CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP017959	Lactiplantibacillus plantarum strain C410L1 plasmid unnamed5, complete sequence	0 crisprs	NA	0	0	0
NZ_CP017960	Lactiplantibacillus plantarum strain C410L1 plasmid unnamed6, complete sequence	2 crisprs	NA	0	2	0
NZ_CP017955	Lactiplantibacillus plantarum strain C410L1 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0	1
NZ_CP017957	Lactiplantibacillus plantarum strain C410L1 plasmid unnamed3, complete sequence	0 crisprs	NA	0	0	3
NZ_CP017958	Lactiplantibacillus plantarum strain C410L1 plasmid unnamed4, complete sequence	0 crisprs	csa3	0	0	0
NZ_CP017954	Lactiplantibacillus plantarum strain C410L1 chromosome, complete genome	2 crisprs	csa3,cas3,DEDDh,DinG,WYL	8	1	6
NZ_CP017956	Lactiplantibacillus plantarum strain C410L1 plasmid unnamed2, complete sequence	0 crisprs	NA	0	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP017960_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017960_1

6855-6956

Orphan

Consensus_repeat	Method
GTCTATTTTTTAGACTTTCGCTCGTAGCAAGGGTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP017960_1

>merge|NZ_CP017960|1|6855-6956|CRISPRCasFinder
GTCTATTTTTTAGACTTTCGCTCGTAGCAAGGGTTTGCGGGGTGTCATCAACGGACTTTCGCGAAGGTCTATTTTTTAGACTTTCGCTCGTAGCAAGGGTTT

>NZ_CP017960|1|1|6855-6956|CRISPRCasFinder
GTCTATTTTTTAGACTTTCGCTCGTAGCAAGGGTTT	GCGGGGTGTCATCAACGGACTTTCGCGAAG
GTCTATTTTTTAGACTTTCGCTCGTAGCAAGGGTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017960.1\|WP_187337836.1\|10962_11568_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017960.1\|WP_080487867.1\|11802_11958_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379050
NZ_CP017960.1\|WP_071543029.1\|13313_13598_-\|Abi-family-protein	unknown	unknown	gnl\|CDD\|377910
NZ_CP017960.1\|WP_080487863.1\|10868_11027_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379050
NZ_CP017960.1\|WP_071543026.1\|10206_10392_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017960.1\|WP_187337834.1\|532_745_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|271192
NZ_CP017960.1\|WP_155118894.1\|12075_12291_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|173776
NZ_CP017960.1\|WP_011668984.1\|3281_3605_+\|plasmid-maintenance-system-killer-protein	unknown	unknown	gnl\|CDD\|282822
NZ_CP017960.1\|WP_071543018.1\|1160_1445_-\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	unknown	unknown	gnl\|CDD\|225619
NZ_CP017960.1\|WP_187337835.1\|8986_9808_+\|Dam-family-site-specific-DNA-(adenine-N6)-methyltransferase	unknown	unknown	gnl\|CDD\|273146
NZ_CP017960.1\|WP_155118892.1\|10414_10564_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017960.1\|WP_071543019.1\|1577_3209_+\|type-IV-secretory-system-conjugative-DNA-transfer-family-protein	unknown	unknown	gnl\|CDD\|226036
NZ_CP017960.1\|WP_071543017.1\|782_1160_-\|type-II-toxin-antitoxin-system-YafQ-family-toxin	unknown	unknown	gnl\|CDD\|379750
NZ_CP017960.1\|WP_071543020.1\|3618_3954_+\|HigA-family-addiction-module-antidote-protein	unknown	unknown	gnl\|CDD\|274228
NZ_CP017960.1\|WP_155118895.1\|13810_14200_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017960.1\|WP_071543022.1\|4791_5952_+\|relaxase/mobilization-nuclease-domain-containing-protein	unknown	unknown	gnl\|CDD\|367497
NZ_CP017960.1\|WP_071543024.1\|8109_8697_+\|DUF536-domain-containing-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP017960.1\|WP_071543029.1\|13313_13598_-\|Abi-family-protein	gnl\|CDD\|377910	pfam07751, Abi_2, Abi-like protein. This family, found in various bacterial species, contains sequences that are similar to the Abi group of proteins, which are involved in bacteriophage resistance mediated by abortive infection in Lactococcus species. The proteins are thought to have helix-turn-helix motifs, found in many DNA-binding proteins, allowing them to perform their function.	2.35596e-13
NZ_CP017960.1\|WP_071543020.1\|3618_3954_+\|HigA-family-addiction-module-antidote-protein	gnl\|CDD\|274228	TIGR02607, Virulence-associated_protein_I, addiction module antidote protein, HigA family. Members of this family form a distinct clade within the larger family HTH_3 of helix-turn-helix proteins, described by pfam01381. Members of this clade are strictly bacterial and nearly always shorter than 110 amino acids. This family includes the characterized member HigA, without which the killer protein HigB cannot be cloned. The hig (host inhibition of growth) system is noted to be unusual in that killer protein is uncoded by the upstream member of the gene pair. [Regulatory functions, DNA interactions, Regulatory functions, Protein interactions, Mobile and extrachromosomal element functions, Other].	4.9958e-10
NZ_CP017960.1\|WP_187337834.1\|532_745_+\|hypothetical-protein	gnl\|CDD\|271192	cd01192, INT_C_like_3, Uncharacterized site-specific tyrosine recombinase, C-terminal catalytic domain. Tyrosine recombinase (integrase) belongs to a DNA breaking-rejoining enzyme superfamily. The catalytic domain contains six conserved active site residues. The recombination reaction involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	1.98884e-26
NZ_CP017960.1\|WP_155118894.1\|12075_12291_+\|hypothetical-protein	gnl\|CDD\|173776	cd01026, TOPRIM_OLD, TOPRIM_OLD: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in bacterial and archaeal nucleases of the OLD (overcome lysogenization defect) family. The bacteriophage P2 OLD protein, which has DNase as well as RNase activity, consists of an N-terminal ABC-type ATPase domain and a C-terminal Toprim domain; the nuclease activity of OLD is stimulated by ATP, though the ATPase activity is not DNA-dependent. Functional details on OLD are scant and further experimentation is required to define the relationship between the ATPase and Toprim nuclease domains. The TOPRIM domain has two conserved motifs, one of which centers at a conserved glutamate and the other one at two conserved aspartates (DxD). The conserved glutamate may act as a general acid in strand cleavage by nucleases. The DXD motif may co-ordinate Mg2+, a cofactor required for full catalytic function.	0.000882427
NZ_CP017960.1\|WP_011668984.1\|3281_3605_+\|plasmid-maintenance-system-killer-protein	gnl\|CDD\|282822	pfam05015, HigB-like_toxin, RelE-like toxin of type II toxin-antitoxin system HigB. This family carries several different examples of type II bacterial toxins of toxin-antitoxin systems including many HigB-like ones. The fold is referred to as the RelE/YoeB/Txe/Yeeu fold suggesting all examples of these are present in this family. Several plasmids with proteic killer gene-systems have been reported. All of them encode a stable toxin and an unstable antidote. Upon loss of the plasmid, the less stable inhibitor is inactivated more rapidly than the toxin, allowing the toxin to be activated. The activation of these systems results in cell filamentation and cessation of viable cell production. It has been verified that both the stable killer and the unstable inhibitor of the systems are short polypeptides. This family corresponds to the toxin.	0.00588913
NZ_CP017960.1\|WP_071543018.1\|1160_1445_-\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	gnl\|CDD\|225619	COG3077, RelB, DNA-damage-inducible protein J [DNA replication, recombination, and repair].	8.19022e-09
NZ_CP017960.1\|WP_187337835.1\|8986_9808_+\|Dam-family-site-specific-DNA-(adenine-N6)-methyltransferase	gnl\|CDD\|273146	TIGR00571, DNA_adenine_methylase, DNA adenine methylase (dam). All proteins in this family for which functions are known are DNA-adenine methyltransferases. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). The DNA adenine methylase (dam) of E. coli and related species is instrumental in distinguishing the newly synthesized strand during DNA replication for methylation-directed mismatch repair. This family includes several phage methylases and a number of different restriction enzyme chromosomal site-specific modification systems. [DNA metabolism, DNA replication, recombination, and repair].	1.71406e-84
NZ_CP017960.1\|WP_071543019.1\|1577_3209_+\|type-IV-secretory-system-conjugative-DNA-transfer-family-protein	gnl\|CDD\|226036	COG3505, VirD4, Type IV secretory pathway, VirD4 components [Intracellular trafficking and secretion].	4.90227e-48
NZ_CP017960.1\|WP_080487867.1\|11802_11958_+\|AAA-family-ATPase	gnl\|CDD\|379050	pfam13175, AAA_15, AAA ATPase domain. This family of domains contain a P-loop motif that is characteristic of the AAA superfamily.	1.28147e-05
NZ_CP017960.1\|WP_080487863.1\|10868_11027_+\|AAA-family-ATPase	gnl\|CDD\|379050	pfam13175, AAA_15, AAA ATPase domain. This family of domains contain a P-loop motif that is characteristic of the AAA superfamily.	1.28628e-09
NZ_CP017960.1\|WP_071543022.1\|4791_5952_+\|relaxase/mobilization-nuclease-domain-containing-protein	gnl\|CDD\|367497	pfam03432, Relaxase, Relaxase/Mobilisation nuclease domain. Relaxases/mobilisation proteins are required for the horizontal transfer of genetic information contained on plasmids that occurs during bacterial conjugation. The relaxase, in conjunction with several auxiliary proteins, forms the relaxation complex or relaxosome. Relaxases nick duplex DNA in a specific manner by catalyzing trans-esterification.	4.56944e-55
NZ_CP017960.1\|WP_071543017.1\|782_1160_-\|type-II-toxin-antitoxin-system-YafQ-family-toxin	gnl\|CDD\|379750	pfam15738, YafQ_toxin, Bacterial toxin of type II toxin-antitoxin system, YafQ. YafQ is a family of bacterial toxin ribonucleases of type II toxin-antitoxin systems. The E.coli gene is expressed from the dinB operon. The cognate antitoxin for the E. coli protein is DinJ, in family RelB_antitoxin, pfam02604.	8.80182e-09

>NZ_CP017960.1|WP_071543022.1|4791_5952_+|relaxase/mobilization-nuclease-domain-containing-protein
MATTHIKRSTSASRLVNYAEKRAVKKDGLNLDIQYAKSEFKQVRDVYGNPGKTQAYASRIAFSPLEFNPQDPHDQQTVLAVAKEVYAQAYPNQQVALYEHADTDSLHVHAVIGAINLETGQKMHGNWHQYRDHLVRITDQVCQEHGLLVTQPDPNRHEKRTMAEIKLRAKHQPTWKDQIRQAVDHTMQNPLIRDFQAFQADLKQQAVKVWQRGKNLTYQLLGTNYKSRGTKLGLDYEKETIFNELARRQTRNEQPERSVNATTDKTQSDFERTAKLSGHPDSTASHGQNVVGSTTPADRADRSTGQPPVSDDLKQLRRQQQQLTGPIKTDLTKRLRSLSKADQSDQSRKSEHTQADPNQARPKQPAPHPTRRPSEPDHSRNDGPSR
>NZ_CP017960.1|WP_071543020.1|3618_3954_+|HigA-family-addiction-module-antidote-protein
MLHRENSIRQYHTSSAADLIKETMDFYQITQTDLAARLGVSQKNISDILKRKRFINELLALRIENVMGISSQLLLNLDANFKLHQAKENAKNSEPDHQSDKFLKRYDWVSA
>NZ_CP017960.1|WP_011668984.1|3281_3605_+|plasmid-maintenance-system-killer-protein
MEYVAENRKLAKILNDPRLLVKNFGRDRAKRIQSRLDEFDAADTLQQIPSDPPPRCHRLHNNLEGKFAVDVSKNFRIVFEGYDKSDQLSVEKSAIVTVQILKIEDYH
>NZ_CP017960.1|WP_071543019.1|1577_3209_+|type-IV-secretory-system-conjugative-DNA-transfer-family-protein
MIDLIVLVLLILLAIYAHKKHAASEKLITKPIRFFIFPVHWWLRNAIFKFTGSNLITGIIWFFAGIFIFLLFIPVYVINKTAGFIFAYYLAFGYFFCLFPQNTALAGDSDLGRAKYLSYSELKHGGLITNTGLVLGKKQHRLVAKPSDFEGNVAVFGGAGTGKTAGNLIPTLLTFQGNALVVDIKPELLKRTGHLHPNKEVLNFINPKQSYDPLATLQTYTDVTDLAKTLIPISSDIKEPYFRESAQNILASACWEFKGQKSFSEIAEFLTATPADAIIKQLSASSKSETRILINAVAGIKTEQLASVMNELRNTLVIFATDPVLKQLAGHSANSIQPQDIETNWIYLVLPESKLKVYQPYLALIVAQFTRYLTQRPEKSQPNLLLALDEFPRLGYLPAFADAISTLRSRNVSVMILLQSLAQLDQLYQETGRKIIMDNMHYVVVHNALDHTSQQYFSDRAGTKTAVAKSHSYGTGGSGGTIDALFGSSSTSYNQQSAPLIRPEEFATLKQPILYAYQLGITPVDKAYWFEDNHMKSMVELND
>NZ_CP017960.1|WP_071543018.1|1160_1445_-|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin
MARIEARIDGTIKSKAKDVLADHGLTISDFMRMTLTTVANEGLPKYYSIPNRQLKNSIQEVVDDLSGKEKLPEAHSPKELDQLLSSDDALESSK
>NZ_CP017960.1|WP_071543017.1|782_1160_-|type-II-toxin-antitoxin-system-YafQ-family-toxin
MTKAIKYTKTFKIQFKKRRQDPKWRSVFKSSLPQELDDQERSPWKFIIQCLIEDKTIPDYFYPHALEGLKDLKKQIKRQLNDANMTIIILELHFDGHNGDRLLVYVPTGKTVFLAGIGTHSELFG
>NZ_CP017960.1|WP_187337834.1|532_745_+|hypothetical-protein
MSKVGDLLGINYLGTHTMRKTGAYRVYTQSNYNIGLVMHLLNHSSEAMTLAYLGLDQASQETMLDQIDFG
>NZ_CP017960.1|WP_071543024.1|8109_8697_+|DUF536-domain-containing-protein
MGKTIRQLSEELQLSKQAINQRISSIKDFRSKHTHKVKNHLEIDEQGVKMLANFDKQKRQDQQVDRQERQVKNDKQDKKETNINDVLLKQLDVKDQQISKLQKSLDQQQQLQLATLAENRQLKGHIQKLNGLLESSNSTQKRQATKKNDNLSNGANSSNTMNKNDKQEKNRVVDTNEKQKRIHKNKVNNSWWHFW
>NZ_CP017960.1|WP_187337835.1|8986_9808_+|Dam-family-site-specific-DNA-(adenine-N6)-methyltransferase
MSPFIKWVGGKRQLLPELVKYLPHGFNKYYEPFVGGGALFLRITPKEAVINDYNEELVNVWKVVRDDLSNLLSLLKGHQDNDSKDYYLNVRSVDRDGRIINMTNTERAARFIYLNKAGYNGLWRVNSNGQNNVPYGSHKKLNLLSPSLENISNYLNNNNIKLLTGDFEKSVVDAKKDDFVYFDPPYIPVNQTSKFTNYTKNGFGLVQQQQLRDLAINLASRGVSVMLSNSDTSLVHNLYANKIFRIHHVKAMRYVNSNIAKRGKVGEVIITTY
>NZ_CP017960.1|WP_071543026.1|10206_10392_+|hypothetical-protein
MKFFFNFDANTIFIVEKKWQQGSGSVDEKIFGFVNKRRLYQNDFNQLSHEPKPTVEFSSII
>NZ_CP017960.1|WP_155118892.1|10414_10564_+|hypothetical-protein
MKNTMENNDLEKYPRKNEKQYQDYFDNLRIDGVKIFFDNYDYWWFGLYY
>NZ_CP017960.1|WP_080487863.1|10868_11027_+|AAA-family-ATPase
MRLAKFRIKNFRGYKDEKKIDFTDFTTFVGINDSGKSTIFEALDIFFWEFKD
>NZ_CP017960.1|WP_187337836.1|10962_11568_+|hypothetical-protein
MTLESQQFLKHLIFFFGNSKIEKSDRTVNSTDDVELTAYFSDLPREIKLETIPTTLKEEFLTLNDDNSDKDYLVLRQKYSGEGLKLSEFLVSTFPSDKSVQNIHTSKITALRKTFSSLIVDVDKRKSTEIRKVALKDAAKRSGLETTEISLNGKGLLKDIASVIHVNLPMYQLFKSDRSNTDADSEIQDPIKAIIKNSPFT
>NZ_CP017960.1|WP_080487867.1|11802_11958_+|AAA-family-ATPase
MFSDLKREENESNLKKKQNNEINIIYAFEEPETSQHPKFQTMLIDSFKTMS
>NZ_CP017960.1|WP_155118894.1|12075_12291_+|hypothetical-protein
MKQLSEKYIAQLGIVPNIKLYPDQLDCVVLVEGPTDVVFFQYIYDKWSSKTDSEKSKTVFISGGGASIVMY
>NZ_CP017960.1|WP_071543029.1|13313_13598_-|Abi-family-protein
MIQSIKIFIVITNTFQEPKSLNFSENKHVAVPLWVAIQFLTFGQLNMMLHLLKTEDLNKVIEQMNVRDKFTNTEFLNCMDVFNNLRNTCAHGRC
>NZ_CP017960.1|WP_155118895.1|13810_14200_-|hypothetical-protein
MLESLIGKIYYSLIFVIYFILKKVWLTGIKIWKSKTALINQLIKNRNLTDNDSILENFLTEANYFEAINGLESIFLKSSNRHQYFQKNYENKYDAKLFHILYDFDHELSEEILKIIIEMELKIKKFCCI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP017960_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017960_2

20874-20975

Orphan

Consensus_repeat	Method
GTCTATTTTTTAGACTTTCGCTCGTAGCAAGGGTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP017960_2

>merge|NZ_CP017960|2|20874-20975|CRISPRCasFinder
GTCTATTTTTTAGACTTTCGCTCGTAGCAAGGGTTTGCGGGGTGTCATCAACGGACTTTCGCGAAGGTCTATTTTTTAGACTTTCGCTCGTAGCAAGGGTTT

>NZ_CP017960|2|2|20874-20975|CRISPRCasFinder
GTCTATTTTTTAGACTTTCGCTCGTAGCAAGGGTTT	GCGGGGTGTCATCAACGGACTTTCGCGAAG
GTCTATTTTTTAGACTTTCGCTCGTAGCAAGGGTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017960.1\|WP_071543033.1\|24881_26663_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379050
NZ_CP017960.1\|WP_071543018.1\|15172_15457_-\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	unknown	unknown	gnl\|CDD\|225619
NZ_CP017960.1\|WP_071543020.1\|17637_17973_+\|HigA-family-addiction-module-antidote-protein	unknown	unknown	gnl\|CDD\|274228
NZ_CP017960.1\|WP_155118895.1\|13810_14200_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017960.1\|WP_071543024.1\|22128_22716_+\|DUF536-domain-containing-protein	unknown	unknown	unknown
NZ_CP017960.1\|WP_155118894.1\|12075_12291_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|173776
NZ_CP017960.1\|WP_011668984.1\|17300_17624_+\|plasmid-maintenance-system-killer-protein	unknown	unknown	gnl\|CDD\|282822
NZ_CP017960.1\|WP_071543031.1\|15722_16025_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017960.1\|WP_071543022.1\|18810_19971_+\|relaxase/mobilization-nuclease-domain-containing-protein	unknown	unknown	gnl\|CDD\|367497
NZ_CP017960.1\|WP_187337835.1\|23005_23827_+\|Dam-family-site-specific-DNA-(adenine-N6)-methyltransferase	unknown	unknown	gnl\|CDD\|273146
NZ_CP017960.1\|WP_187337833.1\|16993_17170_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017960.1\|WP_071543029.1\|13313_13598_-\|Abi-family-protein	unknown	unknown	gnl\|CDD\|377910
NZ_CP017960.1\|WP_071543032.1\|15987_16971_+\|type-IV-secretory-system-conjugative-DNA-transfer-family-protein	unknown	unknown	gnl\|CDD\|226036
NZ_CP017960.1\|WP_080487865.1\|23933_24578_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP017960.1\|WP_011668984.1\|17300_17624_+\|plasmid-maintenance-system-killer-protein	gnl\|CDD\|282822	pfam05015, HigB-like_toxin, RelE-like toxin of type II toxin-antitoxin system HigB. This family carries several different examples of type II bacterial toxins of toxin-antitoxin systems including many HigB-like ones. The fold is referred to as the RelE/YoeB/Txe/Yeeu fold suggesting all examples of these are present in this family. Several plasmids with proteic killer gene-systems have been reported. All of them encode a stable toxin and an unstable antidote. Upon loss of the plasmid, the less stable inhibitor is inactivated more rapidly than the toxin, allowing the toxin to be activated. The activation of these systems results in cell filamentation and cessation of viable cell production. It has been verified that both the stable killer and the unstable inhibitor of the systems are short polypeptides. This family corresponds to the toxin.	0.00588913
NZ_CP017960.1\|WP_071543033.1\|24881_26663_+\|AAA-family-ATPase	gnl\|CDD\|379050	pfam13175, AAA_15, AAA ATPase domain. This family of domains contain a P-loop motif that is characteristic of the AAA superfamily.	2.69622e-50
NZ_CP017960.1\|WP_071543022.1\|18810_19971_+\|relaxase/mobilization-nuclease-domain-containing-protein	gnl\|CDD\|367497	pfam03432, Relaxase, Relaxase/Mobilisation nuclease domain. Relaxases/mobilisation proteins are required for the horizontal transfer of genetic information contained on plasmids that occurs during bacterial conjugation. The relaxase, in conjunction with several auxiliary proteins, forms the relaxation complex or relaxosome. Relaxases nick duplex DNA in a specific manner by catalyzing trans-esterification.	4.56944e-55
NZ_CP017960.1\|WP_187337835.1\|23005_23827_+\|Dam-family-site-specific-DNA-(adenine-N6)-methyltransferase	gnl\|CDD\|273146	TIGR00571, DNA_adenine_methylase, DNA adenine methylase (dam). All proteins in this family for which functions are known are DNA-adenine methyltransferases. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). The DNA adenine methylase (dam) of E. coli and related species is instrumental in distinguishing the newly synthesized strand during DNA replication for methylation-directed mismatch repair. This family includes several phage methylases and a number of different restriction enzyme chromosomal site-specific modification systems. [DNA metabolism, DNA replication, recombination, and repair].	1.71406e-84
NZ_CP017960.1\|WP_071543018.1\|15172_15457_-\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	gnl\|CDD\|225619	COG3077, RelB, DNA-damage-inducible protein J [DNA replication, recombination, and repair].	8.19022e-09
NZ_CP017960.1\|WP_071543020.1\|17637_17973_+\|HigA-family-addiction-module-antidote-protein	gnl\|CDD\|274228	TIGR02607, Virulence-associated_protein_I, addiction module antidote protein, HigA family. Members of this family form a distinct clade within the larger family HTH_3 of helix-turn-helix proteins, described by pfam01381. Members of this clade are strictly bacterial and nearly always shorter than 110 amino acids. This family includes the characterized member HigA, without which the killer protein HigB cannot be cloned. The hig (host inhibition of growth) system is noted to be unusual in that killer protein is uncoded by the upstream member of the gene pair. [Regulatory functions, DNA interactions, Regulatory functions, Protein interactions, Mobile and extrachromosomal element functions, Other].	4.9958e-10
NZ_CP017960.1\|WP_071543029.1\|13313_13598_-\|Abi-family-protein	gnl\|CDD\|377910	pfam07751, Abi_2, Abi-like protein. This family, found in various bacterial species, contains sequences that are similar to the Abi group of proteins, which are involved in bacteriophage resistance mediated by abortive infection in Lactococcus species. The proteins are thought to have helix-turn-helix motifs, found in many DNA-binding proteins, allowing them to perform their function.	2.35596e-13
NZ_CP017960.1\|WP_071543032.1\|15987_16971_+\|type-IV-secretory-system-conjugative-DNA-transfer-family-protein	gnl\|CDD\|226036	COG3505, VirD4, Type IV secretory pathway, VirD4 components [Intracellular trafficking and secretion].	1.13794e-32
NZ_CP017960.1\|WP_155118894.1\|12075_12291_+\|hypothetical-protein	gnl\|CDD\|173776	cd01026, TOPRIM_OLD, TOPRIM_OLD: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in bacterial and archaeal nucleases of the OLD (overcome lysogenization defect) family. The bacteriophage P2 OLD protein, which has DNase as well as RNase activity, consists of an N-terminal ABC-type ATPase domain and a C-terminal Toprim domain; the nuclease activity of OLD is stimulated by ATP, though the ATPase activity is not DNA-dependent. Functional details on OLD are scant and further experimentation is required to define the relationship between the ATPase and Toprim nuclease domains. The TOPRIM domain has two conserved motifs, one of which centers at a conserved glutamate and the other one at two conserved aspartates (DxD). The conserved glutamate may act as a general acid in strand cleavage by nucleases. The DXD motif may co-ordinate Mg2+, a cofactor required for full catalytic function.	0.000882427

>NZ_CP017960.1|WP_071543022.1|18810_19971_+|relaxase/mobilization-nuclease-domain-containing-protein
MATTHIKRSTSASRLVNYAEKRAVKKDGLNLDIQYAKSEFKQVRDVYGNPGKTQAYASRIAFSPLEFNPQDPHDQQTVLAVAKEVYAQAYPNQQVALYEHADTDSLHVHAVIGAINLETGQKMHGNWHQYRDHLVRITDQVCQEHGLLVTQPDPNRHEKRTMAEIKLRAKHQPTWKDQIRQAVDHTMQNPLIRDFQAFQADLKQQAVKVWQRGKNLTYQLLGTNYKSRGTKLGLDYEKETIFNELARRQTRNEQPERSVNATTDKTQSDFERTAKLSGHPDSTASHGQNVVGSTTPADRADRSTGQPPVSDDLKQLRRQQQQLTGPIKTDLTKRLRSLSKADQSDQSRKSEHTQADPNQARPKQPAPHPTRRPSEPDHSRNDGPSR
>NZ_CP017960.1|WP_071543020.1|17637_17973_+|HigA-family-addiction-module-antidote-protein
MLHRENSIRQYHTSSAADLIKETMDFYQITQTDLAARLGVSQKNISDILKRKRFINELLALRIENVMGISSQLLLNLDANFKLHQAKENAKNSEPDHQSDKFLKRYDWVSA
>NZ_CP017960.1|WP_011668984.1|17300_17624_+|plasmid-maintenance-system-killer-protein
MEYVAENRKLAKILNDPRLLVKNFGRDRAKRIQSRLDEFDAADTLQQIPSDPPPRCHRLHNNLEGKFAVDVSKNFRIVFEGYDKSDQLSVEKSAIVTVQILKIEDYH
>NZ_CP017960.1|WP_187337833.1|16993_17170_+|hypothetical-protein
MAKSHSYGTGGSGGTIDALFGSSSTSYNQQSAPLIRPEEFATLKQPILYAYQLGITPG
>NZ_CP017960.1|WP_071543032.1|15987_16971_+|type-IV-secretory-system-conjugative-DNA-transfer-family-protein
MVLGKKQHRLVAKPSDFEGNVAVFGGAGTGKTAGNLIPTLLTFQGNALVVDIKPELLKRTGHLHPNKEVLNFINPKQSYDPLATLQTYTDVTDLAKTLIPISSDIKEPYFRESAQNILASACWEFKGQKSFSEIAEFLTATPADAIIKQLSASSKSETRILINAVAGIKTEQLASVMNELRNTLVIFATDPVLKQLAGHSANSIQPQDIETNWIYLVLPESKLKVYQPYLALIVAQFTRYLTQRPEKSQPNLLLALDEFPRLGYLPAFADAISTFAFSRNVSVMILLQSLAQLDQLYQETGRKIIMDNMHYVVVHNALDHTSQQYFF
>NZ_CP017960.1|WP_071543031.1|15722_16025_+|hypothetical-protein
MQFLNLPAATLSPVSFGSFAGIFIFLLFIPVYVINKTAGFIFAYYLAFGYFFCLFPQNTALAGDSDLGRAKYLSYSELKHGGLITNTGFGFRQKATSLSR
>NZ_CP017960.1|WP_071543018.1|15172_15457_-|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin
MARIEARIDGTIKSKAKDVLADHGLTISDFMRMTLTTVANEGLPKYYSIPNRQLKNSIQEVVDDLSGKEKLPEAHSPKELDQLLSSDDALESSK
>NZ_CP017960.1|WP_155118895.1|13810_14200_-|hypothetical-protein
MLESLIGKIYYSLIFVIYFILKKVWLTGIKIWKSKTALINQLIKNRNLTDNDSILENFLTEANYFEAINGLESIFLKSSNRHQYFQKNYENKYDAKLFHILYDFDHELSEEILKIIIEMELKIKKFCCI
>NZ_CP017960.1|WP_071543029.1|13313_13598_-|Abi-family-protein
MIQSIKIFIVITNTFQEPKSLNFSENKHVAVPLWVAIQFLTFGQLNMMLHLLKTEDLNKVIEQMNVRDKFTNTEFLNCMDVFNNLRNTCAHGRC
>NZ_CP017960.1|WP_155118894.1|12075_12291_+|hypothetical-protein
MKQLSEKYIAQLGIVPNIKLYPDQLDCVVLVEGPTDVVFFQYIYDKWSSKTDSEKSKTVFISGGGASIVMY
>NZ_CP017960.1|WP_071543024.1|22128_22716_+|DUF536-domain-containing-protein
MGKTIRQLSEELQLSKQAINQRISSIKDFRSKHTHKVKNHLEIDEQGVKMLANFDKQKRQDQQVDRQERQVKNDKQDKKETNINDVLLKQLDVKDQQISKLQKSLDQQQQLQLATLAENRQLKGHIQKLNGLLESSNSTQKRQATKKNDNLSNGANSSNTMNKNDKQEKNRVVDTNEKQKRIHKNKVNNSWWHFW
>NZ_CP017960.1|WP_187337835.1|23005_23827_+|Dam-family-site-specific-DNA-(adenine-N6)-methyltransferase
MSPFIKWVGGKRQLLPELVKYLPHGFNKYYEPFVGGGALFLRITPKEAVINDYNEELVNVWKVVRDDLSNLLSLLKGHQDNDSKDYYLNVRSVDRDGRIINMTNTERAARFIYLNKAGYNGLWRVNSNGQNNVPYGSHKKLNLLSPSLENISNYLNNNNIKLLTGDFEKSVVDAKKDDFVYFDPPYIPVNQTSKFTNYTKNGFGLVQQQQLRDLAINLASRGVSVMLSNSDTSLVHNLYANKIFRIHHVKAMRYVNSNIAKRGKVGEVIITTY
>NZ_CP017960.1|WP_080487865.1|23933_24578_+|hypothetical-protein
MKKGGKGGANTNRGGLAFESKTDLAARIKRDLNMTYELIEHKYKNSPLIKSTAKVYDIYSKKDQHLIGIITKQMQFYNILEEKYQVRNANHKKWKPDEVFFNFDANTIFIVEKKWQQGSGSVDEKIFGFVNKRRLYQNDFNQLSHEPKPTVEFSALFNSSWWIYGLKNTMENNDLEKYPRKNEKQYQDYFDNLRIDGVKIFFDNYDYWWFGLYY
>NZ_CP017960.1|WP_071543033.1|24881_26663_+|AAA-family-ATPase
MRLAKFRIKNFRGYKDEKIDFTDFTTFVGINDSGKSTIFEALDIFFGNSKIEKSDRTVNSTDDVELTAYFSDLPREIKLETIPTTLKEEFLTLNDDNSDKDYLVLRQKYSGEGLKLSEFLVSTFPSDESVQNIHTSKITALRKTFSSLIVDVDKRKSTEIRKVALKDAAKRSGLETTEISLNGKGLLKDIASVIHVNLPMYQLFKSDRSNTDADSEIQDPIKAIIKTALLHKDIQDKLVDISSDIEESVTNITNKTLGMLREMDNSLSNDLNADFKQPNWSSVFKFNLDTDSGIPLNKRGSGVRRLILLNFFRAEARRKLEQSEKEQNNEINIIYAFEEPETSQHPKFQTMLIDSFKTMSDLDHVQVCITTHSPAIAQIVPKAGIRLVKKEAGEANVLSGETAIREVIAQLGIVPNIKLYPDQLDCVVLVEGPTDVVFFQYIYDKWSSKTDSEKSKTVFISGGGASIVDVLNSKFINQLNLKKKVMIVDGDGAGSDDKQKADENNNLKTIQLNKSTIEFYLPYEDVQNALKESTQNPFIRTKDEWVVGNNECKLNKAQKRMLKDKEIYNHFNLENIPSSIKTELNKIVHDIDD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP017960_1	1.1\|6891\|30\|NZ_CP017960\|CRISPRCasFinder	6891-6920	30	NZ_CP014913	Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-1, complete sequence	22508-22537	0	1.0
NZ_CP017960_1	1.1\|6891\|30\|NZ_CP017960\|CRISPRCasFinder	6891-6920	30	NZ_CP017358	Lactobacillus plantarum strain TMW 1.25 plasmid pL125-4, complete sequence	4830-4859	0	1.0
NZ_CP017960_1	1.1\|6891\|30\|NZ_CP017960\|CRISPRCasFinder	6891-6920	30	NZ_CP017368	Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-5, complete sequence	5770-5799	0	1.0
NZ_CP017960_1	1.1\|6891\|30\|NZ_CP017960\|CRISPRCasFinder	6891-6920	30	NZ_CP017265	Lactobacillus paracasei strain FAM18149 plasmid pFAM18149.24, complete sequence	26504-26533	0	1.0
NZ_CP017960_1	1.1\|6891\|30\|NZ_CP017960\|CRISPRCasFinder	6891-6920	30	NZ_CP017960	Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence	6891-6920	0	1.0
NZ_CP017960_1	1.1\|6891\|30\|NZ_CP017960\|CRISPRCasFinder	6891-6920	30	NZ_CP017960	Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence	20910-20939	0	1.0
NZ_CP017960_1	1.1\|6891\|30\|NZ_CP017960\|CRISPRCasFinder	6891-6920	30	NZ_CP014934	Pediococcus claussenii strain TMW 2.53 plasmid pL253-1, complete sequence	5933-5962	0	1.0
NZ_CP017960_1	1.1\|6891\|30\|NZ_CP017960\|CRISPRCasFinder	6891-6920	30	NZ_CP014937	Pediococcus claussenii strain TMW 2.54 plasmid pL254-1, complete sequence	5934-5963	0	1.0
NZ_CP017960_1	1.1\|6891\|30\|NZ_CP017960\|CRISPRCasFinder	6891-6920	30	MK994179	Lactobacillus plantarum strain PC518 plasmid plp75TA, complete sequence	4885-4914	0	1.0
NZ_CP017960_2	2.1\|20910\|30\|NZ_CP017960\|CRISPRCasFinder	20910-20939	30	NZ_CP014913	Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-1, complete sequence	22508-22537	0	1.0
NZ_CP017960_2	2.1\|20910\|30\|NZ_CP017960\|CRISPRCasFinder	20910-20939	30	NZ_CP017358	Lactobacillus plantarum strain TMW 1.25 plasmid pL125-4, complete sequence	4830-4859	0	1.0
NZ_CP017960_2	2.1\|20910\|30\|NZ_CP017960\|CRISPRCasFinder	20910-20939	30	NZ_CP017368	Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-5, complete sequence	5770-5799	0	1.0
NZ_CP017960_2	2.1\|20910\|30\|NZ_CP017960\|CRISPRCasFinder	20910-20939	30	NZ_CP017265	Lactobacillus paracasei strain FAM18149 plasmid pFAM18149.24, complete sequence	26504-26533	0	1.0
NZ_CP017960_2	2.1\|20910\|30\|NZ_CP017960\|CRISPRCasFinder	20910-20939	30	NZ_CP017960	Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence	6891-6920	0	1.0
NZ_CP017960_2	2.1\|20910\|30\|NZ_CP017960\|CRISPRCasFinder	20910-20939	30	NZ_CP017960	Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence	20910-20939	0	1.0
NZ_CP017960_2	2.1\|20910\|30\|NZ_CP017960\|CRISPRCasFinder	20910-20939	30	NZ_CP014934	Pediococcus claussenii strain TMW 2.53 plasmid pL253-1, complete sequence	5933-5962	0	1.0
NZ_CP017960_2	2.1\|20910\|30\|NZ_CP017960\|CRISPRCasFinder	20910-20939	30	NZ_CP014937	Pediococcus claussenii strain TMW 2.54 plasmid pL254-1, complete sequence	5934-5963	0	1.0
NZ_CP017960_2	2.1\|20910\|30\|NZ_CP017960\|CRISPRCasFinder	20910-20939	30	MK994179	Lactobacillus plantarum strain PC518 plasmid plp75TA, complete sequence	4885-4914	0	1.0
NZ_CP017960_1	1.1\|6891\|30\|NZ_CP017960\|CRISPRCasFinder	6891-6920	30	NC_014386	Lactobacillus helveticus R0052 plasmid pIR52-1, complete sequence	1748-1777	1	0.967
NZ_CP017960_1	1.1\|6891\|30\|NZ_CP017960\|CRISPRCasFinder	6891-6920	30	NZ_CP019583	Lactobacillus helveticus strain LH5 plasmid pCBTLH5_2, complete sequence	4638-4667	1	0.967
NZ_CP017960_1	1.1\|6891\|30\|NZ_CP017960\|CRISPRCasFinder	6891-6920	30	NC_006529	Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence	4742-4771	1	0.967
NZ_CP017960_2	2.1\|20910\|30\|NZ_CP017960\|CRISPRCasFinder	20910-20939	30	NC_014386	Lactobacillus helveticus R0052 plasmid pIR52-1, complete sequence	1748-1777	1	0.967
NZ_CP017960_2	2.1\|20910\|30\|NZ_CP017960\|CRISPRCasFinder	20910-20939	30	NZ_CP019583	Lactobacillus helveticus strain LH5 plasmid pCBTLH5_2, complete sequence	4638-4667	1	0.967
NZ_CP017960_2	2.1\|20910\|30\|NZ_CP017960\|CRISPRCasFinder	20910-20939	30	NC_006529	Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence	4742-4771	1	0.967
NZ_CP017960_1	1.1\|6891\|30\|NZ_CP017960\|CRISPRCasFinder	6891-6920	30	NZ_CP019033	Lactobacillus fermentum strain SNUV175 plasmid pSNU175-4, complete sequence	21083-21112	2	0.933
NZ_CP017960_1	1.1\|6891\|30\|NZ_CP017960\|CRISPRCasFinder	6891-6920	30	NC_017468	Lactobacillus helveticus H10 plasmid pH10, complete sequence	15844-15873	2	0.933
NZ_CP017960_1	1.1\|6891\|30\|NZ_CP017960\|CRISPRCasFinder	6891-6920	30	NZ_CP033891	Lactobacillus plantarum strain LMT1-48 plasmid p_3, complete sequence	3330-3359	2	0.933
NZ_CP017960_1	1.1\|6891\|30\|NZ_CP017960\|CRISPRCasFinder	6891-6920	30	NZ_CP011537	Lactobacillus fermentum 3872 plasmid pLF3872, complete sequence	7181-7210	2	0.933
NZ_CP017960_2	2.1\|20910\|30\|NZ_CP017960\|CRISPRCasFinder	20910-20939	30	NZ_CP019033	Lactobacillus fermentum strain SNUV175 plasmid pSNU175-4, complete sequence	21083-21112	2	0.933
NZ_CP017960_2	2.1\|20910\|30\|NZ_CP017960\|CRISPRCasFinder	20910-20939	30	NC_017468	Lactobacillus helveticus H10 plasmid pH10, complete sequence	15844-15873	2	0.933
NZ_CP017960_2	2.1\|20910\|30\|NZ_CP017960\|CRISPRCasFinder	20910-20939	30	NZ_CP033891	Lactobacillus plantarum strain LMT1-48 plasmid p_3, complete sequence	3330-3359	2	0.933
NZ_CP017960_2	2.1\|20910\|30\|NZ_CP017960\|CRISPRCasFinder	20910-20939	30	NZ_CP011537	Lactobacillus fermentum 3872 plasmid pLF3872, complete sequence	7181-7210	2	0.933
NZ_CP017960_1	1.1\|6891\|30\|NZ_CP017960\|CRISPRCasFinder	6891-6920	30	NC_017017	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-6, complete sequence	5387-5416	3	0.9
NZ_CP017960_1	1.1\|6891\|30\|NZ_CP017960\|CRISPRCasFinder	6891-6920	30	NZ_CP014928	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence	6824-6853	3	0.9
NZ_CP017960_1	1.1\|6891\|30\|NZ_CP017960\|CRISPRCasFinder	6891-6920	30	NZ_CP014920	Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-5, complete sequence	12632-12661	3	0.9
NZ_CP017960_1	1.1\|6891\|30\|NZ_CP017960\|CRISPRCasFinder	6891-6920	30	NZ_CP047125	Lactobacillus hilgardii strain FLUB plasmid unnamed4	5237-5266	3	0.9
NZ_CP017960_1	1.1\|6891\|30\|NZ_CP017960\|CRISPRCasFinder	6891-6920	30	NZ_CP031200	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_B, complete sequence	39624-39653	3	0.9
NZ_CP017960_2	2.1\|20910\|30\|NZ_CP017960\|CRISPRCasFinder	20910-20939	30	NC_017017	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-6, complete sequence	5387-5416	3	0.9
NZ_CP017960_2	2.1\|20910\|30\|NZ_CP017960\|CRISPRCasFinder	20910-20939	30	NZ_CP014928	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence	6824-6853	3	0.9
NZ_CP017960_2	2.1\|20910\|30\|NZ_CP017960\|CRISPRCasFinder	20910-20939	30	NZ_CP014920	Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-5, complete sequence	12632-12661	3	0.9
NZ_CP017960_2	2.1\|20910\|30\|NZ_CP017960\|CRISPRCasFinder	20910-20939	30	NZ_CP047125	Lactobacillus hilgardii strain FLUB plasmid unnamed4	5237-5266	3	0.9
NZ_CP017960_2	2.1\|20910\|30\|NZ_CP017960\|CRISPRCasFinder	20910-20939	30	NZ_CP031200	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_B, complete sequence	39624-39653	3	0.9
NZ_CP017960_1	1.1\|6891\|30\|NZ_CP017960\|CRISPRCasFinder	6891-6920	30	NC_008498	Lactobacillus brevis ATCC 367 plasmid 1, complete sequence	8762-8791	4	0.867
NZ_CP017960_2	2.1\|20910\|30\|NZ_CP017960\|CRISPRCasFinder	20910-20939	30	NC_008498	Lactobacillus brevis ATCC 367 plasmid 1, complete sequence	8762-8791	4	0.867

1. spacer 1.1|6891|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP014913 (Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

2. spacer 1.1|6891|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP017358 (Lactobacillus plantarum strain TMW 1.25 plasmid pL125-4, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

3. spacer 1.1|6891|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP017368 (Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-5, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

4. spacer 1.1|6891|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP017265 (Lactobacillus paracasei strain FAM18149 plasmid pFAM18149.24, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

5. spacer 1.1|6891|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP017960 (Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

6. spacer 1.1|6891|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP017960 (Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

7. spacer 1.1|6891|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP014934 (Pediococcus claussenii strain TMW 2.53 plasmid pL253-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

8. spacer 1.1|6891|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP014937 (Pediococcus claussenii strain TMW 2.54 plasmid pL254-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

9. spacer 1.1|6891|30|NZ_CP017960|CRISPRCasFinder matches to MK994179 (Lactobacillus plantarum strain PC518 plasmid plp75TA, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

10. spacer 2.1|20910|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP014913 (Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

11. spacer 2.1|20910|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP017358 (Lactobacillus plantarum strain TMW 1.25 plasmid pL125-4, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

12. spacer 2.1|20910|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP017368 (Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-5, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

13. spacer 2.1|20910|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP017265 (Lactobacillus paracasei strain FAM18149 plasmid pFAM18149.24, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

14. spacer 2.1|20910|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP017960 (Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

15. spacer 2.1|20910|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP017960 (Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

16. spacer 2.1|20910|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP014934 (Pediococcus claussenii strain TMW 2.53 plasmid pL253-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

17. spacer 2.1|20910|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP014937 (Pediococcus claussenii strain TMW 2.54 plasmid pL254-1, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

18. spacer 2.1|20910|30|NZ_CP017960|CRISPRCasFinder matches to MK994179 (Lactobacillus plantarum strain PC518 plasmid plp75TA, complete sequence) position: , mismatch: 0, identity: 1.0

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
******************************

19. spacer 1.1|6891|30|NZ_CP017960|CRISPRCasFinder matches to NC_014386 (Lactobacillus helveticus R0052 plasmid pIR52-1, complete sequence) position: , mismatch: 1, identity: 0.967

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcgggttgtcatcaacggactttcgcgaag	Protospacer
***** ************************

20. spacer 1.1|6891|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP019583 (Lactobacillus helveticus strain LH5 plasmid pCBTLH5_2, complete sequence) position: , mismatch: 1, identity: 0.967

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcgggttgtcatcaacggactttcgcgaag	Protospacer
***** ************************

21. spacer 1.1|6891|30|NZ_CP017960|CRISPRCasFinder matches to NC_006529 (Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence) position: , mismatch: 1, identity: 0.967

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacggactttcgcgaag	Protospacer
**********.*******************

22. spacer 2.1|20910|30|NZ_CP017960|CRISPRCasFinder matches to NC_014386 (Lactobacillus helveticus R0052 plasmid pIR52-1, complete sequence) position: , mismatch: 1, identity: 0.967

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcgggttgtcatcaacggactttcgcgaag	Protospacer
***** ************************

23. spacer 2.1|20910|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP019583 (Lactobacillus helveticus strain LH5 plasmid pCBTLH5_2, complete sequence) position: , mismatch: 1, identity: 0.967

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcgggttgtcatcaacggactttcgcgaag	Protospacer
***** ************************

24. spacer 2.1|20910|30|NZ_CP017960|CRISPRCasFinder matches to NC_006529 (Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence) position: , mismatch: 1, identity: 0.967

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacggactttcgcgaag	Protospacer
**********.*******************

25. spacer 1.1|6891|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP019033 (Lactobacillus fermentum strain SNUV175 plasmid pSNU175-4, complete sequence) position: , mismatch: 2, identity: 0.933

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggagtgtcgtcaacggactttcgcgaag	Protospacer
****.*****.*******************

26. spacer 1.1|6891|30|NZ_CP017960|CRISPRCasFinder matches to NC_017468 (Lactobacillus helveticus H10 plasmid pH10, complete sequence) position: , mismatch: 2, identity: 0.933

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaag	Protospacer
**********.******.************

27. spacer 1.1|6891|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP033891 (Lactobacillus plantarum strain LMT1-48 plasmid p_3, complete sequence) position: , mismatch: 2, identity: 0.933

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaag	Protospacer
**********.******.************

28. spacer 1.1|6891|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP011537 (Lactobacillus fermentum 3872 plasmid pLF3872, complete sequence) position: , mismatch: 2, identity: 0.933

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggagtgtcgtcaacggactttcgcgaag	Protospacer
****.*****.*******************

29. spacer 2.1|20910|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP019033 (Lactobacillus fermentum strain SNUV175 plasmid pSNU175-4, complete sequence) position: , mismatch: 2, identity: 0.933

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggagtgtcgtcaacggactttcgcgaag	Protospacer
****.*****.*******************

30. spacer 2.1|20910|30|NZ_CP017960|CRISPRCasFinder matches to NC_017468 (Lactobacillus helveticus H10 plasmid pH10, complete sequence) position: , mismatch: 2, identity: 0.933

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaag	Protospacer
**********.******.************

31. spacer 2.1|20910|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP033891 (Lactobacillus plantarum strain LMT1-48 plasmid p_3, complete sequence) position: , mismatch: 2, identity: 0.933

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaag	Protospacer
**********.******.************

32. spacer 2.1|20910|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP011537 (Lactobacillus fermentum 3872 plasmid pLF3872, complete sequence) position: , mismatch: 2, identity: 0.933

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggagtgtcgtcaacggactttcgcgaag	Protospacer
****.*****.*******************

33. spacer 1.1|6891|30|NZ_CP017960|CRISPRCasFinder matches to NC_017017 (Pediococcus claussenii ATCC BAA-344 plasmid pPECL-6, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaac	Protospacer
**********.******.***********

34. spacer 1.1|6891|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP014928 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaac	Protospacer
**********.******.***********

35. spacer 1.1|6891|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP014920 (Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-5, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaat	Protospacer
**********.******.***********

36. spacer 1.1|6891|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP047125 (Lactobacillus hilgardii strain FLUB plasmid unnamed4) position: , mismatch: 3, identity: 0.9

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaac	Protospacer
**********.******.***********

37. spacer 1.1|6891|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP031200 (Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_B, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaat	Protospacer
**********.******.***********

38. spacer 2.1|20910|30|NZ_CP017960|CRISPRCasFinder matches to NC_017017 (Pediococcus claussenii ATCC BAA-344 plasmid pPECL-6, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaac	Protospacer
**********.******.***********

39. spacer 2.1|20910|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP014928 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaac	Protospacer
**********.******.***********

40. spacer 2.1|20910|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP014920 (Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-5, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaat	Protospacer
**********.******.***********

41. spacer 2.1|20910|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP047125 (Lactobacillus hilgardii strain FLUB plasmid unnamed4) position: , mismatch: 3, identity: 0.9

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaac	Protospacer
**********.******.***********

42. spacer 2.1|20910|30|NZ_CP017960|CRISPRCasFinder matches to NZ_CP031200 (Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_B, complete sequence) position: , mismatch: 3, identity: 0.9

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaat	Protospacer
**********.******.***********

43. spacer 1.1|6891|30|NZ_CP017960|CRISPRCasFinder matches to NC_008498 (Lactobacillus brevis ATCC 367 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.867

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gtggggtgtcgtcaacgaactttcgcgaac	Protospacer
*.********.******.***********

44. spacer 2.1|20910|30|NZ_CP017960|CRISPRCasFinder matches to NC_008498 (Lactobacillus brevis ATCC 367 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.867

gcggggtgtcatcaacggactttcgcgaag	CRISPR spacer
gtggggtgtcgtcaacgaactttcgcgaac	Protospacer
*.********.******.***********

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP017955

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

484 : 68671

uncultured_Caudovirales_phage(11.11%)

transposase,holin,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006293514.1\|484_589_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_071542869.1\|988_1231_-	hypothetical protein	NA	NA	NA	NA
WP_071542870.1\|1304_1940_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_071542871.1\|1941_4131_-	hypothetical protein	NA	NA	NA	NA
WP_062689804.1\|4102_4570_-	hypothetical protein	NA	NA	NA	NA
WP_016526645.1\|4587_5088_-	hypothetical protein	NA	NA	NA	NA
WP_080487850.1\|5089_5383_-	hypothetical protein	NA	NA	NA	NA
WP_080487844.1\|5694_6603_-	hypothetical protein	NA	NA	NA	NA
WP_071542874.1\|6621_7047_-	thioredoxin fold domain-containing protein	NA	NA	NA	NA
WP_016526641.1\|7043_7343_-	hypothetical protein	NA	NA	NA	NA
WP_016526640.1\|7339_7558_-	hypothetical protein	NA	NA	NA	NA
WP_080487851.1\|7559_7772_-	hypothetical protein	NA	NA	NA	NA
WP_071542876.1\|7771_8728_-	hypothetical protein	A0A2H4JAH5	uncultured_Caudovirales_phage	5.7e-35	48.2
WP_071542877.1\|9544_10174_-	hypothetical protein	NA	NA	NA	NA
WP_071542878.1\|10186_11347_-	CHAP domain-containing protein	A0A0A0RSI6	Bacillus_phage	7.6e-10	35.5
WP_071542879.1\|11347_11554_-	hypothetical protein	NA	NA	NA	NA
WP_071542880.1\|11556_13509_-	hypothetical protein	NA	NA	NA	NA
WP_071542881.1\|13524_14184_-	hypothetical protein	NA	NA	NA	NA
WP_071542882.1\|14155_14539_-	hypothetical protein	NA	NA	NA	NA
WP_071542883.1\|14802_17364_-	hypothetical protein	NA	NA	NA	NA
WP_071542884.1\|17683_19216_-	primase C-terminal domain-containing protein	NA	NA	NA	NA
WP_016526629.1\|19994_20768_+	ParA family protein	F0PIG8	Enterococcus_phage	4.3e-33	36.6
WP_016526628.1\|20770_20995_+	hypothetical protein	NA	NA	NA	NA
WP_016526627.1\|21169_21481_-	hypothetical protein	NA	NA	NA	NA
WP_071542885.1\|21594_22896_+	Y-family DNA polymerase	M1Q231	Streptococcus_phage	9.9e-83	40.0
WP_071542886.1\|22888_23209_+	acetyl-CoA carboxylase	NA	NA	NA	NA
WP_071542887.1\|23201_23585_+	hypothetical protein	NA	NA	NA	NA
WP_187337826.1\|24067_24460_-	hypothetical protein	NA	NA	NA	NA
WP_155118879.1\|24410_24686_-	hypothetical protein	NA	NA	NA	NA
WP_071542890.1\|25074_25446_-	hypothetical protein	NA	NA	NA	NA
WP_071542891.1\|25420_25885_-	hypothetical protein	NA	NA	NA	NA
WP_155118880.1\|25885_26059_-	hypothetical protein	NA	NA	NA	NA
WP_080487845.1\|29131_29416_-	BRCT domain-containing protein	NA	NA	NA	NA
WP_071542894.1\|29530_29866_+	hypothetical protein	NA	NA	NA	NA
WP_071542895.1\|31119_32511_-	MATE family efflux transporter	NA	NA	NA	NA
WP_071542896.1\|35734_36760_-	alcohol dehydrogenase catalytic domain-containing protein	NA	NA	NA	NA
WP_071542897.1\|36761_37463_-	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_071542898.1\|37523_38444_-\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	9.2e-51	38.2
WP_071542899.1\|39013_39787_-	tyrosine protein phosphatase	NA	NA	NA	NA
WP_071542900.1\|39773_40502_-	CpsD/CapB family tyrosine-protein kinase	NA	NA	NA	NA
WP_071542901.1\|40513_41284_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_080487846.1\|42116_42419_-	VanZ family protein	NA	NA	NA	NA
WP_071542903.1\|42900_44076_-\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	7.0e-27	29.2
WP_071542904.1\|44312_45359_-	glycosyltransferase family 2 protein	A0A0F7L2F7	uncultured_marine_virus	3.0e-05	29.6
WP_155118882.1\|45351_46473_-	hypothetical protein	NA	NA	NA	NA
WP_071542906.1\|46538_47258_-	glycosyltransferase	NA	NA	NA	NA
WP_071542908.1\|47632_48127_-	glycosyl transferase	NA	NA	NA	NA
WP_071542909.1\|48126_48576_-	UDP-N-acetylglucosamine--LPS N-acetylglucosamine transferase	NA	NA	NA	NA
WP_065201559.1\|52006_52645_+	sugar transferase	NA	NA	NA	NA
WP_155118883.1\|53248_54036_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_071542913.1\|54973_56380_-	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_071542914.1\|56392_57226_-	LicD family protein	A0A1V0SD50	Indivirus	9.4e-10	34.1
WP_071542915.1\|57313_58147_-	hypothetical protein	NA	NA	NA	NA
WP_187337825.1\|59525_60077_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_071542918.1\|60178_60475_-	hypothetical protein	NA	NA	NA	NA
WP_071542919.1\|60550_63490_-	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_071542920.1\|63518_64298_-	class A sortase	NA	NA	NA	NA
WP_071542921.1\|64307_66413_-	hypothetical protein	NA	NA	NA	NA
WP_071542922.1\|66506_66821_-	hypothetical protein	NA	NA	NA	NA
WP_071542923.1\|66886_68671_-\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	8.8e-82	33.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP017954

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP017954_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017954_1

2151847-2152272

Orphan

Consensus_repeat	Method
TCTTNTNNGACTTNNNNT	CRT

11 spacers

The CRISPR arrays of NZ_CP017954_1

>merge|NZ_CP017954|1|2151847-2152272|CRT
TCTTACTGGATTTACCATGCTTCTTGGAAGATTTCTTCTTATTGGACTTGCCGTGCTTCTTGGAAGATTTCTTCTTGTGCGACTTGCCATGTTTCTTGGAAGACTTCTTCTTACTGGACTTGCCATGTTTCTTGGAAGACTTTTTCTTATTGGACTTGCCGTGCTTCTTAGAAGACTTCTTCTTGTGCGACTTGCCGTGTTTCTTGGAAGACTTTTTCTTATTGGACTTGCCGTGCTTCTTCGAAGATTTTTTCTTGTGCGACTTGCCATGCTTCTTAGAAGACTTCTTCTTGTGCGGCTTCTTATGTTTCCTGGCCGCTTTCTTCTTGTGCGACTTCTTATGTTTCTTGGCCGCTTTCTTCTTGTGTGACTTCTTGTGCGACTTCTTATGTTTCTTAGCGGCCTTCTTCTTATGCGCCTTTTTAT

>NZ_CP017954|1|1|2151847-2152272|CRT
TCTTACTGGATTTACCAT	GCTTCTTGGAAGATTTCT
TCTTATTGGACTTGCCGT	GCTTCTTGGAAGATTTCT
TCTTGTGCGACTTGCCAT	GTTTCTTGGAAGACTTCT
TCTTACTGGACTTGCCAT	GTTTCTTGGAAGACTTTT
TCTTATTGGACTTGCCGT	GCTTCTTAGAAGACTTCT
TCTTGTGCGACTTGCCGT	GTTTCTTGGAAGACTTTT
TCTTATTGGACTTGCCGT	GCTTCTTCGAAGATTTTT
TCTTGTGCGACTTGCCAT	GCTTCTTAGAAGACTTCT
TCTTGTGCGGCTTCTTAT	GTTTCCTGGCCGCTTTCT
TCTTGTGCGACTTCTTAT	GTTTCTTGGCCGCTTTCTTCTTGTGTGACT
TCTTGTGCGACTTCTTAT	GTTTCTTAGCGGCCTTCT
TCTTATGCGCCTTTTTAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017954.1\|WP_003641941.1\|2161063_2162035_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224050
NZ_CP017954.1\|WP_003646444.1\|2159654_2160986_-\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224169
NZ_CP017954.1\|WP_003646442.1\|2163799_2164246_+\|ribonuclease-H	unknown	unknown	gnl\|CDD\|178927
NZ_CP017954.1\|WP_003646448.1\|2150474_2150708_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379738
NZ_CP017954.1\|WP_003643768.1\|2165135_2166047_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|180448
NZ_CP017954.1\|WP_003646441.1\|2166183_2167104_+\|ribonucleoside-hydrolase-RihC	unknown	unknown	gnl\|CDD\|182713
NZ_CP017954.1\|WP_016526893.1\|2148756_2148930_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017954.1\|WP_003643774.1\|2155827_2157657_-\|type-1-glycerol-3-phosphate-oxidase	unknown	unknown	gnl\|CDD\|380303
NZ_CP017954.1\|WP_108725669.1\|2149977_2150094_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017954.1\|WP_016526894.1\|2146345_2147521_-\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151
NZ_CP017954.1\|WP_003646449.1\|2148936_2149854_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017954.1\|WP_003643773.1\|2157671_2159189_-\|glycerol-kinase-GlpK	unknown	unknown	gnl\|CDD\|234594
NZ_CP017954.1\|WP_003646443.1\|2162035_2163562_-\|ABC-transporter-permease/substrate-binding-protein	unknown	unknown	gnl\|CDD\|270328
NZ_CP017954.1\|WP_016526891.1\|2152547_2154896_-\|MucBP-domain-containing-protein	unknown	unknown	gnl\|CDD\|377660
NZ_CP017954.1\|WP_016526896.1\|2144717_2145461_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|381088
NZ_CP017954.1\|WP_003646470.1\|2143643_2144417_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP017954.1\|WP_003643811.1\|2143386_2143545_+\|two-peptide-bacteriocin-plantaricin-EF-subunit-PlnF	unknown	unknown	unknown
NZ_CP017954.1\|WP_003646450.1\|2147668_2148211_-\|ankyrin-repeat-domain-containing-protein	unknown	unknown	gnl\|CDD\|293786
NZ_CP017954.1\|WP_003641945.1\|2155090_2155813_-\|aquaporin-family-protein	unknown	unknown	gnl\|CDD\|223653
NZ_CP017954.1\|WP_003646471.1\|2143197_2143362_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP017954.1\|WP_003641941.1\|2161063_2162035_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224050	COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism].	1.46616e-132
NZ_CP017954.1\|WP_003646448.1\|2150474_2150708_-\|hypothetical-protein	gnl\|CDD\|379738	pfam15603, Imm74, Immunity protein 74. A predicted immunity protein with an alpha+beta fold. Proteins containing this domain are present in bacterial polymorphic toxin systems as an immediate gene neighbor of the toxin gene, which usually contains toxin domains of the Tox-ARC family. This domain is also found in heterogeneous poly-immunity loci.	2.43472e-10
NZ_CP017954.1\|WP_003643768.1\|2165135_2166047_-\|oxidoreductase	gnl\|CDD\|180448	PRK06182, PRK06182, short chain dehydrogenase; Validated.	4.43747e-163
NZ_CP017954.1\|WP_003646441.1\|2166183_2167104_+\|ribonucleoside-hydrolase-RihC	gnl\|CDD\|182713	PRK10768, PRK10768, ribonucleoside hydrolase RihC; Provisional.	0
NZ_CP017954.1\|WP_003646450.1\|2147668_2148211_-\|ankyrin-repeat-domain-containing-protein	gnl\|CDD\|293786	sd00045, ANK, ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.	6.04348e-09
NZ_CP017954.1\|WP_003646444.1\|2159654_2160986_-\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224169	COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion].	9.71858e-123
NZ_CP017954.1\|WP_016526894.1\|2146345_2147521_-\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	6.12313e-110
NZ_CP017954.1\|WP_003646442.1\|2163799_2164246_+\|ribonuclease-H	gnl\|CDD\|178927	PRK00203, rnhA, ribonuclease H; Reviewed.	0.00017599
NZ_CP017954.1\|WP_003643773.1\|2157671_2159189_-\|glycerol-kinase-GlpK	gnl\|CDD\|234594	PRK00047, glpK, glycerol kinase GlpK.	0
NZ_CP017954.1\|WP_003646443.1\|2162035_2163562_-\|ABC-transporter-permease/substrate-binding-protein	gnl\|CDD\|270328	cd13610, PBP2_ChoS, Substrate-binding domain ChoS of an osmoregulated ABC-type transporter and related proteins; type 2 periplasmic-binding protein fold. Osmoprotectant binding lipoprotein ChoS of Lactococcus lactis is predicted to be involved in uptake of compatible solutes such as choline and glycine betaine, but the relative substrate preference is not known. To counteract the efflux of water, microorganisms accumulate the compatible solutes for a sustained adjustment to high osmolarity surroundings. ChoS belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	8.08905e-155
NZ_CP017954.1\|WP_016526891.1\|2152547_2154896_-\|MucBP-domain-containing-protein	gnl\|CDD\|377660	pfam06458, MucBP, MucBP domain. The MucBP (MUCin-Binding Protein) domain is found in a wide variety of bacterial proteins, in several repeats. The domain is found in bacterial peptidoglycan bound proteins and is often found in conjunction with pfam00746 and pfam00560.	6.56753e-10
NZ_CP017954.1\|WP_016526896.1\|2144717_2145461_-\|response-regulator-transcription-factor	gnl\|CDD\|381088	cd17533, REC_LytTR_AgrA-like, phosphoacceptor receiver (REC) domain of LytTR/AlgR family response regulators similar to AgrA. Members of the LytTR/AlgR family of response regulators contain a REC domain and a unique LytTR DNA-binding output domain that lacks the helix-turn-helix motif and consists mostly of beta-strands. Transcriptional regulators with the LytTR-type output domains are involved in biosynthesis of extracellular polysaccharides, fimbriation, expression of exoproteins, including toxins, and quorum sensing. Included in this AgrA-like group of LytTR/AlgR family response regulators are Staphylococcus aureus accessory gene regulator protein A (AgrA) and Streptococcus pneumoniae response regulator ComE, which are members of two-component regulatory systems. AgrA is a global regulator that controls the synthesis of virulence factors and other exoproteins. ComE is part of the ComD-ComE system that is part of a quorum-sensing signaling pathway that controls the development of competence, a physiological state required for genetic transformation. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	9.44046e-41
NZ_CP017954.1\|WP_003646470.1\|2143643_2144417_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	8.33506e-10
NZ_CP017954.1\|WP_003643774.1\|2155827_2157657_-\|type-1-glycerol-3-phosphate-oxidase	gnl\|CDD\|380303	NF033461, glycerol3P_ox_1, type 1 glycerol-3-phosphate oxidase. Glycerol-3-phosphate oxidase, also called alpha-glycerophosphate oxidase (GlpO), is an FAD-dependent enzyme related to the glycerol-3-phosphate dehydrogenase GlpD. Notably, GlpO releases hydrogen peroxide, which can contribute to virulence.	0
NZ_CP017954.1\|WP_003641945.1\|2155090_2155813_-\|aquaporin-family-protein	gnl\|CDD\|223653	COG0580, GlpF, Glycerol uptake facilitator and related permeases (Major Intrinsic Protein Family) [Carbohydrate transport and metabolism].	7.59237e-82

>NZ_CP017954.1|WP_003646448.1|2150474_2150708_-|hypothetical-protein
MKITGSSSHVKFDLENEYAVKAEGEMLVGGQFVVFKDSMKNWEPPHEDEKLSEAEVQEIIQQVKQNTNENTVQISFE
>NZ_CP017954.1|WP_108725669.1|2149977_2150094_-|hypothetical-protein
MNQGIISCLTDLVRYNDIYTMITGKDAATGYNLVTGTR
>NZ_CP017954.1|WP_003646449.1|2148936_2149854_-|hypothetical-protein
MTKRLSEQESYFSMSEFLESYYWASRDDDLGSLLGSVTLWSDDGELFDQAIAEDWHAFFSDVSNENHTVFESFQAVKQFVNEYLPDIAATTPVSGSLTYNIRIICEMTESQRNQEPVWQNWVAAVNWITNPNVVPVNESPFLKTGQSLPNPKEKGFRQNQFPIAKVLPAPRPEIPMGPSLEKVDLTQSYYAFVKFLQHYYQVSDDSELGNFLQQNRAISENNEEYRYWKGKFSRCSGNKKLLDILKAFLMVRDYFEIEFPDNALHTHPVRKLSCNLWKAAYLPHSQRIQTEVWQNWLTAVHQVIE
>NZ_CP017954.1|WP_016526893.1|2148756_2148930_-|hypothetical-protein
MSFDNQLSSQFKDQEDSYNAIILLYDYSYDKEQVVRKIATGENYRINYIGTVIYEDE
>NZ_CP017954.1|WP_003646450.1|2147668_2148211_-|ankyrin-repeat-domain-containing-protein
MKILNVFDAVRDGTFQDFKNFYEGNINVISGNLDLNLLCMAVTNDKNPEEKLQIIKFLFAEGIDVNYATQKEKRNALHLFYFCVLRPTIEYEMEITNLFIKHGMNVNATDKYNAIPLKYAITINNLPTSDNKEMYQLLLNKGSDYNLKDGFGKSCLDYAKEYSWRNDFLDIVKEYENSKN
>NZ_CP017954.1|WP_016526894.1|2146345_2147521_-|IS256-family-transposase
MNELTTEIIAALAQKQDLDEVFRHHLEIAINQLLQTELAEFLGYERYSYAGINTGNNRNGSYERSFDTKYGQLNLTIPRDRNGRFENHTLPAYGRHSDNLETTVIQLYTKGITTAEIAELIEKMYGAHYSKATVSNMTKAVNEQVQAFQQRRLASQYAAIFLDATYLPLKRDTVQKEAVHIAIGIRPDGTKEVLNYQVAPTESTGIWTELLGTLIKQGVKDVLLFVADGLVGLDEGLNRHFPKAKRQRCLVHVGRNLMNKVRVKDRKAVISDFKQVHRAANREAAELKLNEFANNWHQTYPKLIKDLLKMPNLLTFMDFPPAIRQSLYSTNLIENFNKHLKRTTHHKEQFPTEDSLDRFLVSQFNVYNEKSLKRIHRGFKGLQGTLEASFI
>NZ_CP017954.1|WP_016526896.1|2144717_2145461_-|response-regulator-transcription-factor
MFPIYLYEDNAEQRDNYCKTVNNTMMINEFAMELRVATDDQKIILADLNQQQDGLFFLDMEIGEDKQTGLELASRIRATIPLAKIVFITTHDELSFVTLERRIAPLDYILKDQSADLITQRIIKDINVVQNELKKTNSQRKDVFNYKLGTRYFSLALDDVILLSTSKLRPGSVQLHAINKVAEFPGNLNALEEKYPQFFRCDKSSLVNLNHLRSFDYKEKELLLDGEIRCKASFRKSRELNKLLRDN
>NZ_CP017954.1|WP_003646470.1|2143643_2144417_+|CPBP-family-intramembrane-metalloprotease
MPLIKVIITAIYYLIVLFLMNPLTDIMGIKDGPFQFILTESIILIAIIILNRRYVKQPIHWLPVNIMSILKKNSLPLSLAIIFLLIFFRNHMYQFLISLLLSLIVAITEEYAFRGMIFRTLLALNLKKFATLQATIASMMTASLIFAAMHLVNLLSQPVWSVLCQVLYVIGLGILLAAIYLKTGSLLAAISVHWLIDFSSFYSQGIDPTQSPINGPMEALLKGLFLNILFIGIATFILSSKHWKLLSILNIEDKIDE
>NZ_CP017954.1|WP_003643811.1|2143386_2143545_+|two-peptide-bacteriocin-plantaricin-EF-subunit-PlnF
MKKFLVLRDRELNAISGGVFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG
>NZ_CP017954.1|WP_003646471.1|2143197_2143362_+|hypothetical-protein
MLQFEKLQYSRLPQKSLPKYLVVLIGAVITLVKVFDIDEIGSVAGIRGILKSIR
>NZ_CP017954.1|WP_016526891.1|2152547_2154896_-|MucBP-domain-containing-protein
MTDSTDKVAPDETVKVGYGKAYDVTKQVKTITGYKRNATLDEHTRGTASKTTKEAVMYYDPLPYNIHVNYLLTDGQKLDELDVTGLYGDTYTTEATDFEDLYTVDTDRLPTNAQGTVTEKPTTVNYYYQPTTGQWVDVGNQSSVLVRQDTKHNVRSVSQIYANDSGFTVKYNQDAAQVAIAASDTNGTQDNSLVFDYNSKYTFELSKNETVTFKVDDQGQVTATRVLGAEQTVTTFDKSGQLKTVTTVTNANGTKSQQTNTVDGLKSMVTGEQYDLGLLNGLKVTAQKEINPSQAATTESKTTTDTSQSGSNQSTSTTATDQTETNESTAGSSTNATNASSSVDASSANSQGDTEATSQSGTSASADSKTDSSAASSTSQTTDGETTNTDDTTTGTTTDSGLGFKSPFTEDQNTSSALGSAQTSSSLNSDTSAAVQALIAEPNSTPVVLGEDASFEEGVPVNDPVFSNGEGVSPNNNPSSAATPLAQATNTRARLTQNGKLLYEGTLQADQGEQNLYVSPDTTVEVDGGADGDGFYLDTYDGDKGMAYTLGSGYAWAAENNDVTAAPASSATTSSESAASESSTNSSDSSRTASSAADHSTSSASISDASQSSHSTSSSENSRSESSSSSSTTGDSADADKQAAARSSQTQSNSVNGSSQAVGSSTVTSQSSVPTKANTKQASSTPTTKANRATVVAATSSTAPRQSRATTASASVPSVTSASAAAASRAKQRSAFKKQHPILNQILPKTNSAVATWLVWLGVGLLILTVAITMVIKKRGRD
>NZ_CP017954.1|WP_003641945.1|2155090_2155813_-|aquaporin-family-protein
MMKDPLALQLLGEFLGTFILILLGDGVVAGVTLNKSKAQNAGWVAITLGWGFAVTMGVYASSFMSPAHLNPAVSLGMAVAGKFPWAYVIPYSAAQIAGGVIGGLVVWLHYYPHWQATKDAGAILGIFATGPGIRRYFWNFISEVIGTFVLVFGLLAFTKGQFTAGLNPIVVGILIIAIGLSLGGTTGYAINPARDLGPRIAHAVLPIANKGTSDWAYSWVPIAGPLVGGALGALLFNVLP
>NZ_CP017954.1|WP_003643774.1|2155827_2157657_-|type-1-glycerol-3-phosphate-oxidase
MAFSATTRQQNIERLQNETLDLLVIGGGITGAGVAIQSTAMNMKTGLIDMQDFAEGTSSRSTKLVHGGIRYLKTFDVGVVADTVKERAVVQGIAPHIPKPDPMLLPIYDETGATFDLFSVKVAMDLYDKLAEVKDPKFTNYTLSREEVLQREPQLNPKHLVGGGVYLDFRNNDARLVIENIKKAHENGGIMASHVKATGLLHDDDGRINGITAEDLLTGASFEIHARIVINTTGPWSDTIRKMDHTEKYQSQMRPTKGVHLVVDAEKLPVPQPTYFDSGDQDGRMIFVVPRENKTYFGTTDTDYHGDLKHPTVTQEDVDYLLEIVNRRFPTAKITLDDIEASWAGLRPLIAANGSSDYNGGNSGKISDKSFKEVIKVVDQFESQEASREDVESVLNDLETSLAEDKLSPSAVSRGSSLTSSPDGLLTLAGGKITDYRKMAAGAMALIAKILADKYDAHFNEINSKNLPVSGGDIDPHNVDATIAFYAKQGTDNGLTNDEALRIANMYGSNAARVFSLIGKVEPTHGLSLAETISLRYALDEEMTLTPVDYLLRRTNHLLFMRDTLDGLKDGVIATMADYLGWDAATVKAQTELLNQTIAESDLTALKQG
>NZ_CP017954.1|WP_003643773.1|2157671_2159189_-|glycerol-kinase-GlpK
MTDKYIMAIDEGTTSTRAIIFDHAGHKVADSQREFPQYFPQPGWVEHNANEIWNAVLSTIANAFIESGIKPAQISGIGITNQRETTIVWDKQTGLPIYNAIVWQSRQTAPIAEKLVKDGYGDLIHQHTGLVTDAYFSATKIRWILDHVKGAQERAEKGELLFGTIDTWLLWKLTGGATHVTDYSNASRTMLFNIHDLKWDDQILQLLNIPAAMLPEVRTNSEVYGKTKDYHFFGSEVPISGMAGDQQAALFGQLAFEPGTVKNTYGTGAFIVMNTGEKPQLSDNNLLTTIGYGINGKVYYALEGSIFVAGSAIQWLRDGIRLVESAPDSERAARESHNENEVYVVPAFTGLGAPYWDSEARGSVFGLTRGTTREDFIKATLQALAYQTRDVVETMKKDSGIEIPVLKVDGGAARNDWLMQFQADILDTQIMRAANLETTALGAAFLAGLSVGYWQDLEELKASYKPGTSFDPEMGPAERTNLYEGWQAAVKATQVFKHTPYHAGK
>NZ_CP017954.1|WP_003646444.1|2159654_2160986_-|NAD(P)/FAD-dependent-oxidoreductase
MAEQYDVVVIGGGPAGNAMASGLKAQGKTVLIVEADLWGGTCPNRGCDPKKILLSAVEARQAAQHLQGQGLIGAPKIDWPALMAHKRGYTDGINDGTLNGLTGQDIATLHGQAHFQSDNQLAVGDRVVSATDYVIATGQRPAILPITGHEYFKTSTDFLDLDQMPKRVTFVGGGYVGFELATIANAAGADVHVIHHNDRPLKAFDADLVKDLMAAMTADGITFDLNTDVQAITKTATGLQLTADNFELTTDLVISSAGRIPNADQLGLANVGVTFDRHGIQVNDHLQTANPHIYAIGDVSDTPVPKLTPVAGFEARYLVGELTHPGAAIKYPVVPTQVFAAPKLAQVGISAAVATEHPDEYRVNTLDMTKWFTYYRFGAQQAQAKVVVAKASGQVVGATLLSDVADEMINYFTLLIEKHVTLPDLQRLVLAYPTPASDLQYLY
>NZ_CP017954.1|WP_003641941.1|2161063_2162035_-|ABC-transporter-ATP-binding-protein
MTTAIEFQHVQKDFNGQTVIPDLNLTIDQGELFVLVGTSGSGKTTSLKMINCLEPLTAGKILVNGTDTTTIPVRSLRWQMGYVLQQIALFPTMTVAQNIAVIPEMKGTAKKEINQTIDELLAEVGLDPKEYRDRMPSELSGGEQQRIGILRAIAAQPDIVLMDEPFSALDPISRQQLQDLVLRLHARYHNTIVFVTHDMNEALKLGDRIGVMQHGQLIQVDTPAALAQHPVNDFVRNFFGASRAKNVYDVYVGRVGLIQGYLTEEPSVASGRIQSLDVQATLRTAFTALTDHDYVAVTEENRVVGYLDRQRIVAYLSQHEEVS
>NZ_CP017954.1|WP_003646443.1|2162035_2163562_-|ABC-transporter-permease/substrate-binding-protein
MQTLIQTFMDRRGDLLTALWQHLGISLASLVIAMVIAIPLAIWVVRRPRWAEGLLQLTSVLQTIPSLALLGLLIPLVGIGTVPAVIALVIYALLPIFQNTYLGISEIDASIEEAADAFGMSRMRKLFKVELPIALPQIIAGIRTALVLIIGTATLAALIGAGGLGTFIMLGIDRNDTSLLLIGAISSALLAILLSALVRWFQTAKPRHALIVFVGILALLGGGGAYSVYANRVETITIAGKLGSEPEILINMYKQLIEAEDEHVHVTLKPNFGKTTFLFSALKNNQVDIYPEFTGSVLETLVKGNNPAGQTANQTYQLAKQRLAKQEQMTYLKPMQYNNTYALAVTKKFQQEHHLKTISDLTQVESILKPGMTLEFIDRNDGLKGIKKTYGLDVTAKSMEPALRYEAISKGKINLVDAYATDSELRQYHLALLKDNKHFFPTYQGAPLMKTNFANKHPKVVKALNKLAGKISETDMQEMNYEVNVKKQSASTVAHRYLVKHGLLKEGR
>NZ_CP017954.1|WP_003646442.1|2163799_2164246_+|ribonuclease-H
MATIHLYLASTNHQSTNITATTPAAWVVILRYADHQKALNDGGYGHTETSLALSALTTALATLKRHDLPVHVHTTTEQVAAVISEQRYLSWRQNNWDVPEADQPDLPQWQTLIPIIEEFPNLTITYHPVDDPAMTTATTTLTAVMTKL
>NZ_CP017954.1|WP_003643768.1|2165135_2166047_-|oxidoreductase
MSQPRVILITGASSGIGKATALKLQAQGNIVYGAARRIEKMTDLAAAGVHVLKVDVTDEATLIAAVKTIQVEQGRIDVLINNAGYGSYGSLEDVPVAEGEYQFKVNVFGVMRLTQLVLPLMRAQHRGRIINVSSIGGKIYQPLSAWYMGTKHAIEGMSDSLRMEVAPFGIDVVIVEPGGIKTEWAGIAEKKLLAVSGETAYHEQAVKVGAMLSLFDQFASNPGVIAKLMVRAVNDVKPKTRYHAGMGAGVSLTARQWLSDRQFDRMMNSAVNGAAKLSKVTRRKDRRTGSRHYRHGKIPADNN
>NZ_CP017954.1|WP_003646441.1|2166183_2167104_+|ribonucleoside-hydrolase-RihC
MSTKIIMDTDPGIDDAAAITFALNHPDLDLQLITTVAGNVTVDKTTLNALKLTRFFNSDVPVAGGAAQPLIKPFEDAVRIHGVSGMPGYDFPTDLAEPLPETAVEALRDYIMAAEQPITLVPTGAYTNIALLFKTYPEVMPHIKEIVAMGGALGKGNMTSAAEFNVFTDPHAAEIMYQSGVPITMVGLDVTMKALLTRESIEQLPTLGKTGEMLHALFGHYNDRNQTGVAMHDVNTLFYLLHPEAFTTEKMWIDVQTEGPANGETVGDIRGAYHDGKTNATVCVDIDAAAFNKWFLETVAAIDQPK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP017954_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017954_2

2959108-2959193

Orphan

Consensus_repeat	Method
AATAAGATACTTTAAGTTTCTTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP017954_2

>merge|NZ_CP017954|2|2959108-2959193|CRISPRCasFinder
AATAAGATACTTTAAGTTTCTTATTGACTTTTTCTTTATATAGCGTATTATACCAGTTATGCGAATAAGACACTTTAAGTTTCTTA

>NZ_CP017954|2|1|2959108-2959193|CRISPRCasFinder
AATAAGATACTTTAAGTTTCTTA	TTGACTTTTTCTTTATATAGCGTATTATACCAGTTATGCG
AATAAGACACTTTAAGTTTCTTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017954.1\|WP_071542843.1\|2943516_2949648_+\|KxYKxGKxW-signal-peptide-domain-containing-protein	unknown	unknown	gnl\|CDD\|375451
NZ_CP017954.1\|WP_003645367.1\|2962204_2963158_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318
NZ_CP017954.1\|WP_016511875.1\|2952794_2953688_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187572
NZ_CP017954.1\|WP_015640979.1\|2963376_2963943_+\|DUF1211-domain-containing-protein	unknown	unknown	gnl\|CDD\|226078
NZ_CP017954.1\|WP_003645369.1\|2965255_2965822_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP017954.1\|WP_003642340.1\|2967490_2967775_-\|DUF1905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378097
NZ_CP017954.1\|WP_003642355.1\|2951754_2952501_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP017954.1\|WP_003642344.1\|2964091_2965129_-\|aldehyde-reductase	unknown	unknown	gnl\|CDD\|187538
NZ_CP017954.1\|WP_016527331.1\|2956409_2957204_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP017954.1\|WP_003645365.1\|2961017_2961257_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017954.1\|WP_003643401.1\|2953668_2954181_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100
NZ_CP017954.1\|WP_049816394.1\|2957488_2958370_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238558
NZ_CP017954.1\|WP_003643397.1\|2959207_2960686_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP017954.1\|WP_003642356.1\|2951282_2951738_+\|acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP017954.1\|WP_071542844.1\|2965980_2966709_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP017954.1\|WP_003645366.1\|2961503_2961695_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017954.1\|WP_003643398.1\|2958490_2959090_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP017954.1\|WP_003643392.1\|2966841_2967207_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP017954.1\|WP_016511874.1\|2954424_2955420_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP017954.1\|WP_016511877.1\|2949745_2950126_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133384

Protein	Function_ID	Function_description	E-value
NZ_CP017954.1\|WP_071542843.1\|2943516_2949648_+\|KxYKxGKxW-signal-peptide-domain-containing-protein	gnl\|CDD\|375451	pfam17966, Mub_B2, Mub B2-like domain. This entry corresponds to the Mub B2 domain. This domain is related to the Mub B1 domain pfam17965. This domain may be involved in mucin binding. This domain is often found associated with the related pfam17965 in bacterial cell surface proteins.	1.98496e-13
NZ_CP017954.1\|WP_003645367.1\|2962204_2963158_+\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	1.45542e-130
NZ_CP017954.1\|WP_016511875.1\|2952794_2953688_+\|SDR-family-oxidoreductase	gnl\|CDD\|187572	cd05262, SDR_a7, atypical (a) SDRs, subgroup 7. This subgroup contains atypical SDRs of unknown function. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.02953e-129
NZ_CP017954.1\|WP_015640979.1\|2963376_2963943_+\|DUF1211-domain-containing-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	6.30859e-29
NZ_CP017954.1\|WP_003645369.1\|2965255_2965822_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	2.749e-05
NZ_CP017954.1\|WP_003642340.1\|2967490_2967775_-\|DUF1905-domain-containing-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	1.07383e-22
NZ_CP017954.1\|WP_003642355.1\|2951754_2952501_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.40011e-91
NZ_CP017954.1\|WP_016527331.1\|2956409_2957204_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	1.35948e-113
NZ_CP017954.1\|WP_003643401.1\|2953668_2954181_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	3.33884e-08
NZ_CP017954.1\|WP_049816394.1\|2957488_2958370_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	5.81827e-56
NZ_CP017954.1\|WP_003643397.1\|2959207_2960686_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	3.12844e-72
NZ_CP017954.1\|WP_003642356.1\|2951282_2951738_+\|acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	9.94104e-53
NZ_CP017954.1\|WP_071542844.1\|2965980_2966709_-\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	7.39889e-89
NZ_CP017954.1\|WP_003642344.1\|2964091_2965129_-\|aldehyde-reductase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.62333e-95
NZ_CP017954.1\|WP_003643398.1\|2958490_2959090_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.95133e-09
NZ_CP017954.1\|WP_003643392.1\|2966841_2967207_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.44304e-30
NZ_CP017954.1\|WP_016511874.1\|2954424_2955420_-\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	3.00121e-78
NZ_CP017954.1\|WP_016511877.1\|2949745_2950126_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133384	cd01109, HTH_YyaN, Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	1.28343e-18

>NZ_CP017954.1|WP_003643398.1|2958490_2959090_-|TetR/AcrR-family-transcriptional-regulator
MTKTRRRGAELENAIYQAARDILNQDGLEQLTFANVAEQAGTSKPVIYRRWRSPLELAIAAIQDQIITENHGQLDEVSLTGQTLSEDLFQVLKRFTVSINTFNQALVITWFHHLDQQANPEVKDLLNAVKKIDAHAIERVCQRAQQRGELRTGTLSCDLQLMPFDWLRYRAFANEPITDATLHLLVDDLLVPAYQHALG
>NZ_CP017954.1|WP_049816394.1|2957488_2958370_+|ABC-transporter-substrate-binding-protein
MGSLLLGACGAKQPTSTTVTRTDYLKHKVKVPKHPKRIVASYLEDDLVALGIKPVVQWSVKNGSGTQAYLKEQLKGVPLIDYSLPYEAVTKAKPDLILIGTSSAVANGKYAQYNKIAPTYVVKNGTTVTWRQTFLDVAKVVNRQAKAKKVLAKYDEQVQTTRQALKKSGQHKVAVLWVTNNTAYMVNDNSASGALLYQDLQLGEPSLVKQVSKSATADWSAVSLEKLAKLDADDIFLVNSQKSASLFKDPLWKNIKAVKNNHLYQYGDSSSWQYSGPIAYSQMIDMVKTDLLK
>NZ_CP017954.1|WP_016527331.1|2956409_2957204_-|ABC-transporter-ATP-binding-protein
MNTIEAQNISIGYGDKVIVDQLSITIPHGQITTLIGPNGSGKSTLIRAIAHLLPPTTGVILLDHQNIQQIKSKTFAKKIAVLPQTNQTANDLTVEELVSFGRLPYRRPLNGLTTTDHQKIEWALTQASLQDLRQRPLSTLSGGQRQRAWIAMAVAQDTDTIILDEPTTYLDLTHQLEVMQLVKKLNEQAHRTIIMALHDLNHAARISDQLIALKDGHVLAHGPVSTVMTAANLKKIFNIDATLVDYHGTPLILTYNGCQEVAPA
>NZ_CP017954.1|WP_016511874.1|2954424_2955420_-|iron-ABC-transporter-permease
MSPNRRLIIWSLLLTASMLGLAILNLSTGTMTISWPALLGILTSRGNATDMLVLVNFRLPRIVLAIMVGWALALSGNVLQTVTNNPMADPSLLGINNGAGLAVMLLIIGAGTNASLTLSLPIVALAGAWLSTALIFLLANQRQRGISSKRLLLVGVALSGCFSALMVLMTLKLSPDNYQFVMNWLAGSLWGTDWSYIGWALPWLAVGSGILFIQLPVLDAFTLGTTTAQTLGINLKRQQLGLISMAAMLAGVSVAISGGISFIGLITPNLARRIVGSRQRYQLPLAGLLGSTLLLAADTLGKLITTTTELPAGVLVALIGAPYFIYLLVRG
>NZ_CP017954.1|WP_003643401.1|2953668_2954181_-|TetR/AcrR-family-transcriptional-regulator
MANQRNQRMQATILLAYENLLSDKPFRKITVQDISDAALVHRSTFYKHFQDQYDLLEALFEQKRQQSKLTIDQIFTHPFETLNSFGNARFQETLRHQFNDDAFRDAFLNYLIHLCKDTVDDDQRLVRFLAVGRIKGLTLWITVGNAPYNIFTDTATLDNIFSNPLNTVNY
>NZ_CP017954.1|WP_016511875.1|2952794_2953688_+|SDR-family-oxidoreductase
MKVFITGGTGFVGSAVVQELVANGFEVVGLARSETSAQKLISWGAQPVRGSLTSLSTLATAAAQADAIIHLGFNNDFRHFFQAGAMDRRAIETMGRAISGTNKPLVVTYGTTGIRKHVETEHEVADTGLLKWLTPRKSEIVARQLMAQNINAFVIRLSPAVHGAGDMGFTRTVIERAKKSHRAEYFGLGTHAWSAVHRLDAAHLFYLVTMYGLEHPTTNERVFNAVAEESITTAAIARTISRKLNVPLKAKYNPLSFGDTAMLYLINCPTSSQLTRQILGWVPVQPDLLTDISSSRY
>NZ_CP017954.1|WP_003642355.1|2951754_2952501_+|SDR-family-oxidoreductase
MSIKGKVVVITGASSGIGAATAKLLAAKGAKVVLGARREERLQALSQAIGDNAVYQVTDVTDRQQVRALIDLAVSKFGRVDVLYNNAGTMPQGNLSDREYDKWQMMLNVNIMGVLNGIGEVLPIMQKQHDGLIIATDSVAGHVVYPASAVYNGTKYAVRAIMEGLRQEEKEHGIRSTIVSPGAVRTELVNTIGNTQIQAGISELMNADDRQGLALNPEDIANAVLFAIDQPKHVAISEVLVRPAQQEV
>NZ_CP017954.1|WP_003642356.1|2951282_2951738_+|acetyltransferase
MNVTREPSEIRERLAEITGQTIDISVEIRVPLWTDYGRNLKIGKRVFINDNVQITDLGGIELADDVLIGPGAMLLSVNHPLDPAKRHAVEVQPIHIERNAWIGAGAKVLAGVTVGENAVVGAGAVVTKSVPANTVVAGVPAKVIKTIEQVD
>NZ_CP017954.1|WP_016511877.1|2949745_2950126_-|MerR-family-transcriptional-regulator
MLTFKIPEQQHYFTTKEVTTITGMTKDALRYYEHLGILPDVQRNQYNYRQYSHKNLETLQLIKIFRDLDLDLSLLTPAHLALDGQAKVVAFKQYQQVIRDRIRHLEAIDQLLATKIDYFEHQSIDT
>NZ_CP017954.1|WP_071542843.1|2943516_2949648_+|KxYKxGKxW-signal-peptide-domain-containing-protein
MQKRRLQRARLTEKRAYKMYKKGRLWLVAGLSTFTLETGLVQLQAMADTTSTPVSQVEKTTDHANSSATLTTKVATNTNDTANADTKSSNSSSVHATTNNSSGAATASDDRAKTSVAEHTLSSATDGTKTTDSSTTDLTDSTTSHSSSVATANVSATSAAQTARTVNGTTNSAVSPNKVTASAAATEIESDSVKTKEITKTTGTAKAVSLAVTDTSMSQIKLRSARAAVATVATISSTTKMYDGVAGTPDRYTVTLADGIKAPTDWAVTKDPNVYTDIDLSDFDKNQFGRGIGTYPIAFSEFGLSKLAEANDSLDITAANVVTGTLTIEQAPVHSAAITIGSTSIDYGDSKPSSYQITVTNGYFDKYNAPSTWTLVDSTSSGVIKTTYTIASDSGDIAVPTATEAGTYVLALSAQGLAALQQANPNYEFTADSIVNGQLVIAAHDIITMGATTVLVNKTTSTVQVAVNSRAVSVPGDWEVYYNDKLTDSIVYKVPVSYTTYSTAVDTSTVGKYTITLTDAAMATLAQLNSSTVFNNTNVDDGVVLVKESNAVTISPSNYGAKASVNNNVTAASIQNARDKGINLLYGQGLYLVLPLLNVAQSEMTVDNLTEYVIIPAGFKVATTGNGDTVQVATDPVGALTAAIETMMTKNNVTYQGLAVTQLTDYNGRQTFKVHLDQTAAYSNGLFETMVYTLLPTIAVQSSGVTSGLIGNQVSSPDSAVIYVTDDPNENNGSYSLKDQNYPNIDKVAKALGVADAVTISSSFTDYLYTYTLKAAEADDIYMLQAPDGSSLGIIVVSGNVGTTYVPSRELQTITSSGNDYYYLNPDSIPRTRTYDSPDQRTYTLTYQRYVTTTTDTAAKITIAPASKVYDNNVTTDPSRYTVYLPTEYTVPSDWTADSAATAVDGTTAYQVSTDYLNTTAIDQNVGTYAVTLNSAGMAALAAANPDFLIAGDVNVGGTLTITQRPVTITLPDTILWANGQEQNITPVITGVVAGQSLDYTLTSGLTDPDTTTITATLTNATANSNYKLTNSPSGQLTVGAVAVVYQYGYRDKAGTLHVVTTANGTATHGTDVTAKGYLSYTTSDTTAAHAKTGYTLQPESTGYQADGTLADIGGQVVYTYLANTEKIAVVYVDQDKNSVILYQVPLSGSFGTHTNYTTAQDIAAYEKLGYVLASDEVPAQLEFDQDTEQTYYVYLKHGTITATVDQPGNVAVSDLMKTSQRTIHYVYADNTPTDLADVLQTVTYTRTATVDAVDRTVLSYGNWTTTVNSYPAIESPTITGYTADQTTIAAAVPASMGEATEATVRYSANLETIRVQFVDGTTDNQVLGYIDLNGKYGDAADYTVTADIAKYSKLGYEPVSSDLPDQLIYNQNAQVYTVTLAHRHVTVSVVHPGQPGQAIDADYPAGPKYPAGTGRDSLQQTVVRTITYQYASGESAAETVNQSVTFNRTATFDMATGKQLTYGDWTVAPGQSALLAAVTSPTITGYQASIAEVEATSVTSHDKSCSIAITYTAKSQTATVAFVDVTSGKTLPTMVVTGAYGTTNSYSPVSQIAAYEQLGYRLVSNNVPTTGITFDQNDVIKSYTVKLAHQMTTVTPTKPGQPGQPVDSAHPEGPKYPAGTGLKDLTTSVQRFITYVYNDGQTAASTVTQTVSFERKAAFDQVTKVVTYTDWRTPESALTGVYAVVESPIIAGYTPNATRVADVTVSAGDTDSRQTVTYQANLETATVTYVDVTTGHRLGTSVTLTGRFGTQADYQPTTMIAQYTQAGYVLMGSDYPATGVTFNQAGVVQKYTVYLAHNKIVITAPDQLTKTITQTVHYQDQAGHTLQADTIRALTFTRSGMKDAVTGVATYRDWAPTGLNFTAVSAPTIAKYHALTATTQAVAITAASADDVQTLTYALDVPTPTKPVKPTKPAKPTKPTTSDDLIKPTTKPITAAKPTQLTEPATVVKDFQATTGNQTPAKSTRTLVSSRIKAVKTAPASAIIKPGSEVTEPAHKAQADTTSRLPQTGETRRSEAAAETLGLTLATLLLGFGGLKRKRHEK
>NZ_CP017954.1|WP_003643397.1|2959207_2960686_+|DHA2-family-efflux-MFS-transporter-permease-subunit
MQAKAKISKATMTIAWVVVFGAMAPLLDSTMINIAINNLVTSFHSSVTTVQWAVTGYLLATGVAVPFSSWLLNRFDGKAVFVAGEILFGLGSIFAAVAPNIQLLIIARLVQGFAGGLIMPLLTTLLVQTAGAAVMGQMMATVGLPMILGPLIGPVIGGIIIKFASWHWIFWINVPVVLISIALILWKMPNYPAQNRTAKMDFIGILLLIVSSSAIIYSLVNAAHTDRFNNATSIEMLILGAIALISYVVWAAWQKERAVVPLHLFKFASFDGAGLGLFIAGTVLNGAMLLLPLYFQNVRGMSVINAALALLPQGAGMLVSRTLTGRLTDQIGAKYVVLGSVVITFVGTLPFYWFGQQTSYWILALVLFVRGIGAGGILMPLMADAYTGMQPGQVPAATIGTRIIQNIGSAFGSALITTIVTAYSTHQVNVFERHLKAGTYHVDAAHLQVFTTSHLQAIRLAAFQQGFLVIAIAAIVIILPTLLLTNKLKAAK
>NZ_CP017954.1|WP_003645365.1|2961017_2961257_+|hypothetical-protein
MKKVYLRYQKQVDSFININKIMLMLEFVLLFVVKGSIDRYNQLPYDWFAYLTTLIHYFLGTFTFFGIILVIECVWNKLK
>NZ_CP017954.1|WP_003645366.1|2961503_2961695_-|hypothetical-protein
MAAFSEKQLKKAPVTDQEFEKVVAVAKPDVQGIHSVCQQLVISFIAEERFLAVFGDGTCHPSN
>NZ_CP017954.1|WP_003645367.1|2962204_2963158_+|aldo/keto-reductase
MKTIQIGASQLKASAVALGIMRMVRLDTDAAANVLETVHDRGVNFIDSADIYGNGDSERIFGQALKQSSLKREDFFIQSKGGIVLDPEKSSGELVFGQRYDFSKQHLIATVDKILQRIQLDYLDSFLLHRPDPLMDPAEVAAAFDELQAAGKVRHFGVSNFNPMQVEMLQAAVSQKLMINQLQFGVMHTGPIQFGLHTNMQDTASLNHDGEIIEYSRLHHMTIQAWSPYQYGMFAGTFIDNPKFPELNAKLQELADQYHVTKNAIATAWILRHPANMQVILGSMNPQHLDESIAGTDVTLTRQEWYDVYFAAGNDLP
>NZ_CP017954.1|WP_015640979.1|2963376_2963943_+|DUF1211-domain-containing-protein
MNKARLEAFTDAIIAIVLTLLVLDLPRPQTPSVRALFAEWQSIYVYIITFTLLISIWLNHHDLFVQVKKIDRVVFWANSFWLLCQSFIPFMASWITKFPHSKWPAVFYILTGFVWMLAYQLLVAAVRRLNPHIHRMSSPALSVVFGGFLVVLTVALINPDVGLFLIPVHAFVSVILATKRKWHLRKYF
>NZ_CP017954.1|WP_003642344.1|2964091_2965129_-|aldehyde-reductase
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGGITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPAVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVLSAKYSHSNIQIQQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTIPNAAVKLAAKARPELRMVASLVGTYAETSNHKAQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>NZ_CP017954.1|WP_003645369.1|2965255_2965822_+|TetR/AcrR-family-transcriptional-regulator
MAATNHAQAIKKDSQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLDAYFAPAIAARFQDVLQHVPANQKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNANMTNYYQTTMANGTLTAVQLKYWTRFMSAGVYAIWREWLLGGQLEPLTMIHELLATLQTATMQALTQAQK
>NZ_CP017954.1|WP_071542844.1|2965980_2966709_-|SDR-family-oxidoreductase
MKPLVVITGASSGFGAEIAKLFAADNYPLLLLGRRQAKLAALSANFENAMIDTVDVTNYHQFETAVRKAEAKYGKTDLLVNNAGLMLLGNVQNQDPQEWQTMLNTNVMGVLNGTQIVLNDMRDREHGTILNMSSLAGKKTFVNHAAYVASKFGIHGLSETLREENAPKNVRVMLVAPGAAETELLTHVTSKSALSDYEAWKASMGGLTLDPKHVAATVKFMYDMPQNVNIREVDIAATAQDA
>NZ_CP017954.1|WP_003643392.1|2966841_2967207_+|helix-turn-helix-transcriptional-regulator
MLKERVTAQPRYRNEFDATMQLIRGKWKIMILFELAEVKVSRFADLQHHIQAVSHKTLASQLKKLEQDELIERHDFKTAQPHVEYRLTAKGQSLIPILDAICTWGDQHVDPALIERSLCDE
>NZ_CP017954.1|WP_003642340.1|2967490_2967775_-|DUF1905-domain-containing-protein
MKTYQFDAPIQAATIGKGGAYVACPFDIRDLFGKGRVKVHATFDEVPYNGSIVNMGVKNLDGSICYILGIRKDIRAKLHKSIGDVVAVTVTAID

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP017954_1	1.1\|2151865\|18\|NZ_CP017954\|CRT	2151865-2151882	18	NZ_CP017954.1	2151829-2151846	2	0.889
NZ_CP017954_1	1.2\|2151901\|18\|NZ_CP017954\|CRT	2151901-2151918	18	NZ_CP017954.1	2151829-2151846	2	0.889
NZ_CP017954_1	1.4\|2151973\|18\|NZ_CP017954\|CRT	2151973-2151990	18	NZ_CP017954.1	2925148-2925165	2	0.889
NZ_CP017954_1	1.5\|2152009\|18\|NZ_CP017954\|CRT	2152009-2152026	18	NZ_CP017954.1	2151829-2151846	2	0.889
NZ_CP017954_1	1.6\|2152045\|18\|NZ_CP017954\|CRT	2152045-2152062	18	NZ_CP017954.1	2925148-2925165	2	0.889
NZ_CP017954_1	1.7\|2152081\|18\|NZ_CP017954\|CRT	2152081-2152098	18	NZ_CP017954.1	2151793-2151810	1	0.944
NZ_CP017954_1	1.8\|2152117\|18\|NZ_CP017954\|CRT	2152117-2152134	18	NZ_CP017954.1	2151829-2151846	2	0.889
NZ_CP017954_1	1.9\|2152153\|18\|NZ_CP017954\|CRT	2152153-2152170	18	NZ_CP017954.1	2371314-2371331	2	0.889

1. spacer 1.1|2151865|18|NZ_CP017954|CRT matches to position: 2151829-2151846, mismatch: 2, identity: 0.889

gcttcttggaagatttct	CRISPR spacer
gcttcttagatgatttct	Protospacer
*******.** *******

2. spacer 1.2|2151901|18|NZ_CP017954|CRT matches to position: 2151829-2151846, mismatch: 2, identity: 0.889

gcttcttggaagatttct	CRISPR spacer
gcttcttagatgatttct	Protospacer
*******.** *******

3. spacer 1.4|2151973|18|NZ_CP017954|CRT matches to position: 2925148-2925165, mismatch: 2, identity: 0.889

gtttcttggaagactttt	CRISPR spacer
gttacttggaagaccttt	Protospacer
*** **********.***

4. spacer 1.5|2152009|18|NZ_CP017954|CRT matches to position: 2151829-2151846, mismatch: 2, identity: 0.889

gcttcttagaagacttct	CRISPR spacer
gcttcttagatgatttct	Protospacer
********** **.****

5. spacer 1.6|2152045|18|NZ_CP017954|CRT matches to position: 2925148-2925165, mismatch: 2, identity: 0.889

gtttcttggaagactttt	CRISPR spacer
gttacttggaagaccttt	Protospacer
*** **********.***

6. spacer 1.7|2152081|18|NZ_CP017954|CRT matches to position: 2151793-2151810, mismatch: 1, identity: 0.944

gcttcttcgaagattttt	CRISPR spacer
gctttttcgaagattttt	Protospacer
****.*************

7. spacer 1.8|2152117|18|NZ_CP017954|CRT matches to position: 2151829-2151846, mismatch: 2, identity: 0.889

gcttcttagaagacttct	CRISPR spacer
gcttcttagatgatttct	Protospacer
********** **.****

8. spacer 1.9|2152153|18|NZ_CP017954|CRT matches to position: 2371314-2371331, mismatch: 2, identity: 0.889

gtttcctggccgctttct	CRISPR spacer
gttttcttgccgctttct	Protospacer
****.** **********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP017954_1	1.10\|2152189\|30\|NZ_CP017954\|CRT	2152189-2152218	30	NZ_CP006988	Rhizobium sp. IE4771 plasmid pRetIE4771b, complete sequence	31052-31081	7	0.767

1. spacer 1.10|2152189|30|NZ_CP017954|CRT matches to NZ_CP006988 (Rhizobium sp. IE4771 plasmid pRetIE4771b, complete sequence) position: , mismatch: 7, identity: 0.767

gtttcttggccgctttcttcttgtgtgact	CRISPR spacer
gcttcttggcggctttattcttgtgcggtc	Protospacer
*.******** ***** ********.*...

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

383727 : 437867

Lactobacillus_phage(77.5%)

portal,capsid,head,terminase,integrase,tail,holin

attL 397912:397932|attR 438253:438273

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061468360.1\|383727_384885_-\|integrase	site-specific integrase	Q938N9	Temperate_phage	6.6e-54	34.8
WP_003643618.1\|384963_385608_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003643619.1\|385755_385935_+	helix-turn-helix domain-containing protein	E9LUT5	Lactobacillus_phage	2.5e-21	89.7
WP_061468359.1\|386217_386436_+	hypothetical protein	NA	NA	NA	NA
WP_061468358.1\|386432_387233_+	bifunctional DNA primase/polymerase	NA	NA	NA	NA
WP_061468357.1\|387232_388627_+	virulence protein	Q4ZD27	Staphylococcus_phage	2.7e-70	35.8
WP_003645297.1\|388770_389190_+	hypothetical protein	NA	NA	NA	NA
WP_024971524.1\|389214_389397_+	sporulation protein Cse60	NA	NA	NA	NA
WP_061468356.1\|389406_389745_+\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	4.6e-08	35.6
WP_061468355.1\|389737_390127_+	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	3.0e-19	45.2
WP_071542597.1\|390740_391214_+\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_071542599.1\|391210_392914_+\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	1.3e-119	40.1
WP_071542602.1\|393068_394175_+\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	1.0e-48	33.6
WP_071542604.1\|394164_395763_+\|capsid	phage major capsid protein	A0A1J0MFW8	Staphylococcus_phage	1.2e-40	33.4
WP_071542605.1\|395979_396249_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_071542607.1\|396415_396787_+	hypothetical protein	NA	NA	NA	NA
WP_016511207.1\|396869_397175_+	hypothetical protein	NA	NA	NA	NA
WP_003642774.1\|397594_397801_+	hypothetical protein	NA	NA	NA	NA
397912:397932	attL	NA	NA	NA	NA
WP_070083730.1\|398152_399274_-\|integrase	tyrosine-type recombinase/integrase	D6PSS4	Lactobacillus_phage	1.7e-46	32.7
WP_070083729.1\|399781_400699_-	type II toxin-antitoxin system PemK/MazF family toxin	Q4ZE81	Staphylococcus_phage	4.3e-16	51.9
WP_080396925.1\|400886_401063_-	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	9.1e-08	53.4
WP_071542609.1\|401346_401685_-	hypothetical protein	NA	NA	NA	NA
WP_071542611.1\|401644_402220_-	hypothetical protein	NA	NA	NA	NA
WP_061468341.1\|402270_403617_-	DUF4041 domain-containing protein	A0A1B0Y697	Lactobacillus_phage	1.1e-81	51.8
WP_061468340.1\|403642_404056_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_011101778.1\|404067_404430_-	helix-turn-helix domain-containing protein	A0A2R2ZGJ3	Clostridioides_phage	1.7e-08	48.4
WP_061468339.1\|404558_404786_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003642792.1\|404782_404953_+	hypothetical protein	NA	NA	NA	NA
WP_071542613.1\|404965_405271_+	DUF771 domain-containing protein	NA	NA	NA	NA
WP_071542614.1\|405338_405851_+	helix-turn-helix transcriptional regulator	D6PST4	Lactobacillus_phage	1.0e-27	43.5
WP_074161518.1\|406221_406608_+	hypothetical protein	NA	NA	NA	NA
WP_071542618.1\|406604_407492_+	recombinase RecT	E9LUM3	Lactobacillus_phage	4.3e-61	47.3
WP_071542855.1\|407523_408276_+	PD-(D/E)XK nuclease-like domain-containing protein	A0A0P0IZH9	Lactobacillus_phage	5.0e-71	50.6
WP_071542620.1\|408357_409194_+	DUF4373 domain-containing protein	NA	NA	NA	NA
WP_071542621.1\|409174_410017_+	ATP-binding protein	O03914	Lactobacillus_phage	2.5e-151	95.7
WP_016527203.1\|410173_410896_+	phage antirepressor KilAC domain-containing protein	Q8SDM9	Staphylococcus_phage	2.1e-50	45.6
WP_071542623.1\|410900_411419_+	hypothetical protein	O03915	Lactobacillus_phage	2.3e-38	53.9
WP_003642802.1\|411415_411790_+	hypothetical protein	NA	NA	NA	NA
WP_071542624.1\|411792_412104_+	hypothetical protein	A0A2P0ZLB4	Lactobacillus_phage	1.6e-52	98.1
WP_155118873.1\|412268_412418_+	hypothetical protein	NA	NA	NA	NA
WP_155118874.1\|412419_412569_+	hypothetical protein	NA	NA	NA	NA
WP_071542626.1\|412552_412954_+	hypothetical protein	D6PSV5	Lactobacillus_phage	3.9e-30	56.0
WP_033609727.1\|413250_413721_+	hypothetical protein	B4XYT9	Lactobacillus_phage	1.9e-15	40.0
WP_071542628.1\|414417_414945_+	hypothetical protein	NA	NA	NA	NA
WP_071542630.1\|414937_415654_+	hypothetical protein	NA	NA	NA	NA
WP_071542632.1\|415663_416686_+	hypothetical protein	NA	NA	NA	NA
WP_071542634.1\|416802_416991_+	hypothetical protein	E9LUP6	Lactobacillus_phage	2.7e-10	63.8
WP_071542636.1\|417176_417695_+\|terminase	terminase small subunit	O03926	Lactobacillus_phage	2.0e-71	86.0
WP_071542638.1\|417675_419019_+\|terminase	PBSX family phage terminase large subunit	O03927	Lactobacillus_phage	1.1e-257	95.7
WP_071542856.1\|419028_420555_+\|portal	phage portal protein	O03928	Lactobacillus_phage	6.3e-246	82.1
WP_071542640.1\|420551_421694_+\|capsid	capsid protein	O03929	Lactobacillus_phage	1.3e-166	92.4
WP_071542643.1\|422390_423272_+\|capsid	capsid protein	U3PDP8	Lactobacillus_phage	3.5e-92	59.4
WP_071542644.1\|423292_423721_+	hypothetical protein	NA	NA	NA	NA
WP_071542646.1\|423720_424071_+\|capsid	capsid protein	O03932	Lactobacillus_phage	2.3e-55	91.4
WP_071542647.1\|424070_424418_+\|capsid	capsid protein	O03933	Lactobacillus_phage	9.4e-57	92.2
WP_071542648.1\|424417_424822_+\|capsid	minor capsid protein	O03934	Lactobacillus_phage	2.0e-66	96.3
WP_071542650.1\|424856_425411_+\|capsid	capsid protein	O03972	Lactobacillus_phage	2.6e-85	90.9
WP_071542651.1\|425461_425893_+	hypothetical protein	O03935	Lactobacillus_phage	3.1e-73	95.8
WP_071542653.1\|425898_426522_+	hypothetical protein	O03936	Lactobacillus_phage	5.4e-103	95.5
WP_071542655.1\|426525_431388_+	peptidoglycan DD-metalloendopeptidase family protein	O03937	Lactobacillus_phage	0.0e+00	59.9
WP_071542657.1\|431384_432233_+\|tail	phage tail family protein	D2KRB8	Lactobacillus_phage	3.0e-64	46.4
WP_071542658.1\|432236_433385_+\|tail	phage tail protein	D2KRB9	Lactobacillus_phage	1.5e-53	30.6
WP_071542659.1\|433374_433698_+	hypothetical protein	NA	NA	NA	NA
WP_071542660.1\|433694_435908_+	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_071542857.1\|436093_437206_+	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	1.3e-35	35.9
WP_016511341.1\|437206_437503_+	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	4.4e-39	77.6
WP_071542661.1\|437489_437867_+\|holin	holin	A0A2H4PBB2	Lactobacillus_phage	3.7e-14	83.3
438253:438273	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1263704 : 1273305

Lactobacillus_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645220.1\|1263704_1264700_-	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	3.1e-52	38.8
WP_015380221.1\|1265326_1265464_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003643094.1\|1265559_1266000_+	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	8.0e-77	99.3
WP_016527054.1\|1266070_1266631_-	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	1.3e-100	99.5
WP_015380220.1\|1266718_1269157_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.5
WP_003643097.1\|1269159_1269774_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_003645222.1\|1270117_1271065_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	1.7e-177	99.7
WP_015640259.1\|1271250_1272222_+	Nisin resistance protein	A0A2P0ZL68	Lactobacillus_phage	2.0e-181	98.8
WP_071542710.1\|1272312_1273305_-	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	3.2e-158	77.1

DBSCAN-SWA_3

1299407 : 1367839

Lactobacillus_phage(84.44%)

tRNA,capsid,protease,head,terminase,integrase,tail,holin

attL 1320921:1320937|attR 1362114:1362130

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645238.1\|1299407_1301096_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	1.2e-75	32.9
WP_003645239.1\|1301367_1301814_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003643130.1\|1302202_1302448_-	hypothetical protein	NA	NA	NA	NA
WP_016527046.1\|1302574_1303966_-	MATE family efflux transporter	NA	NA	NA	NA
WP_003645240.1\|1304241_1306017_-	SLC13 family permease	NA	NA	NA	NA
WP_016527045.1\|1306449_1308189_-	aryl-sulfate sulfotransferase	NA	NA	NA	NA
WP_003645242.1\|1308409_1309366_-	bifunctional oligoribonuclease/PAP phosphatase NrnA	NA	NA	NA	NA
WP_003645243.1\|1309355_1309979_-	adenylyl-sulfate kinase	A0A2K9L4R9	Tupanvirus	4.8e-27	40.6
WP_003645244.1\|1309981_1311157_-	sulfate adenylyltransferase	A0A2P1ELS9	Moumouvirus	1.4e-48	31.7
WP_003645245.1\|1311134_1312772_-	sulfotransferase family protein	NA	NA	NA	NA
WP_003645246.1\|1313660_1315967_+	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
WP_011101376.1\|1315980_1317837_+	bifunctional homocysteine S-methyltransferase/methylenetetrahydrofolate reductase	NA	NA	NA	NA
WP_003645248.1\|1317909_1318269_+	YisL family protein	NA	NA	NA	NA
WP_003643142.1\|1318368_1318890_-	GtrA family protein	NA	NA	NA	NA
WP_016527043.1\|1318995_1320009_+	hypothetical protein	NA	NA	NA	NA
WP_003645249.1\|1320173_1320599_+	hypothetical protein	NA	NA	NA	NA
1320921:1320937	attL	NA	NA	NA	NA
WP_071542712.1\|1321175_1321553_-\|holin	holin	A0A2K9VCG4	Lactobacillus_phage	1.3e-14	62.5
WP_021357089.1\|1321564_1321828_-	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	3.4e-35	92.0
WP_071542713.1\|1321827_1322988_-	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	3.6e-193	87.2
WP_071542714.1\|1322999_1323254_-	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	2.2e-18	82.0
WP_071542715.1\|1323253_1324252_-	hypothetical protein	A0A2P0ZLF6	Lactobacillus_phage	9.7e-62	86.4
WP_162985027.1\|1324235_1324397_-	hypothetical protein	A0A2P0ZLG1	Lactobacillus_phage	6.1e-19	94.3
WP_071542716.1\|1324400_1324640_-	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	2.7e-31	93.5
WP_071542717.1\|1324632_1327410_-	hypothetical protein	E9LUR4	Lactobacillus_phage	5.1e-177	94.6
WP_071542718.1\|1327411_1329769_-\|tail	phage tail protein	E9LUR3	Lactobacillus_phage	0.0e+00	92.2
WP_071542719.1\|1329834_1331604_-\|tail	phage tail family protein	E9LUR2	Lactobacillus_phage	0.0e+00	91.3
WP_071542720.1\|1331676_1336560_-	C40 family peptidase	A0A2P0ZLG0	Lactobacillus_phage	0.0e+00	57.4
WP_015640500.1\|1336591_1336777_-	hypothetical protein	NA	NA	NA	NA
WP_071542721.1\|1336821_1337196_-\|tail	phage tail assembly chaperone	A0A2P0ZLH4	Lactobacillus_phage	5.4e-58	95.2
WP_071542722.1\|1337271_1337925_-\|tail	phage tail protein	A0A2P0ZLH1	Lactobacillus_phage	2.9e-107	89.4
WP_071542723.1\|1337938_1338319_-	DUF806 family protein	A0A2P0ZLF4	Lactobacillus_phage	2.9e-59	92.1
WP_071542724.1\|1338318_1338726_-	HK97 gp10 family phage protein	A0A2P0ZLE6	Lactobacillus_phage	6.5e-65	93.2
WP_041142734.1\|1338728_1339076_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	1.2e-43	72.2
WP_071542725.1\|1339062_1339398_-\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	1.2e-45	85.5
WP_071542726.1\|1339470_1340703_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	6.7e-206	91.2
WP_071542727.1\|1340702_1341452_-\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	8.7e-124	93.6
WP_071542728.1\|1342628_1342823_-	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	8.2e-26	95.3
WP_071542729.1\|1342812_1344711_-\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	0.0e+00	96.7
WP_187337823.1\|1345865_1346012_-	hypothetical protein	E9LUP6	Lactobacillus_phage	9.8e-16	82.1
WP_071542730.1\|1346035_1346302_-	hypothetical protein	NA	NA	NA	NA
WP_071542731.1\|1346703_1347135_-	transcriptional regulator	E9LUP5	Lactobacillus_phage	1.6e-74	95.8
WP_071542860.1\|1347634_1348069_-	hypothetical protein	Q5ULU9	Lactobacillus_virus	2.2e-42	59.3
WP_155118875.1\|1348244_1348403_-	hypothetical protein	A0A2P0ZLB5	Lactobacillus_phage	1.6e-16	92.0
WP_071542734.1\|1348445_1348655_-	hypothetical protein	D6PSV2	Lactobacillus_phage	1.8e-31	98.6
WP_071542735.1\|1348651_1349029_-	endodeoxyribonuclease	NA	NA	NA	NA
WP_071542861.1\|1349025_1349544_-	hypothetical protein	O03915	Lactobacillus_phage	1.5e-37	52.6
WP_071542736.1\|1349703_1350489_-	ATP-binding protein	E9LUN6	Lactobacillus_phage	5.3e-132	90.8
WP_071542737.1\|1351305_1351998_-	hypothetical protein	E9LUU3	Lactobacillus_phage	2.5e-117	88.7
WP_071542738.1\|1352012_1352417_-	single-stranded DNA-binding protein	D6PSU2	Lactobacillus_phage	3.7e-44	65.7
WP_071542739.1\|1352413_1353061_-	ERF family protein	D6PSU1	Lactobacillus_phage	3.0e-64	59.0
WP_071542740.1\|1353063_1353474_-	hypothetical protein	NA	NA	NA	NA
WP_187337824.1\|1353574_1353721_-	hypothetical protein	E9LUT9	Lactobacillus_phage	5.2e-17	89.4
WP_071542741.1\|1353890_1354145_-	hypothetical protein	NA	NA	NA	NA
WP_021732031.1\|1354233_1354563_-	DUF771 domain-containing protein	E9LUT3	Lactobacillus_phage	2.0e-48	82.6
WP_071542742.1\|1354655_1355375_+	hypothetical protein	NA	NA	NA	NA
WP_015825325.1\|1355538_1355748_-	hypothetical protein	NA	NA	NA	NA
WP_080487843.1\|1355759_1356503_-	ORF6C domain-containing protein	A0A1P8BM06	Lactococcus_phage	8.2e-50	45.6
WP_071542744.1\|1356508_1356730_-	hypothetical protein	NA	NA	NA	NA
WP_063733609.1\|1356975_1357314_+	helix-turn-helix transcriptional regulator	Q8W5Y0	Listeria_phage	4.6e-16	43.1
WP_071542862.1\|1357323_1357602_+	hypothetical protein	D2KRD5	Lactobacillus_phage	1.8e-21	58.0
WP_071542745.1\|1357658_1358435_+	hypothetical protein	NA	NA	NA	NA
WP_003641358.1\|1358446_1358647_+	hypothetical protein	E9LUS6	Lactobacillus_phage	4.9e-26	100.0
WP_027822546.1\|1358952_1359135_+	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	8.8e-14	66.7
WP_071542746.1\|1359319_1359634_+	hypothetical protein	NA	NA	NA	NA
WP_056988408.1\|1359705_1359936_-	hypothetical protein	U5U783	Lactobacillus_phage	5.4e-08	47.5
WP_063485466.1\|1359959_1360697_+	hypothetical protein	U5U717	Lactobacillus_phage	4.4e-35	40.7
WP_070085494.1\|1360860_1361997_+\|integrase	site-specific integrase	E9LUS1	Lactobacillus_phage	2.6e-212	98.7
WP_041142698.1\|1362641_1364909_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	2.0e-118	31.5
1362114:1362130	attR	NA	NA	NA	NA
WP_003643147.1\|1364973_1365261_-	hypothetical protein	NA	NA	NA	NA
WP_003643148.1\|1365375_1365888_+	hypothetical protein	NA	NA	NA	NA
WP_003643149.1\|1366004_1366481_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003645251.1\|1367152_1367839_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_4

1690648 : 1754483

Lactobacillus_phage(26.67%)

bacteriocin,transposase,tRNA,protease,integrase

attL 1719296:1719317|attR 1723114:1723135

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641210.1\|1690648_1690978_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003645735.1\|1691186_1691855_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_016526995.1\|1691986_1692556_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011101234.1\|1692606_1693371_-	YibE/F family protein	NA	NA	NA	NA
WP_015640120.1\|1693367_1694618_-	YibE/F family protein	NA	NA	NA	NA
WP_003645738.1\|1694581_1695583_-	hypothetical protein	NA	NA	NA	NA
WP_003641204.1\|1696002_1696785_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_003641203.1\|1697119_1697446_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003645740.1\|1697637_1698519_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_016511043.1\|1698561_1700370_-	DNA helicase RecQ	M1PGQ0	Moumouvirus	1.0e-77	36.1
WP_071542761.1\|1700627_1700825_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003644064.1\|1701044_1701311_+	hypothetical protein	NA	NA	NA	NA
WP_003645742.1\|1701361_1702594_+	hypothetical protein	NA	NA	NA	NA
WP_003641197.1\|1702629_1704036_+	C69 family dipeptidase	NA	NA	NA	NA
WP_003641196.1\|1704488_1705496_+	aspartate--ammonia ligase	A0A1C9C5F0	Heterosigma_akashiwo_virus	1.4e-63	43.0
WP_003645743.1\|1705534_1706830_+\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	4.2e-57	31.2
WP_016526992.1\|1707000_1707630_+	FMN-dependent NADH-azoreductase	NA	NA	NA	NA
WP_003641193.1\|1707738_1708212_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_080487831.1\|1708490_1710380_-	FAD-binding protein	A0A2P0ZL82	Lactobacillus_phage	8.9e-16	26.2
WP_003645746.1\|1710566_1711493_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	3.2e-19	25.8
WP_003644057.1\|1711563_1712115_-	helix-turn-helix domain-containing protein	X2CXD8	Lactobacillus_phage	4.9e-07	48.4
WP_003645747.1\|1712214_1712967_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003644055.1\|1713035_1713530_-	kinase	NA	NA	NA	NA
WP_003645748.1\|1713618_1713738_-	putative metal homeostasis protein	NA	NA	NA	NA
WP_071542762.1\|1713946_1717720_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_003645751.1\|1717834_1718365_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_071542763.1\|1718678_1719275_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_046783358.1\|1719282_1719870_+	restriction endonuclease subunit S	NA	NA	NA	NA
1719296:1719317	attL	NA	NA	NA	NA
WP_015379944.1\|1719880_1720798_-\|integrase	site-specific integrase	A8ATM2	Listeria_phage	2.7e-74	44.7
WP_016526887.1\|1721065_1721995_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	3.2e-19	29.9
WP_016526988.1\|1722089_1723187_-	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	8.5e-11	27.4
1723114:1723135	attR	NA	NA	NA	NA
WP_016526987.1\|1723183_1724770_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	4.2e-176	62.9
WP_016526986.1\|1724783_1727657_-	type I restriction endonuclease subunit R	NA	NA	NA	NA
WP_003645758.1\|1727884_1730419_-	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	3.5e-68	27.4
WP_003644050.1\|1730600_1731173_-	hypothetical protein	NA	NA	NA	NA
WP_003644049.1\|1731278_1731611_-	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_003645760.1\|1731972_1732983_-	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_016526985.1\|1733114_1733915_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_016526984.1\|1734118_1734559_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_003644046.1\|1734619_1735042_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_003641174.1\|1735056_1735239_-	hypothetical protein	NA	NA	NA	NA
WP_003644045.1\|1735251_1735797_-	alkaline shock response membrane anchor protein AmaP	NA	NA	NA	NA
WP_003641172.1\|1735808_1736063_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_016526983.1\|1736303_1738151_-	acetyltransferase	A0A1R3Y5Q6	Salmonella_virus	5.8e-20	23.7
WP_003645764.1\|1738140_1738524_-	hypothetical protein	NA	NA	NA	NA
WP_003645765.1\|1739008_1741510_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_015640093.1\|1743154_1744030_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.8e-20	28.9
WP_003645768.1\|1744038_1744746_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_071542764.1\|1744901_1745246_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003645770.1\|1745465_1746149_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641165.1\|1746714_1747083_+	helix-turn-helix transcriptional regulator	E9LUL4	Lactobacillus_phage	5.9e-17	42.7
WP_003641164.1\|1747316_1747685_+	membrane protein	NA	NA	NA	NA
WP_041161819.1\|1748221_1749646_+	hypothetical protein	NA	NA	NA	NA
WP_003641157.1\|1751424_1751943_-	hypothetical protein	NA	NA	NA	NA
WP_016526887.1\|1753553_1754483_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	3.2e-19	29.9

DBSCAN-SWA_5

1946961 : 1955585

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643943.1\|1946961_1947957_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	5.9e-51	38.2
WP_003640969.1\|1948095_1948881_-	acyl-ACP thioesterase	NA	NA	NA	NA
WP_003643942.1\|1948884_1949781_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	9.9e-82	55.7
WP_003640967.1\|1949879_1950227_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_003640966.1\|1950251_1951271_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640965.1\|1951287_1951617_-	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_003644908.1\|1951613_1952279_-	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640957.1\|1952676_1952928_-	YaaL family protein	NA	NA	NA	NA
WP_003637790.1\|1952942_1953542_-	recombination protein RecR	NA	NA	NA	NA
WP_003640956.1\|1953557_1953866_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003644909.1\|1953887_1955585_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0

DBSCAN-SWA_6

2088895 : 2144417

uncultured_Mediterranean_phage(20.0%)

bacteriocin,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646511.1\|2088895_2090167_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.5e-96	43.7
WP_003642042.1\|2090634_2092248_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.2e-143	49.9
WP_003642041.1\|2092420_2093029_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_003642040.1\|2093073_2093514_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_015639962.1\|2093876_2094809_+	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_169484456.1\|2094817_2096176_+	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	5.2e-26	32.9
WP_003646508.1\|2096195_2097005_+	sugar-phosphatase	NA	NA	NA	NA
WP_003643831.1\|2097174_2098161_-	lipoprotein	NA	NA	NA	NA
WP_003646506.1\|2098243_2099266_-	YdcF family protein	NA	NA	NA	NA
WP_003643830.1\|2099555_2100536_-	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	4.9e-42	36.3
WP_003646505.1\|2100901_2101726_-	serine hydrolase	NA	NA	NA	NA
WP_071542781.1\|2101961_2103344_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L140	Tupanvirus	1.5e-28	33.6
WP_003642030.1\|2103412_2104249_-	pur operon repressor	NA	NA	NA	NA
WP_003642029.1\|2104741_2105005_-	hypothetical protein	NA	NA	NA	NA
WP_071542782.1\|2105019_2105562_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_003646500.1\|2106642_2107440_-	metal ABC transporter permease	NA	NA	NA	NA
WP_003642023.1\|2107432_2108131_-	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	1.2e-15	27.8
WP_003642022.1\|2108397_2109342_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003643828.1\|2109651_2110518_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_003642020.1\|2110650_2110902_-	Veg family protein	NA	NA	NA	NA
WP_003646498.1\|2111006_2111897_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_011101014.1\|2111893_2112457_-	ribonuclease M5	NA	NA	NA	NA
WP_069137150.1\|2112443_2113220_-	TatD family hydrolase	NA	NA	NA	NA
WP_003646496.1\|2113471_2113960_-	hypothetical protein	NA	NA	NA	NA
WP_016511603.1\|2115445_2116630_-	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_003646493.1\|2116862_2118914_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8
WP_071542783.1\|2119231_2119621_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_003642012.1\|2120217_2121060_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_003646490.1\|2121059_2121764_-	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_071542784.1\|2121785_2122745_-	IpaB/EvcA family protein	NA	NA	NA	NA
WP_003642009.1\|2122737_2124012_-	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_003642008.1\|2124057_2124975_-	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_003646487.1\|2125416_2126430_-\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_003646486.1\|2126660_2127026_-	type II toxin-antitoxin system PemK/MazF family toxin	A0A1S5SAB3	Streptococcus_phage	1.8e-21	44.1
WP_003646485.1\|2127012_2127231_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_003646484.1\|2127364_2127787_-	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003641999.1\|2127776_2127965_-	hypothetical protein	NA	NA	NA	NA
WP_003641998.1\|2127971_2129333_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_071542785.1\|2129405_2130116_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_071542786.1\|2130523_2131540_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003646481.1\|2131979_2132756_-	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_003646480.1\|2133014_2135324_+	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_003646479.1\|2135613_2135907_-	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	9.9e-07	48.3
WP_101494318.1\|2135938_2136211_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_003646477.1\|2136326_2137013_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_071542787.1\|2137106_2137787_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003646475.1\|2137873_2138542_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003646474.1\|2138609_2139299_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003646473.1\|2139388_2140765_-	HlyD family secretion protein	NA	NA	NA	NA
WP_071542788.1\|2140780_2142931_-	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	1.8e-44	27.7
WP_003646471.1\|2143197_2143362_+	hypothetical protein	NA	NA	NA	NA
WP_003643811.1\|2143386_2143545_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_003646470.1\|2143643_2144417_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP017957

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 4978

unidentified_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016511784.1\|709_2083_-	MFS transporter	NA	NA	NA	NA
WP_016511783.1\|2122_3652_-	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_003576326.1\|3778_3970_+	hypothetical protein	NA	NA	NA	NA
WP_071542982.1\|4048_4978_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.1e-24	29.8

DBSCAN-SWA_2

9283 : 10858

Clostridium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016511420.1\|9283_9868_+	recombinase family protein	M9Q1K0	Clostridium_phage	1.2e-11	30.5
WP_016511421.1\|10048_10858_+	ParA family protein	A0A1V0DZZ0	Clostridioides_phage	5.1e-21	27.8

DBSCAN-SWA_3

25953 : 30027

Streptococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003580213.1\|25953_26649_-	response regulator transcription factor	W8CYM9	Bacillus_phage	8.3e-36	36.7
WP_071542987.1\|26816_27740_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.1e-31	31.6
WP_003577309.1\|27932_29771_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	2.6e-68	28.9
WP_016511950.1\|29814_30027_+	tyrosine recombinase	A0A1S5SEW4	Streptococcus_phage	5.4e-07	45.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_CP017956

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

14635 : 61194

Bacillus_phage(15.38%)

protease,holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071542944.1\|14635_15271_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_071542945.1\|15551_15656_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_016526651.1\|15717_16242_+\|transposase	transposase	NA	NA	NA	NA
WP_155118884.1\|16196_17093_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.1e-39	36.2
WP_071542946.1\|17701_19864_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	2.2e-103	46.3
WP_071542947.1\|20119_20326_+	hypothetical protein	NA	NA	NA	NA
WP_071542948.1\|20749_20989_+	hypothetical protein	NA	NA	NA	NA
WP_016526772.1\|22031_22226_+	hypothetical protein	NA	NA	NA	NA
WP_071542951.1\|22228_22861_+	hypothetical protein	NA	NA	NA	NA
WP_071542952.1\|22863_24648_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	4.0e-82	33.6
WP_016526775.1\|24714_25029_+	hypothetical protein	NA	NA	NA	NA
WP_071542953.1\|25124_27227_+	hypothetical protein	NA	NA	NA	NA
WP_071542954.1\|27236_28025_+	class A sortase	NA	NA	NA	NA
WP_071542957.1\|31068_31365_+	hypothetical protein	NA	NA	NA	NA
WP_071542958.1\|31746_31926_+	hypothetical protein	NA	NA	NA	NA
WP_187337827.1\|33181_33340_-	hypothetical protein	NA	NA	NA	NA
WP_071542959.1\|34782_36399_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	2.1e-127	50.3
WP_071542960.1\|36412_39580_-	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	9.0e-21	22.7
WP_155118887.1\|39782_40178_+	recombinase family protein	A0A0A8WIK3	Clostridium_phage	1.2e-20	43.1
WP_071542962.1\|40300_41014_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_071542963.1\|41098_41992_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	5.7e-21	29.7
WP_010012236.1\|41988_42663_-	helix-turn-helix domain-containing protein	A0A0C5AJ29	Paenibacillus_phage	6.2e-28	33.3
WP_071542980.1\|43142_44471_+	MFS transporter	NA	NA	NA	NA
WP_003567312.1\|44671_45229_+	hypothetical protein	NA	NA	NA	NA
WP_071542965.1\|45462_45879_-	arsenate reductase (thioredoxin)	A0A2H4PQT9	Staphylococcus_phage	3.9e-33	56.9
WP_071542966.1\|45901_46237_-	arsenite efflux transporter metallochaperone ArsD	NA	NA	NA	NA
WP_071542967.1\|46292_47213_-\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	1.7e-49	37.9
WP_071542967.1\|48388_49309_-\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	1.7e-49	37.9
WP_155118886.1\|51848_52010_-	hypothetical protein	NA	NA	NA	NA
WP_056953201.1\|52147_52444_+	hypothetical protein	NA	NA	NA	NA
WP_003646125.1\|52892_53429_+	hypothetical protein	NA	NA	NA	NA
WP_003636336.1\|53710_54292_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	7.2e-33	45.1
WP_071542968.1\|54738_55161_+	transcriptional regulator Spx	NA	NA	NA	NA
WP_071542969.1\|55653_56052_-	hypothetical protein	NA	NA	NA	NA
WP_071542970.1\|56190_56472_+	BRCT domain-containing protein	NA	NA	NA	NA
WP_071542971.1\|56654_59363_+	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_071542972.1\|59532_61194_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	4.6e-93	41.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage