQFLSFENLPDFIKKDLDIQPRLLGGTAAQAIAAAIKKHGEDGVKAAREIWPLLVRGEMDQGKVAAAITALATRQTTSAGTGGRNIEKFFAGREHAGSITKDVSNFTIKIKTGVITEAQEIQIRQLIGQMFQSQPKTN
>NZ_CP017563.1|WP_071336712.1|843655_843910_+|hypothetical-protein
MIVMQFRRCTDRMSLRVAPLIRRATIIAARGSAENQPHDAQDRGGATTKTIAAVKRRLERSPATLIDATMIVNNVSRRIGETPI
>NZ_CP017563.1|WP_027194634.1|845269_845608_-|hypothetical-protein
MAESVPVCDRRASPSFQQAAIANSPANASQWSDAQFDPWLATVRFAYACLCLGQRAAGERAFEDGQSQARDYCNYAVQELAGVLFCATRSKPVPATWNRARSTPWAGPFICT
>NZ_CP017563.1|WP_027194633.1|847006_847981_+|efflux-RND-transporter-periplasmic-adaptor-subunit
MQLTKVEPADASAIRIFTGRVEQTSISPLAFEVSGRVVQIAVLEGVSVKRGQLIARIDEEPYKLQLQRANAQYQQLSDNLKRQAVLRKDGILSQAAYEQLSAATDAARAARDMASRDLRNTRLVAPFDGRIARRNIEIQQVVQAGAPAFNLENIGRVDVGVDLPQSIAERLFVDKTLRAEAWLPERPQNRFALVFRERSTQTSPTSAAYRLVFSIQGPQGAMLFPGMALRVQISDTARQVSQNGNSGYFAIPIAAMSIGPDGQRSLWRYDAASGRVHAVPVSVREIRNDDVVVAGAVAQGDRVVAGGSQFMKEGMVVRPMDAPR
>NZ_CP017563.1|WP_027194632.1|847977_851037_+|efflux-RND-transporter-permease-subunit
MNLARPLIDKPLIAWVLTLISLLGGIFAYFNIGRLEDPKFTIKTAVVVTLYPGASAHEVEHEVTDRLESAIQQMPQVDKLTSRSTPGYSEVRVEIRDQYTSAQLPQVWDEVRKSVSDAQPRLPPGAGPSLVVDRFGDVYGMFYALTGEGYTQAQLYEYARELRRQLLTLGDVSDIVIAGEQQEQISVDVDQSQLIANNLSTDDLAQTLFLQNEVRPAGRERVGDLSLRIAPTGSLDSLQAIRSLPVNNTPGPLLLGDIARVSHGYATIPNHVIHYNGQPAITIGISARPRVNVVSVGAKIKAKLAELERDRPIGIKLYPLYDQPQVVDESVRGFIFDVFLSVAIVGVALGIALGWRAGVVLGVELFLSILGTLLVMYAAGIELQRISLGALIIVMGMLTDNSIVVVEGMLVKVQRGTSHLQAATEILKQSQWLLLASTVVGILAFSGIGLSPDSVGEFCASLFAVAAISLLFSWVIAIALTPLFGTYLFKPADIIDDDPFKSKLYKRYGELLSWVTRQRVFVVIGLVALTVLAGWAFRFVERSFFPASTTPIFYVDMRLPRGTDIRAVVEKSREVEKVLLKHADVTNVQTYIGSGATRFFLVYDPETRDPSYAQFIVGAKDQSLIDDMIPDIEADLKKRFPDQHWTVTRPNFGPGGGAAIQARFSGPDPAVLRRLSQEAQNVLKADGRIIAIRDDWENPISIVRPEFDESRARSLGVTRRQVSDTMAYATEGLRAGIYREGDQLLPIVLRSPDYTLGVAGLQDLQVFSAGLRRYVPLGDVVNGFTVGTEEGQIARENRIRTLTVSANPIYGQNSVDAFNRIRSSIENIKLPPGYSFEWGGEHESSTRAQQSLFRQLPLGFIGMALLVLMMFGRLKPALVVLLVVPMSIVGVTLGLLLFRGAFGFMALLGLLSLIGMLIKNGVVLVEEMDSQIAAGVPRMQAVTHGAMNRLRPVILGGGTTALGMAPLLWDPFFKDMAITIMAGLVFATVLTLVAVPALYAMLFSIRQAEWEPGRHPEAK
>NZ_CP017563.1|WP_027194631.1|851033_852512_+|efflux-transporter-outer-membrane-subunit
MIHARRWLLAIAALLLEAGCTGSLQLQKPAAFAPQYSEAQPGVATPMSEQQLAAWWTQYNDPTLNKLIDLALAHNFDIATAYARVDQVQAGIRLARSQLLPSVGASVSAAKYHGGETQLEFEELLGINNTDAQFWRVGLQAQWEIDLFGQGRARLSAAREQARAAAGDAEAVRLSVVSGVADLYVTYRGLLRQRTILLQSRAIADDFVNIAEKSFTAGLVLSTDIEAARAGRAQVDARLQDVENGIAQARLNLQNLCGVQPTEFAGLLDESDTLMTALPHVEPGQPVDLLMRRPDLIAAQARVNAAVRQSDVARLNYWPTISLSGLLARNGWEIAGQNLGASTFWLFGAAMAMPLIDFGARRSQVESSDAQAQQAMFNYEKTALGAFYDVDRALARLNRQDELFKARNEEVTRRTTQLSQVQRRYQLGDTGRVDIDRVRVALLESQSSQVREEVGKLQAQFALFRAMGGGWLASPPVAANTRTPTGPAPASQ
>NZ_CP017563.1|WP_027194630.1|852613_854050_+|amino-acid-permease
MATQLDTKLSLPALTAMVVGSMVGAGIFSLPRNFARATGPFGAVIAWCVAGIGMYALARVFQALAQRRPELDAGVFAYARAGFGDYAGFLSAFGYWMAGCFGNVSYWVLIKSTLGAFVPVFGNGNTATAIIVSSVGIWLFHLVMLRGVQQATMINTIVTVAKLIPIVLFIVMLVALFRTDMFRANLGEGSDQIGAGLFSQVRATMLVTVFVFVGIEGASVYSRYAKKRTDVGAATITGFVAVLCLLVLVTLLPYATLPRADIAVMRQPSMAAVLGALLGPFGVIFVSAGLIVSILGAYLAWSLICAEVLFAAARLETMPRVFARQNERKLPVAAVWLTSTVVQLFVISTYWSTDAFALMLNLTSSMALIPYFLVAAYGIKAARHDSGQGGGALSGALRTEYFVAMFATLYTAFLLFAGGLKFLMLSALLYAPGTVLYVVAKRERALRVFSKVEWVIFAVAACGAIAALIGLATGTIVI
>NZ_CP017563.1|WP_027194627.1|856069_856720_+|response-regulator-transcription-factor
MKKIRVGIADDHPFILLGVEHLLRPCPDMQVCFKCESIGRLLELLVEMPVDVLVCDYEFEGDPYADGLNLLDRIQRVAPAIRVVFLSSHSSTHIISAALNAGAAGFVGKGPEGFVSLAAAIRAAKNKSLFLPDSIANRMLSTTGRAAEGGSSLNSLSEKESTVVRMICDGMSIGAIAERLNRSPKTVSNQKNAGMKKLGARNDVELVTIVREWYCS
>NZ_CP017563.1|WP_034477510.1|856974_857511_+|type-1-fimbrial-protein
MKKQMKHLMIALAGLSVAPMVFAQTAPGTGKVTFNGELYDETCVINAGDEDKTVTLPTLSTQSLATAGQVRGSKMFDISVSQCPASLSTVAAHFETTNMNPNTRNAINQAATSPAGNVEVQLLDGDGETPILLGSTGTFVPVASDGTATMSYGGQYYATDKTTAGNVTAVVRYTLAYQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP017563_1	1.2\|839987\|48\|NZ_CP017563\|PILER-CR	839987-840034	48	NZ_CP017563	Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence	839957-840004	0	1.0
NZ_CP017563_1	1.1\|839878\|67\|NZ_CP017563\|PILER-CR	839878-839944	67	NZ_CP017563	Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence	839871-839937	7	0.896

1. spacer 1.2|839987|48|NZ_CP017563|PILER-CR matches to NZ_CP017563 (Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence) position: , mismatch: 0, identity: 1.0

gtcacgctctgggtcagccgcgaactcgctgggagccgcggaatcccg	CRISPR spacer
gtcacgctctgggtcagccgcgaactcgctgggagccgcggaatcccg	Protospacer
************************************************

2. spacer 1.1|839878|67|NZ_CP017563|PILER-CR matches to NZ_CP017563 (Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence) position: , mismatch: 7, identity: 0.896

ttcgctgctgagcgggcttttcacgtggcggcggctgatcgttggagcgcggcgtatatg	CRISPR spacer
ttcgctgctgagcgggcttttcacgtggcggcggctgatcgttggagcgcggcgtatatg	Protospacer
************************************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP017565

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

12638 : 72403

Staphylococcus_phage(25.0%)

transposase,integrase

attL 69311:69349|attR 72468:72506

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027196582.1\|12638_14138_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_082194590.1\|15091_16195_+	GTP-binding protein	NA	NA	NA	NA
WP_027196583.1\|16191_17223_+	WD40 repeat domain-containing protein	NA	NA	NA	NA
WP_154671786.1\|17437_17929_-	hypothetical protein	NA	NA	NA	NA
WP_027196584.1\|18551_18821_+	hypothetical protein	NA	NA	NA	NA
WP_051374351.1\|19217_20252_+	PAAR domain-containing protein	E5E3Y0	Burkholderia_phage	6.6e-05	41.1
WP_027196585.1\|20281_21169_+	hypothetical protein	NA	NA	NA	NA
WP_027196586.1\|21565_23011_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_154671787.1\|23322_24066_-	hypothetical protein	NA	NA	NA	NA
WP_034478907.1\|24413_25394_+	DUF3298 domain-containing protein	NA	NA	NA	NA
WP_051374353.1\|25642_25984_-	DUF4087 domain-containing protein	NA	NA	NA	NA
WP_071336742.1\|26327_28055_-	MCP four helix bundle domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	6.7e-10	30.3
WP_027196590.1\|28292_28556_-	hypothetical protein	NA	NA	NA	NA
WP_174566143.1\|28790_29057_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_027196591.1\|30686_31874_-	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_082194592.1\|31961_33440_-	MFS transporter	NA	NA	NA	NA
WP_027196592.1\|33816_34587_-	SDR family NAD(P)-dependent oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	1.6e-08	30.2
WP_027193605.1\|34697_35381_-	nitroreductase	M1I6Q5	Acanthocystis_turfacea_Chlorella_virus	6.9e-27	34.7
WP_071336743.1\|35410_37105_-	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	6.7e-63	34.6
WP_071336744.1\|37348_37996_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_083421027.1\|38389_40276_-	tannase/feruloyl esterase family alpha/beta hydrolase	NA	NA	NA	NA
WP_027196594.1\|40653_40929_-	hypothetical protein	NA	NA	NA	NA
WP_051374354.1\|41056_41914_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_034478912.1\|43060_44248_+	CoA transferase	NA	NA	NA	NA
WP_154671795.1\|44428_45307_+	EamA family transporter	NA	NA	NA	NA
WP_027196596.1\|45508_46120_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_027196597.1\|46160_46811_-	maleylacetoacetate isomerase	NA	NA	NA	NA
WP_051374355.1\|46880_47972_-	hypothetical protein	NA	NA	NA	NA
WP_027196598.1\|47993_49079_-	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L7I1	Tupanvirus	5.0e-80	42.2
WP_027196599.1\|49094_50078_-	aldo/keto reductase	NA	NA	NA	NA
WP_027196600.1\|50089_50503_-	cupin domain-containing protein	NA	NA	NA	NA
WP_027196601.1\|50604_51498_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_154671789.1\|51831_52053_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_162162786.1\|54563_54875_-	hypothetical protein	NA	NA	NA	NA
WP_027196604.1\|54785_54980_+	YqaE/Pmp3 family membrane protein	NA	NA	NA	NA
WP_027196605.1\|55017_55212_+	hypothetical protein	NA	NA	NA	NA
WP_034478923.1\|55221_55548_+	H-NS histone family protein	NA	NA	NA	NA
WP_027196606.1\|55709_56108_+	hypothetical protein	NA	NA	NA	NA
WP_154671796.1\|58099_58480_-	DUF1330 domain-containing protein	NA	NA	NA	NA
WP_027196608.1\|58526_58859_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_027196609.1\|59069_60095_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	1.7e-05	21.8
WP_027196610.1\|60214_60514_-	hypothetical protein	NA	NA	NA	NA
WP_027196611.1\|61219_62188_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_083421030.1\|62751_64374_+	PQQ-dependent dehydrogenase, methanol/ethanol family	NA	NA	NA	NA
WP_154671790.1\|65029_65557_+	hypothetical protein	NA	NA	NA	NA
WP_154671791.1\|65676_68934_+	hypothetical protein	NA	NA	NA	NA
69311:69349	attL	NA	NA	NA	NA
WP_027196614.1\|69466_70426_+\|integrase	tyrosine-type recombinase/integrase	A0A142K7N4	Mycobacterium_phage	3.1e-09	32.4
WP_027196615.1\|70422_71397_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_027196616.1\|71389_72403_+\|integrase	site-specific integrase	NA	NA	NA	NA
72468:72506	attR	NA	NA	NA	NA

DBSCAN-SWA_2

191667 : 277474

Stx2-converting_phage(25.0%)

transposase,integrase

attL 191541:191600|attR 196463:196560

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
191541:191600	attL	NA	NA	NA	NA
WP_027196616.1\|191667_192681_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_027196615.1\|192673_193648_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_027196614.1\|193644_194604_-\|integrase	tyrosine-type recombinase/integrase	A0A142K7N4	Mycobacterium_phage	3.1e-09	32.4
WP_034476854.1\|194966_195521_-	AAA family ATPase	NA	NA	NA	NA
WP_027193595.1\|195871_196222_+	glyoxalase/bleomycin resistance/dioxygenase family protein	NA	NA	NA	NA
WP_051374096.1\|197300_198890_-	response regulator	W8CYF6	Bacillus_phage	1.7e-15	25.1
196463:196560	attR	NA	NA	NA	NA
WP_027193598.1\|198892_199696_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_051374161.1\|200015_200270_+	DUF378 domain-containing protein	NA	NA	NA	NA
WP_154671642.1\|200280_200535_+	hypothetical protein	NA	NA	NA	NA
WP_154671643.1\|200614_201317_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	2.8e-39	41.5
WP_174566145.1\|202320_202491_-	hypothetical protein	NA	NA	NA	NA
WP_027193601.1\|202525_202795_-	DUF1488 family protein	NA	NA	NA	NA
WP_071336757.1\|204835_206725_+	tannase/feruloyl esterase family alpha/beta hydrolase	NA	NA	NA	NA
WP_027193603.1\|207118_207766_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_071336758.1\|208016_209711_+	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	1.7e-66	36.1
WP_027193605.1\|209740_210424_+	nitroreductase	M1I6Q5	Acanthocystis_turfacea_Chlorella_virus	6.9e-27	34.7
WP_034476863.1\|210827_211034_+	hypothetical protein	NA	NA	NA	NA
WP_154671644.1\|213016_213175_+	hypothetical protein	NA	NA	NA	NA
WP_027193607.1\|215206_215989_-	N-acyl homoserine lactonase family protein	NA	NA	NA	NA
WP_027193608.1\|216049_217072_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_027193609.1\|217443_217812_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_051374162.1\|217969_218857_+	xylose isomerase	NA	NA	NA	NA
WP_027193610.1\|218853_219909_+	isopenicillin N synthase family oxygenase	S4VNP9	Pandoravirus	6.9e-18	31.8
WP_027193612.1\|220360_221122_+	urea carboxylase-associated family protein	NA	NA	NA	NA
WP_027193613.1\|221132_221783_+	urea carboxylase-associated family protein	NA	NA	NA	NA
WP_027193614.1\|221979_225603_+	urea carboxylase	NA	NA	NA	NA
WP_027193615.1\|225649_227482_+	allophanate hydrolase	NA	NA	NA	NA
WP_027193616.1\|227530_228502_+	ABC transporter permease	G3M9Y4	Bacillus_virus	3.1e-20	26.2
WP_027193617.1\|228559_229471_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.8e-37	37.3
WP_027193619.1\|230146_230818_+	AMP-binding protein	NA	NA	NA	NA
WP_082194419.1\|232675_233218_-	malonate decarboxylase holo-ACP synthase	NA	NA	NA	NA
WP_027193620.1\|233344_234112_-	malonate transporter subunit MadM	NA	NA	NA	NA
WP_027193621.1\|234696_236700_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.5e-37	37.1
WP_027193622.1\|236860_238246_-	hypothetical protein	NA	NA	NA	NA
WP_051374163.1\|240171_240465_+	hypothetical protein	NA	NA	NA	NA
WP_027193623.1\|241650_242628_-	hypothetical protein	NA	NA	NA	NA
WP_027193624.1\|242656_245017_-	MMPL family transporter	NA	NA	NA	NA
WP_027193625.1\|245080_246916_-	DUF1302 family protein	NA	NA	NA	NA
WP_027193626.1\|247001_248363_-	DUF1329 domain-containing protein	NA	NA	NA	NA
WP_034476873.1\|251831_252248_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_027193630.1\|252244_252589_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	3.6e-40	69.6
WP_154671679.1\|252667_254212_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	2.7e-135	54.3
WP_051374100.1\|255172_256411_-	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_027193632.1\|256471_257401_-	carbon starvation induced protein CsiD	NA	NA	NA	NA
WP_027193633.1\|257496_258408_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_154671645.1\|258540_258972_-	hypothetical protein	NA	NA	NA	NA
WP_051374102.1\|260630_261857_-	pyrroloquinoline quinone biosynthesis protein PqqE	NA	NA	NA	NA
WP_027193637.1\|261801_262077_-	pyrroloquinoline quinone biosynthesis peptide chaperone PqqD	NA	NA	NA	NA
WP_027193638.1\|262073_262826_-	pyrroloquinoline-quinone synthase PqqC	NA	NA	NA	NA
WP_027193639.1\|262898_263810_-	pyrroloquinoline quinone biosynthesis protein PqqB	NA	NA	NA	NA
WP_082194460.1\|263891_263963_-	pyrroloquinoline quinone precursor peptide PqqA	NA	NA	NA	NA
WP_027193640.1\|264970_266017_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_051374103.1\|266063_268139_-	PQQ-binding-like beta-propeller repeat protein	NA	NA	NA	NA
WP_027193641.1\|268309_268957_-	NADPH-dependent F420 reductase	NA	NA	NA	NA
WP_051374104.1\|269059_271372_-	5-amino-6-(D-ribitylamino)uracil--L-tyrosine 4-hydroxyphenyl transferase CofH	NA	NA	NA	NA
WP_027193642.1\|271643_272381_+	coenzyme F420-0:L-glutamate ligase	NA	NA	NA	NA
WP_027193643.1\|272377_273316_+	2-phospho-L-lactate transferase	NA	NA	NA	NA
WP_051374105.1\|273312_273900_+	2-phospho-L-lactate guanylyltransferase	NA	NA	NA	NA
WP_154671679.1\|275929_277474_-\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	2.7e-135	54.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP017561

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP017562

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP017563

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP017565

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection