CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP011660	Enterobacter hormaechei strain CAV1176 extrachromosomal	0 crisprs	NA	0	0
NZ_CP011659	Enterobacter hormaechei strain CAV1176 plasmid pCAV1176-34, complete sequence	0 crisprs	NA	0	0
NZ_CP011662	Enterobacter hormaechei strain CAV1176 chromosome, complete genome	2 crisprs	csa3,PD-DExK,WYL,DinG,DEDDh,cas3	2	9
NZ_CP011658	Enterobacter hormaechei strain CAV1176 plasmid pCAV1176-3223, complete sequence	0 crisprs	NA	0	0
NZ_CP011661	Enterobacter hormaechei strain CAV1176 plasmid pKPC_CAV1176, complete sequence	0 crisprs	NA	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP011662_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011662_1

2873659-2873820

Orphan

Consensus_repeat	Method
TCTCCCGTAGGCCCGGTAAGCGCAGCGCCACCGGGCAACGGTTTTAACCGGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP011662_1

>merge|NZ_CP011662|1|2873659-2873820|CRISPRCasFinder
TCTCCCGTAGGCCCGGTAAGCGCAGCGCCACCGGGCAACGGTTTTAACCGGAGAAACGATAAAAAGCCGGGTGGCGGCTACGCCTTACCCGGCCTACATGTTCTACATATTCTCCCGTAGGCCCGGTAAGCGCAGCGCCACCGGGCAACGGTTTTAGCCGGA

>NZ_CP011662|1|1|2873659-2873820|CRISPRCasFinder
TCTCCCGTAGGCCCGGTAAGCGCAGCGCCACCGGGCAACGGTTTTAACCGGA	GAAACGATAAAAAGCCGGGTGGCGGCTACGCCTTACCCGGCCTACATGTTCTACATAT
TCTCCCGTAGGCCCGGTAAGCGCAGCGCCACCGGGCAACGGTTTTAGCCGGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011662.1\|WP_032619707.1\|2865099_2866167_+\|oxidoreductase	unknown	unknown	gnl\|CDD\|183212
NZ_CP011662.1\|WP_003857302.1\|2881010_2882039_+\|methionine-synthase	unknown	unknown	gnl\|CDD\|181659
NZ_CP011662.1\|WP_015570569.1\|2864342_2865086_+\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NZ_CP011662.1\|WP_017693458.1\|2871148_2872231_+\|HlyD-family-secretion-protein	unknown	unknown	gnl\|CDD\|224482
NZ_CP011662.1\|WP_032620344.1\|2880015_2880990_+\|DUF1852-domain-containing-protein	unknown	unknown	gnl\|CDD\|370181
NZ_CP011662.1\|WP_032619713.1\|2884979_2886200_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|225139
NZ_CP011662.1\|WP_032619706.1\|2862273_2863611_-\|TolC-family-outer-membrane-protein	unknown	unknown	gnl\|CDD\|273829
NZ_CP011662.1\|WP_023303698.1\|2869473_2871126_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP011662.1\|WP_023303693.1\|2882042_2882975_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP011662.1\|WP_017384500.1\|2879307_2879847_-\|DUF2058-domain-containing-protein	unknown	unknown	gnl\|CDD\|225664
NZ_CP011662.1\|WP_023303697.1\|2872227_2873607_+\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|273830
NZ_CP011662.1\|WP_015570577.1\|2877917_2878523_+\|FMN-dependent-NADH-azoreductase	unknown	unknown	gnl\|CDD\|234675
NZ_CP011662.1\|WP_023303692.1\|2883967_2884501_-\|DUF3833-domain-containing-protein	unknown	unknown	gnl\|CDD\|378992
NZ_CP011662.1\|WP_017693463.1\|2878613_2879300_+\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NZ_CP011662.1\|WP_023303699.1\|2868464_2869259_-\|YdcF-family-protein	unknown	unknown	gnl\|CDD\|224351
NZ_CP011662.1\|WP_003857304.1\|2883073_2883508_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|377396
NZ_CP011662.1\|WP_015570570.1\|2866208_2866739_-\|cytochrome-b561	unknown	unknown	gnl\|CDD\|236921
NZ_CP011662.1\|WP_017384015.1\|2841784_2843950_-\|type-I-secretion-system-permease/ATPase	unknown	unknown	gnl\|CDD\|274550
NZ_CP011662.1\|WP_003857305.1\|2883512_2883971_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|377396
NZ_CP011662.1\|WP_032619709.1\|2866826_2868266_-\|aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|182233

Protein	Function_ID	Function_description	E-value
NZ_CP011662.1\|WP_032619707.1\|2865099_2866167_+\|oxidoreductase	gnl\|CDD\|183212	PRK11579, PRK11579, putative oxidoreductase; Provisional.	9.00543e-148
NZ_CP011662.1\|WP_003857302.1\|2881010_2882039_+\|methionine-synthase	gnl\|CDD\|181659	PRK09121, PRK09121, methionine synthase.	0
NZ_CP011662.1\|WP_015570569.1\|2864342_2865086_+\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	1.67687e-73
NZ_CP011662.1\|WP_017693458.1\|2871148_2872231_+\|HlyD-family-secretion-protein	gnl\|CDD\|224482	COG1566, EmrA, Multidrug resistance efflux pump [Defense mechanisms].	1.21598e-94
NZ_CP011662.1\|WP_032620344.1\|2880015_2880990_+\|DUF1852-domain-containing-protein	gnl\|CDD\|370181	pfam08908, DUF1852, Domain of unknown function (DUF1852). This family of proteins are functionally uncharacterized.	0
NZ_CP011662.1\|WP_032619713.1\|2884979_2886200_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|225139	COG2230, Cfa, Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane].	3.2042e-110
NZ_CP011662.1\|WP_032619706.1\|2862273_2863611_-\|TolC-family-outer-membrane-protein	gnl\|CDD\|273829	TIGR01844, Proteases_secretion_protein_PrtF, type I secretion outer membrane protein, TolC family. Members of this model are outer membrane proteins from the TolC subfamily within the RND (Resistance-Nodulation-cell Division) efflux systems. These proteins, unlike the NodT subfamily, appear not to be lipoproteins. All are believed to participate in type I protein secretion, an ABC transporter system for protein secretion without cleavage of a signal sequence, although they may, like TolC, participate also in the efflux of smaller molecules as well. This family includes the well-documented examples TolC (E. coli), PrtF (Erwinia), and AprF (Pseudomonas aeruginosa). [Protein fate, Protein and peptide secretion and trafficking, Transport and binding proteins, Porins].	4.16719e-87
NZ_CP011662.1\|WP_023303698.1\|2869473_2871126_+\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	9.85977e-23
NZ_CP011662.1\|WP_023303693.1\|2882042_2882975_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.17838e-73
NZ_CP011662.1\|WP_017384500.1\|2879307_2879847_-\|DUF2058-domain-containing-protein	gnl\|CDD\|225664	COG3122, COG3122, Uncharacterized protein conserved in bacteria [Function unknown].	1.03752e-76
NZ_CP011662.1\|WP_023303697.1\|2872227_2873607_+\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	6.43453e-93
NZ_CP011662.1\|WP_015570577.1\|2877917_2878523_+\|FMN-dependent-NADH-azoreductase	gnl\|CDD\|234675	PRK00170, PRK00170, azoreductase; Reviewed.	1.54157e-130
NZ_CP011662.1\|WP_023303692.1\|2883967_2884501_-\|DUF3833-domain-containing-protein	gnl\|CDD\|378992	pfam12915, DUF3833, Protein of unknown function (DUF3833). This is a family of uncharacterized proteins found in Proteobacteria.	3.41715e-91
NZ_CP011662.1\|WP_017693463.1\|2878613_2879300_+\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	5.32781e-69
NZ_CP011662.1\|WP_023303699.1\|2868464_2869259_-\|YdcF-family-protein	gnl\|CDD\|224351	COG1434, COG1434, Uncharacterized conserved protein [Function unknown].	5.30194e-19
NZ_CP011662.1\|WP_003857304.1\|2883073_2883508_+\|DMT-family-transporter	gnl\|CDD\|377396	pfam04657, DMT_YdcZ, Putative inner membrane exporter, YdcZ. DMT_YdcZ is a family of putative inner membrane exporters from both Gram-positive and Gram-negative bacteria.	2.22711e-23
NZ_CP011662.1\|WP_015570570.1\|2866208_2866739_-\|cytochrome-b561	gnl\|CDD\|236921	PRK11513, PRK11513, cytochrome b561; Provisional.	3.34238e-118
NZ_CP011662.1\|WP_017384015.1\|2841784_2843950_-\|type-I-secretion-system-permease/ATPase	gnl\|CDD\|274550	TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. This model is related to models TIGR01842 and TIGR01846, and to bacteriocin ABC transporters that cleave their substrates during export. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	0
NZ_CP011662.1\|WP_003857305.1\|2883512_2883971_+\|DMT-family-transporter	gnl\|CDD\|377396	pfam04657, DMT_YdcZ, Putative inner membrane exporter, YdcZ. DMT_YdcZ is a family of putative inner membrane exporters from both Gram-positive and Gram-negative bacteria.	5.29058e-30
NZ_CP011662.1\|WP_032619709.1\|2866826_2868266_-\|aldehyde-dehydrogenase	gnl\|CDD\|182233	PRK10090, PRK10090, aldehyde dehydrogenase A; Provisional.	0

>NZ_CP011662.1|WP_023303697.1|2872227_2873607_+|efflux-transporter-outer-membrane-subunit
MTLRPIAGLLIMAFLAGCQSVDVEPAKSSLHIPAQWRATSGPASPTEQLWWRNFHDSNLNRYVDQALKNNSDVLIARERINEYQARVYAADGSLFPSLDAGVTGTRARSQSAATGLPVYGTLYKGSLTASYDVDIWGVNRSTSRAAEASLEAQKAAAAAADLTVASSVASGYVTLLSLDEQLRVTRSTLKSREEAFNLAKRQFETGYSSRLELMQSDSELRATRAQVPLLQHQIAQQENALSLLLGSNPGDVARGESFDALTPLKLPSQLPSTLLNRRPDIVQAERQLIAADATLAASRASLLPSINLTATGSVQDRTLSGLLDNPLQLWSVGGSILAPLLNRQALNAQVDISQSQRNQALYSYEKTVRNAFAEVNDSLDAITRYQEQLTELLAQQTVAQETLRIAQNRYRNGYSSYLDELDAQRTLFSVQTSVVQVKNNLLLAQIDLYKALGGGWSSA
>NZ_CP011662.1|WP_017693458.1|2871148_2872231_+|HlyD-family-secretion-protein
MSQQDAAKEQANTRKNVRVVSIFTAAAIGIVGVLVILYAWQLPPFTRHAQFTDNAYVRGQTTFISPQVNGYITEVHVQDFAQVKKGELLLQIDDRIYRQRVHQAEAQLAMKIAALNNNLQQRKSAEAVIAKNEAALKNARAQSLKTQADLKRVKELTADGSLSIRERDSALASAAQGSADIDQAKATLEMSRQDLQTVIVNRGSLEADVENAKAALELAQIDLQNTRIVAPRDGQLGQIAVRLGAYVTAGTHLTTLVPPQHWVIANIKETQLANLRVGQPVKFTVDALNDKAYQGRVESISPATGVEFSAITPDNATGNFVKIAQRIPVRIEVLGEPEAYRLLRPGMSVQVTIDTREAKQ
>NZ_CP011662.1|WP_023303698.1|2869473_2871126_+|MFS-transporter
MRLPQRDPYAPREWQPHEKPALLGSPSTPEHPTSKRIAYGVVGLLVCLTGALGNAVVTANLQNLQGTFGAWSTEIAWLPAVYVMTNVSINLLLVKFRQQYGLRAFTEGFLVLYVLVTFFHLFVNDLSSALMVRAAHGMVAAALSSLGIYYQIQAWPAKHRLKALTIGITGSSLAIPLARLFSTELLQLDEWRGLYFFELGLALISLACVMALKLPPGDRRKVFEKKDFITFFLLAPGMALLCAVLSLGRLDWWFEAPWIGWALALSLVLIVSAIVFEHNRNNPLLNTRWLSSGSIVRLGLIMLLIRIVLAEQNTGVIGWLQYVGLQNEQMTHLAWAIFAGIVCGIVTSCLTIKPTKLAWPIITSLALMIVASLLDSQSNNLTRPDQLIFSQFLLGFGSAFFLAPAMLAAIGGVIADPRNLVSFSVMFGMSQNLGGLLGSAILGTFQTWREKYHSSLLADQLTTLNPLVNERIQLYTQMYKSLIGDSSLLGTQAITQLQTVTALEANILAYNDTYLLTASIATATLVWILWRLLRLRITARMALKNATGNK
>NZ_CP011662.1|WP_023303699.1|2868464_2869259_-|YdcF-family-protein
MTMALFPCLPGTTLDAVNTVGAWLAQDDYQDNQPVDLVILAGNAVIPAIDAACKIAAEQGIPLIISGGIGHSTTFLYAAIAKHPRYNRIPTTGRAEAAILADIAREFWNIPAEHLHVEDQSTNCGENARFSRALMKQSGLNAARVLVVQDPTMQRRTMATFARVCRDEAASPAWVSHPGLTPVLQNSDDGLVFSGPVEGLWPVERYLSLVLGEFPRLRDDINGYGPAGRDFIAHVDIPADVDAAWQILRNDVILTDALVSRSLL
>NZ_CP011662.1|WP_032619709.1|2866826_2868266_-|aldehyde-dehydrogenase
MTVPVQHPMYIDGQFVAWQGDAWIDVINPATEEVISRIPDGSAEDTRKAIDAADRAQAGWEALPAIERASWLRKISAGIRERVSEISALIVAEGGKIQQLAEVEVNFTADYIDYMAEWARRYEGEIIQSDRPGENILVFKRALGVTTGILPWNFPFFLIARKLAPALLTGNTIVIKPSEFTPNNAIAFAKIVDEIGLPKGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVGAGEKIMAAAAKNITKVGLELGGKAPAIVMDDADLELAVKSIVDSRVINTGQVCNCAERVYVQKGIYDRFVNRLGEAMKAVQFGNPAERTDIAMGPLINAAALERVEQKVARAVQEGAKVVLGGKAAEGKGYFYPPTLLLDVRQDMAIMHEETFGPVLPVVAFDTLEEALNMANDSDYGLTSSVYTQDLNVAMKAIKGLKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLNEYLQTQVVYLQS
>NZ_CP011662.1|WP_015570570.1|2866208_2866739_-|cytochrome-b561
MRTKYTGLQISIHWLVFLLVIMAYCAMEFRGWFPRTDRPLINMIHVSCGISILVLMVARLLIRLKFPAPPIQPKPKAMITGLSHLGHLVIYLLFIALPLIGMVMMYNRGNDWFAFGLTMPHAAEGNFDLVDTLKEWHVTLANLGYFVIGLHAFAALMHHYFWKDNTLLRMMPKKRQ
>NZ_CP011662.1|WP_032619707.1|2865099_2866167_+|oxidoreductase
MNKVKTMNIALIGYGFVGKTFHAPLIQSVEGLKLAVVSSRDEEKVKRDLPDVLVVATPEEAIQHPDIDLVVIASPNATHAPLATLALNAGKHVVVDKPFTLDMQEARDLIALAQEKQRLLSVFHNRRWDSDFLGIKQVIEQGRIGKVKHFESHIDRFRPEVRVRWREQNVPGSGLWFDLGPHMIDQTLQLFGLPQSVQGNIATLRDGAEINDWAHVVLNYPEHKVVLHCSMLVAGGVARFTVHGDKASVVKAHIDQQEAQLLAGVVPGSESWGEDSDAMVLFNAQGEASAIPAPKGDQRQYYINVRDALNGKIDNPVHPVEALAVMAVLEAAVKSSETGSTLELDLTAQERAQLQ
>NZ_CP011662.1|WP_015570569.1|2864342_2865086_+|DeoR/GlpR-transcriptional-regulator
MHKTARQKYVLDIITEQGQASITELAERLQVSADTIRRDLTDLEKQGLAQKNHGGAIALNLSTMTRVSRNSLLPEIKQRLGKQVAQCVPAGSTLFLDAGSTLLAVASFLQGPLTIITPSLDIAQQVSDREDIDLILLGGKWDQKQRLFAGSATLSLLSRYRADIAILGACAIHAELGLSASQEADAEVKRAMLAASQAHWVVADHLKLNQCEPYLVSGLSEIHQLFLDRPWAELGDHSALQVTVGAH
>NZ_CP011662.1|WP_032619706.1|2862273_2863611_-|TolC-family-outer-membrane-protein
MKMKCNNRLLRLSVSLTLISLVVTAANANNGQTGISPVAAMTMKESILFALDRDPSVSQQAAQLGIGQAQIDEARSGWMPQIALNGSTGHSQTTDSSGSLRNSAAWGLSLTQLVYDFGKTNNSISQSSAQRDSYRYQLMSTMSAVAEKTALSYVEVKRYSDLLQAAKENVQALKNVEQLAKLRADAGVSSTSDELQTRTRIAGMQATVEQYNASLNSARARLAVLTGIQAERYSPVPGGLAVEPDSLNRIDYSLIPTVMAAQNMERSAQYGVETARSQHWPTLSLKGGRTRYESDNRAYWDDQIQLNIDAPLYQGGAVSARVRQAEGARAMASSQVDQARFDVLQKASVAQADWTGARGRMEAGKRQLENALRARDVYKNEYTLSKRSINDLLSVEQDVWSATSAKIMAEYDGWSAAINYASAVDNLLPLIGIEKNAAAKLPDLS
>NZ_CP011662.1|WP_017384015.1|2841784_2843950_-|type-I-secretion-system-permease/ATPase
MKTHPQYEPWLQGMLIIAKYYRLDFSAEHVRVTINHESQSPRQLVLEEMARQLGLGMRWVAAGAVALDPWRLPLLAEFTGGQIAVINRMDNEGNVSVQFSGDGGLETTLTRDELGSRLKGLMVLRPLESTPDARVDDYIKPYEKNWFWQLALKDWRRYSDIMLVALVANVLALSGMVFSMQVYDRVVPSQSEATLWVLFGGVMIAIVFEFIMRMLRVHISDVVGKRADLRISERVFAHALRIKNGARSKSTGSFIAQIRELESVRELITSTTIAAISDLPFFLLFVFILWMIGGPLVLVVLLAVPLLLIPGLLVQRPLGKLSSEGMRESAIRNATLVEAVQGLEDIKLMRAEQRFQNQWNNTNDVAASVGMKQRWLTGLLLTWTQEVQSIVYAVVLLVGCYLVISGDMTTGALVGTSILASRTIAPLSQISGVLSRWQSAKVARKGLDDLMQRPIDDPQHGKKVHKAHLRGDYRLDDVGFYYDEEEKLTVLNISKLRIRAGERVAVLGRNGSGKSTLLHLLAGMQEPQQGSILLDDIALNHLDPADVRRDMQLLSQQARLFFGSVRDNILMGNPLATDEEIHQALVNSGALEFVRKQKMGLNTIINEGGTGLSGGQRQALLLARALITSPNILLLDEPTAWLDEVSEKQFIQHLHQWLGKRRTLVVATHRLPILDLVDRIIVLENGKVVMDGPRDAILRQHGMAPQQAPQRTVKLKTEGVA
>NZ_CP011662.1|WP_015570577.1|2877917_2878523_+|FMN-dependent-NADH-azoreductase
MSKVLVLKSSILAGYSQSGQLSDYFVEQWREQHSADEITVRDLAANPIPVLDGELVGALRPSDAPLTPRQQEALALSDELIAELQAHDVIVINAPMYNFNIPTQLKNYFDLVARAGVTFRYTENGPEGLVKGKRAVVLTSRGGIHKDTPTDLVAPYLTLFLGFIGITDVNFVFAEGIAYGPEVATKAQTDAKAAIDSLVAA
>NZ_CP011662.1|WP_017693463.1|2878613_2879300_+|RluA-family-pseudouridine-synthase
MSVIIDTFIAPPCHDNIEILWQDEHLLLINKPSGLLSLSGKNPQNLDSVHHRLVQTFPGCTLVHRLDFGTSGLMVIARNKAINAALCHQFSQRAVNKVYTALLCGHVEQDEGTVDAPIAKDPALFPLMTICARTGKPARSRYRVVERIYQDTTMPLTRVELTPETGRTHQLRIHCQQLGHPILGCDLYGGLEWPGAEETPRLMLHASALNFIHPLSGETMNARHAAPF
>NZ_CP011662.1|WP_017384500.1|2879307_2879847_-|DUF2058-domain-containing-protein
MTKLTLQEQMLKAGLVSSKKMAKVQRTAKKSRVQAREAREAVEENKKAQLERDKQLSEQQKQAVLAKEFRAQVKQLIEMNRITVAKGNITFNFTDGNLIKKIEVDKQTQTQLINGRLAIARLVINANGDCDYAIIPAVVADKIAQRDADSIVLNSALSQEEQDEDDPYADFKIPDDLMW
>NZ_CP011662.1|WP_032620344.1|2880015_2880990_+|DUF1852-domain-containing-protein
MSQAFTFTLKRSCFDENYNPSENTRTTTNFANLARGEKRQENLRNTLVMINNRFNALASWDNPKADRYAVELEIISVDMNIGGDFTFPAIEILQTTIVDKKTHERIEGIVGNNFSSYVRDYDFSVLLLEHNKDRARFSLPENFGELHGNIFKSFVHSAEYQANFKKAPVICLSVSSKDTYRRTGNHHPVLGYEYQPDGESLTEQYFAKMGLKVRYFMPENSVAPFAFFFTGDLLRDYTNLELIGTISTMETFQKIYRPEIYNANSAAGQCYQPDLNQQDHSLTKIVYDREERSRLAIEQGKYTEERFIKTYKTLLEQWSQHFTL
>NZ_CP011662.1|WP_003857302.1|2881010_2882039_+|methionine-synthase
MKTLLPTSTAGSLPKPTWLAQPETLWSPWKLQDEELLAGKQDALRLSLDEQIRAGIDIVSDGEQTRQHFVTTFIEHLSGVDFENRQTVRIRNRYDASVPTVVDAVARQKPVFVDDAKYLRQLTDKPIKWALPGPMTMIDTLYDAHYKSREKLAWEFAKILNQEARELEAAGVDIIQFDEPAFNVFFDEVNDWGIAALERAIEGLKCETAVHICYGYGIKANTDWKKTLGSEWRQYEEAFPKLQTSKIDIISLECHNSRVPMDLLELIRGKKVMVGAIDVATQTIETPEEVADTLRKALQFVDADKLYPSTNCGMAPLSRQVANGKLKALSAGADIIRRELAR
>NZ_CP011662.1|WP_023303693.1|2882042_2882975_-|LysR-family-transcriptional-regulator
MMDAGHISIRALLIFIDVYETQNFSVVARREGISASQVSRVIHQLEDALGQQLFYRNTRAIMPTESGHLFVRYARAMAGNMEDARRELDERAREPSGTLRINGPVFFGQRHIAPGLPGLLARYPRLSIELTLTDDFIDPHRDAADVIFRIGALTDSSFHARVFGQQFYHLAASPDYLQKHGAPEGPDDLSRHHCLVYRGSSGPNRWLIRQPGEAWVHYPIVPLMTSNNAETLLIAALGGMGVVLFPDWMVSERLKSGELVALLPEMECSINTEPLTIAAIYPNARHPPLNVRAVIDYYIERFGTPLYWQT
>NZ_CP011662.1|WP_003857304.1|2883073_2883508_+|DMT-family-transporter
MHIILILLVIAGGMGLSVEAGLLGPLGAEVGDLWAAFSIFSVGTGLTFLLMLFFSPRNSPSFFAQPSWHLLGGVLGPVYVIILTIATPAIGIAMTMIGILAGQVFKSLIIDHYGLLGTPHRRIDTKRIIALGFIIAALILVAQG
>NZ_CP011662.1|WP_003857305.1|2883512_2883971_+|DMT-family-transporter
MTVIMIILAVIGGATLSIQAAINGQLGSSVGVFKSAFLTFSVGALVTALLIFFFEPKQAVSLMDVPKWQLLGALCGVPYIVIMVLAVQRIGTAVATVAVILGQLAMSMLIDNFGWLNNEAIPFSVSRFGAVVCLSIALFFIYSSSKPQPEED
>NZ_CP011662.1|WP_023303692.1|2883967_2884501_-|DUF3833-domain-containing-protein
MKRFLLMALALTMLVAGCSTEVTEYRQQQPRLDIFTYFQGKTEAWGMVQDRSGKQIRRFHVEIAGDVIGDTLTLNEHFVYDDGEKQQRVWHIRRVGQNRYEGTAGDIEGGATGQAAGNALNWRYSMNVKADGKTWLLHFDDWMYLQDSTRLFNKTEMKKFGVTVATVTLFFTRKEGG
>NZ_CP011662.1|WP_032619713.1|2884979_2886200_-|class-I-SAM-dependent-methyltransferase
MTNPVFALEPDIPRNVRVARWLLFRLLNGLHGGSLTLREGAQTFQFGDASAALHAEVQVLAPGVYWRILTGGSLAAAQAWMDGDWETPHLTPLLELIARNSQILGKLEKGFRLLGKPVERLRHWMRRNSRAQARENIAAHYDLGNAFYAHFLDEHLLYSSALFSGDEQDLTAAQQAKMARLCDQLALTANDHLLEIGTGWGAMAEYAARHYGCRVTITTLSQEQYHWATARIARAGLQDRVEVLLCDYRDLSGVYDKLVSVEMIEAVGQRYLPTFFRTCQARLRPGGRMAIQAITIQDQRYRDYSKSVDFIQRYIFPGGFLPSITAMNELMTRHTDFVVRNLFDMGPDYARTLAHWRQRFVHAWQEIEKLGFDDRFRRMWLYYLGYCEAGFNARTISVVQLTAERV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP011662_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011662_2

3494474-3494562

Orphan

I-F

Consensus_repeat	Method
ATTTCTAAGCTGCCTGCCCGGCAGTGAAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP011662_2

>merge|NZ_CP011662|2|3494474-3494562|CRISPRCasFinder
ATTTCTAAGCTGCCTGCCCGGCAGTGAACAAAACACGCTGGCGCGTGTCGGTGTCGCCGTATTTCTAAGCTGCCTGCCCGGCAGTGAAC

>NZ_CP011662|2|2|3494474-3494562|CRISPRCasFinder
ATTTCTAAGCTGCCTGCCCGGCAGTGAAC	AAAACACGCTGGCGCGTGTCGGTGTCGCCGT
ATTTCTAAGCTGCCTGCCCGGCAGTGAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011662.1\|WP_017384857.1\|3506539_3507025_-\|type-II-secretion-system-protein-M	unknown	unknown	gnl\|CDD\|377391
NZ_CP011662.1\|WP_023296208.1\|3496598_3497600_+\|low-specificity-L-threonine-aldolase	unknown	unknown	gnl\|CDD\|236710
NZ_CP011662.1\|WP_015570988.1\|3490289_3491189_+\|lysine-exporter-LysO-family-protein	unknown	unknown	gnl\|CDD\|225287
NZ_CP011662.1\|WP_017693708.1\|3487468_3489127_-\|ATP-dependent-endonuclease	unknown	unknown	gnl\|CDD\|226121
NZ_CP011662.1\|WP_023303384.1\|3492996_3493965_+\|NADH-oxidoreductase	unknown	unknown	gnl\|CDD\|236735
NZ_CP011662.1\|WP_023303381.1\|3502788_3505491_-\|PKD-domain-containing-protein	unknown	unknown	gnl\|CDD\|119365
NZ_CP011662.1\|WP_023303380.1\|3505745_3506543_-\|prepilin-peptidase	unknown	unknown	gnl\|CDD\|224900
NZ_CP011662.1\|WP_026080729.1\|3489417_3490113_+\|aquaporin-Z	unknown	unknown	gnl\|CDD\|235453
NZ_CP011662.1\|WP_017693711.1\|3494841_3496560_+\|ubiquinone-dependent-pyruvate-dehydrogenase	unknown	unknown	gnl\|CDD\|181661
NZ_CP011662.1\|WP_017384852.1\|3499139_3500153_+\|NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223528
NZ_CP011662.1\|WP_032103415.1\|3507021_3508155_-\|general-secretion-pathway-protein-GspL	unknown	unknown	gnl\|CDD\|273768
NZ_CP011662.1\|WP_017384854.1\|3502245_3502686_-\|type-III-secretion-system-invasion-protein-IagB	unknown	unknown	gnl\|CDD\|185228
NZ_CP011662.1\|WP_015570984.1\|3483303_3485244_-\|macrolide-ABC-transporter-ATP-binding-protein/permease-MacB	unknown	unknown	gnl\|CDD\|182528
NZ_CP011662.1\|WP_017693707.1\|3486515_3487472_+\|DUF535-domain-containing-protein	unknown	unknown	gnl\|CDD\|377343
NZ_CP011662.1\|WP_006809408.1\|3483011_3483233_+\|cold-shock-like-protein-CspD	unknown	unknown	gnl\|CDD\|184960
NZ_CP011662.1\|WP_047715755.1\|3491333_3492986_+\|hydroxylamine-reductase	unknown	unknown	gnl\|CDD\|235391
NZ_CP011662.1\|WP_154294646.1\|3494313_3494451_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011662.1\|WP_023303382.1\|3497610_3499047_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187556
NZ_CP011662.1\|WP_032619987.1\|3485240_3486356_-\|macrolide-transporter-subunit-MacA	unknown	unknown	gnl\|CDD\|183211
NZ_CP011662.1\|WP_017693713.1\|3500299_3502111_-\|PKD-domain-containing-protein	unknown	unknown	gnl\|CDD\|381595

Protein	Function_ID	Function_description	E-value
NZ_CP011662.1\|WP_017384857.1\|3506539_3507025_-\|type-II-secretion-system-protein-M	gnl\|CDD\|377391	pfam04612, T2SSM, Type II secretion system (T2SS), protein M. This family of membrane proteins consists of Type II secretion system protein M sequences from several Gram-negative (diderm) bacteria. The precise function of these proteins is unknown, though in Vibrio cholerae, the T2SM (EpsM) protein interacts with the T2SL (EpsL) protein, and also forms homodimers.	2.13746e-29
NZ_CP011662.1\|WP_023296208.1\|3496598_3497600_+\|low-specificity-L-threonine-aldolase	gnl\|CDD\|236710	PRK10534, PRK10534, L-threonine aldolase; Provisional.	0
NZ_CP011662.1\|WP_015570988.1\|3490289_3491189_+\|lysine-exporter-LysO-family-protein	gnl\|CDD\|225287	COG2431, COG2431, Predicted membrane protein [Function unknown].	2.69399e-117
NZ_CP011662.1\|WP_017693708.1\|3487468_3489127_-\|ATP-dependent-endonuclease	gnl\|CDD\|226121	COG3593, COG3593, Predicted ATP-dependent endonuclease of the OLD family [DNA replication, recombination, and repair].	0
NZ_CP011662.1\|WP_023303384.1\|3492996_3493965_+\|NADH-oxidoreductase	gnl\|CDD\|236735	PRK10684, PRK10684, HCP oxidoreductase, NADH-dependent; Provisional.	0
NZ_CP011662.1\|WP_023303381.1\|3502788_3505491_-\|PKD-domain-containing-protein	gnl\|CDD\|119365	cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.	1.3015e-124
NZ_CP011662.1\|WP_023303380.1\|3505745_3506543_-\|prepilin-peptidase	gnl\|CDD\|224900	COG1989, PulO, Type II secretory pathway, prepilin signal peptidase PulO and related peptidases [Cell motility and secretion / Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion].	1.87481e-40
NZ_CP011662.1\|WP_026080729.1\|3489417_3490113_+\|aquaporin-Z	gnl\|CDD\|235453	PRK05420, PRK05420, aquaporin Z; Provisional.	1.82782e-146
NZ_CP011662.1\|WP_017693711.1\|3494841_3496560_+\|ubiquinone-dependent-pyruvate-dehydrogenase	gnl\|CDD\|181661	PRK09124, PRK09124, ubiquinone-dependent pyruvate dehydrogenase.	0
NZ_CP011662.1\|WP_017384852.1\|3499139_3500153_+\|NAD(P)-dependent-oxidoreductase	gnl\|CDD\|223528	COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism].	1.05058e-52
NZ_CP011662.1\|WP_017384854.1\|3502245_3502686_-\|type-III-secretion-system-invasion-protein-IagB	gnl\|CDD\|185228	PRK15328, PRK15328, type III secretion system invasion protein IagB.	5.32861e-87
NZ_CP011662.1\|WP_015570984.1\|3483303_3485244_-\|macrolide-ABC-transporter-ATP-binding-protein/permease-MacB	gnl\|CDD\|182528	PRK10535, PRK10535, macrolide ABC transporter ATP-binding protein/permease MacB.	0
NZ_CP011662.1\|WP_017693707.1\|3486515_3487472_+\|DUF535-domain-containing-protein	gnl\|CDD\|377343	pfam04393, DUF535, Protein of unknown function (DUF535). Family member Shigella flexneri VirK is a virulence protein required for the expression, or correct membrane localization of IcsA (VirG) on the bacterial cell surface,. This family also includes Pasteurella haemolytica lapB, which is thought to be membrane-associated.	3.82706e-128
NZ_CP011662.1\|WP_006809408.1\|3483011_3483233_+\|cold-shock-like-protein-CspD	gnl\|CDD\|184960	PRK14998, PRK14998, cold shock-like protein CspD; Provisional.	9.14248e-48
NZ_CP011662.1\|WP_047715755.1\|3491333_3492986_+\|hydroxylamine-reductase	gnl\|CDD\|235391	PRK05290, PRK05290, hybrid cluster protein; Provisional.	0
NZ_CP011662.1\|WP_017693713.1\|3500299_3502111_-\|PKD-domain-containing-protein	gnl\|CDD\|381595	cd00325, chitinase_GH19, Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.	2.7565e-72
NZ_CP011662.1\|WP_023303382.1\|3497610_3499047_+\|SDR-family-oxidoreductase	gnl\|CDD\|187556	cd05245, SDR_a2, atypical (a) SDRs, subgroup 2. This subgroup contains atypical SDRs, one member is identified as Escherichia coli protein ybjT, function unknown. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that generally matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	4.06263e-140
NZ_CP011662.1\|WP_032619987.1\|3485240_3486356_-\|macrolide-transporter-subunit-MacA	gnl\|CDD\|183211	PRK11578, PRK11578, macrolide transporter subunit MacA; Provisional.	0
NZ_CP011662.1\|WP_032103415.1\|3507021_3508155_-\|general-secretion-pathway-protein-GspL	gnl\|CDD\|273768	TIGR01709, Type_II_secretion_system_protein_L, type II secretion system protein L. This model represents GspL, protein L of the main terminal branch of the general secretion pathway, also called type II secretion. It transports folded proteins across the bacterial outer membrane and is widely distributed in Gram-negative pathogens. [Protein fate, Protein and peptide secretion and trafficking].	6.87481e-40

>NZ_CP011662.1|WP_154294646.1|3494313_3494451_+|hypothetical-protein
MQASAFAFGTSVGPVSVSATGLFAGWHYVYPAYIVPTACTAVNRG
>NZ_CP011662.1|WP_023303384.1|3492996_3493965_+|NADH-oxidoreductase
MTMPTSQCPWRMQVHHIHQETPDVWTLSLLCHDYYPYRAGQYALVSVRNSADTLRAYTISSTPGVSEYITLTVRRIDDGAGSEWLTRDVKRGDYIWLSDAQGEFTCDDKTEDKFLLLAAGCGVTPIMSMRRWLAKYRPQADVQVIFSVRSPEDVIFAEEWRNYPVTLVAEHNATHGFVAGRLSRELLQSVPDIANRTVMTCGPAPYMEIVEKEVKALGVTRFFKEQFFTPVAEAATSGMKFTKLQPAQTFFGRVGTTLLEALESNNVPVAAACRAGVCGCCKTKVVSGEYTVTSTMTLTDAEIAEGYVLACSCHPQGDLVLA
>NZ_CP011662.1|WP_047715755.1|3491333_3492986_+|hydroxylamine-reductase
MFCVQCEQTIRTPAGNGCSYAQGMCGKTAETSDLQDLLIAALQGLSAWAFKAREYGIVDHYVDSFAPRAFFSTLTNVNFDSPRIVGYAREAIALREALKAQCLNADASARVDNPMAELQLVSDDLGELQRQAAEFAPNKDKAAIGENILGLRLLCLYGLKGAAAYMEHAHVLGQYDNAIYAQYHKIMAWLGTWPSDMNALLECSMEIGQMNFKVMSILDAGETSTYGHPTPTQVNVKATEGKCILISGHDLKDLYNLLKQTEGTGVNVYTHGEMLPAHGYPELRKFKHLIGNYGSGWQNQQVEFARFPGPIVMTSNCIIDPTVGAYDDRIWTRSIVGWPGVSHLEGDDFGPVIAQAQQMAGFPYSEIPHLITVGFGRETLRGAADSLIDLVSREKLRHIFLIGGCDGARGERNYFTDFATRVPEDCLILTLACGKYRFNKLDFGNIEGLPRLVDAGQCNDAYSAIILAVTLAEKLGCGVNDLPLSLVLSWFEQKAIVILLTLLSLGVTNIVTGPTAPGFLTPNLLAILNEKFGLRSVTNVEDDMKQLLSA
>NZ_CP011662.1|WP_015570988.1|3490289_3491189_+|lysine-exporter-LysO-family-protein
MFSGLLIILLPLIVGYLIPLRHESALKLINRFLSWIVYVILFFMGISLAFLDNLATNLLSILHYSAVTVVVILLCNIAALFWLERTIPWKNHHHQEKLPSRIAMALESLKLCGVVVLGFLLGLTGWAFLQHATEASEYTLIFLLFLIGIQLRNNGMTLKQIVLNRRGMMVAVIVVASSLAGGVINAFILDLPLKTSLAMASGFGWYSLSGILLTESFGPVIGSAAFFNDLARELIAIMLIPGLVRRSRSTALGLCGATSMDFTLPVLQRSGGLEMVPAAIVHGFILSLLVPILMAFFSA
>NZ_CP011662.1|WP_026080729.1|3489417_3490113_+|aquaporin-Z
MFRKLAAECFGTFWLVFGGCGSAVLAAAFPELGIGFVGVALAFGLTVLTMAFAVGHISGGHFNPAVTLGLWAGGRFPAKDIIGYIIAQVIGGIIAAAVLYVIASGKAGFDAAASGFASNGFGEHSPGGYSMLSAIVIEIVLTAGFLLVIHGATDKYAPAGFAPIAIGLALTLIHLISIPVTNTSVNPARSTAVAIFQGGWALEQLWLFWVMPIIGGILGGVLYRTLLEKRD
>NZ_CP011662.1|WP_017693708.1|3487468_3489127_-|ATP-dependent-endonuclease
MLLERVEIVGFRGINRLSLQLEQNNVLIGENAWGKSSLLDALTLLLSPEENLYHFVHDDFWFPPGDVNGREKHLHIILTFRESEPGRHRVRRFRPMSPCWVPCEDGFQRIFYRLEGEMAQNDGVLTLREFLDEKGNPIPLDNIDELARHLIRLSPVLRLRDARFMRRIRNGTVPNMPEVEVTARELDFLARELVSRPQNLTDGQIRQGLSAMVQLLEHYFSEQGTGQARHRLMRRRSHDEQRSWRYLDIINRMIDRPGGRTHRVILLGLFSTLLQAKGTVRLDRDARPLLLVEDPETRLHPIMLSVAWHLLNLLPLQRVTTTNSGELLSLTPVEYVCRLVRESSRVTAYRLGPGGLNAEDGRRIAFHIRFNRASSLFARCWLLVEGETETWVINELARQCGHHFDAEGIKVIEFAQSGLKPLIKFARRMGIEWHVLVDGDEAGKKYAATVRSLLNNDREEEREHLTALPAMDMEHFMYRQGFDDVFHRVAMIPVDVPMNMRRVIAKAIHRSSKPDLAIEVATEAGRRGVESVPTLLRKMFSRVLWLARGRAD
>NZ_CP011662.1|WP_017693707.1|3486515_3487472_+|DUF535-domain-containing-protein
MSSIVDTPYSTLPQPKSGWQLFKSLASGSLTPGLAWQNPAYRRKFMLRSLATPFTTARLLGNLAKQPRLMQILRVQPGLPCRLHRPWLTVNMGRQTTLDALNDHYEMMSRHLPASLLNGYLSSQGITLVTLTGKEEQQFSVRLSADAFLDKEGEATLTFCDHQNTVLAELTFTLCTYQGKPTLFIGGMQGAKAHVPHEHIQLATKACHGLFPKRLLVEAVMTLAGAFPVEQILAVSNATHIYRSWRYRKKKEGKLLADYDSFWRSLGGQQQDNGNFALPLTMPRKPMEEIASKKRSEYRRRYALLDSLIQQVSQATAR
>NZ_CP011662.1|WP_032619987.1|3485240_3486356_-|macrolide-transporter-subunit-MacA
MNLKGKRRKLFLLLAVVVLAGGFWLWNVLNAPVPQYQTLIVRPGELQQNVLATGKLDALRKVDVGAQVSGQLKTLSVEIGDKVKKGQLLGVIDPEQAQNQIREVEATLMELRAQRAQAQAERNLAQVTLTRQQALAKTQAISKQDLDTAATELAVKQAQIGTIDAQIKRNQASLDTAKTNLDYTQIVAPMAGEVTQITTLQGQTVIAAQQAPNILTLADMSTMLVKAQVSEADVIHLKPGQKAWFTVLGDPQTRYEGVLKDILPTPEKVNDAIFYYARFEVPNPQGVLRLDMTAQVHIQLTGVKNVLTVPLSALGESAGDNRYKVKVLRNGESREREVVIGARNDTDVVVVKGLEEGEEVVTSETLPGAAQ
>NZ_CP011662.1|WP_015570984.1|3483303_3485244_-|macrolide-ABC-transporter-ATP-binding-protein/permease-MacB
MTALLELNDIRRSYPSGDGPVEVLKGISLRVEAGEMVAIVGASGSGKSTLMNILGCLDKPTSGTYRVAGTDVSTLDGDALAKLRREHFGFIFQRYHLLSHLSAAQNVEVPAVYAGVERKKRLERAKALLTRLGLAERVDYQPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILHQLRDQGHTVIIVTHDPQVAAQAERIIEIHDGELVSNPPPRQSRAAAPKEALPASTGWGQFSSGFREALTMAWLAMAANKMRTLLTMLGIIIGIASVVSIVVVGDAAKQLVLADIRAIGTNTIDVYPGKDFGDDEPQYQQALKYDDLAAIQKQPWVNSATPAVSQNLRLRYGNIDVAASANGVSGDYFNVYGMTFSEGATFNAEQLAGRAQVVVLDANSRRQLFPNKTRVVGEVILVGNMPATVIGVAEEKQSMFGSSKILRVWLPYSTISGRIMGQSWLNSITVRVKEGYDSALAEQQLERLLTLRHGKKDFFTWNMDGLLKTAEKTTRTLQLFLTLVAVISLVVGGIGVMNIMLVSVTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGAMGIALSMMIAFALQLFLPGWEIGFSPMAILTAFLCSTFTGILFGWLPARNAARLDPVDALARE
>NZ_CP011662.1|WP_006809408.1|3483011_3483233_+|cold-shock-like-protein-CspD
MEMGTVKWFNNAKGFGFICPEGGGEDIFAHYSTIQMDGYRTLKAGQSVRFDVHQGPKGNHASLIVPVEAETVA
>NZ_CP011662.1|WP_017693711.1|3494841_3496560_+|ubiquinone-dependent-pyruvate-dehydrogenase
MKQTVAAYIAKTLEQAGVKRIWGVTGDSLNGLSDSLNKMKTIEWMPTRHEEVAAFAAGAEAQLTGELAVCAGSCGPGNLHLINGLFDCHRNHVPVLAIAAHIPSSEIGSGYFQETHPQELFRECSHYCELVSSPEQIPQVLAIAMRKAILNRGVSVVVLPGDVALKAAPETATTHWYSAPQPTITPAEEELKKLAQLLRYSSNIALMCGSGCAGAHKELVEFAGKLKAPVVHALRGKEHVEYDNPYDVGMTGLIGFSSGFHTMMNADTLILLGTQFPYRAFYPTDAKIIQIDINPGSIGAHSKVDMALIGDIKSTLAALLPLLEEKTDRKFLDKALSDYRDARKGLDDLAKPSEKAIHPQYLAQQISHFADDDAIFTCDVGTPTVWAARYLKMNGKRRLLGSFNHGSMANAMPQALGAKATAPERQVVAMCGDGGFSMLMGDFLSVAQMKLPLKIVVFNNSVLGFVAMEMKAGGYLTDGTELHDTNFARIAEACGITGIRVEKASEVDDALQRAFAIDGPVLVDVVVAKEELAIPPQIKLEQAKGFSLYMLRAIISGRGDEVIELAKTNWLR
>NZ_CP011662.1|WP_023296208.1|3496598_3497600_+|low-specificity-L-threonine-aldolase
MIDLRSDTVTRPGRAMLEEMMAAPVGDDVYGDDPTVNELQRYAAELSGKEAALFLPTGTQANLVALLSHCERGEEYIVGQGAHNYLYEAGGAAVLGSIQPQPIDAAPDGTLPLDKVAAKIKADDIHFARTKLLSLENTHNGKVLPREYLKAAWDFTRERKLGLHVDGARIFNAVVEYGCELKAITQYCDSFTICLSKGLGTPVGSLLVGSADYIRRANRWRKMTGGGMRQAGILAAAGLYALKNNVSRLKDDHDNAAWMAAQLREIGADVMRHDTNMLFVRVGDEHAAALGDFMKARGVLINASPVVRLVMHLDVNREQLTEVVEHWQAFLQR
>NZ_CP011662.1|WP_023303382.1|3497610_3499047_+|SDR-family-oxidoreductase
MPQRILVLGASGYIGQHLTTALSQQGHQVLAAARNTERLQKLHLPGVTCHNVDLSWPKALPALLEGVDTLYYLVHSMGEGGDFIAHERQVAMNVRDALLQTPVKQVIFLSSLQAPEHEQSDHLRARQLTAETLRSARIPVTELRAGIIVGAGSAAFEVMRDMVYNLPVLTPPRWVRSRTTPIALENLLHYLVALLDHPAEQHRVLEAAGPEVLSYQAQFEHFMRVSGRHRWLIPIPFPTRWISVWFLNVITSVPPTTAKALIQGLKHDLLADDLALRALIPQELIRFDDAVRNTLKEEEKLVNSSDWGYDAQAFARWRPEYGYYPKQAGCTVKTTASLAALWEVVNQIGGKERYFFGNILWQTRGALDLLVGHRLAKGRPAHPWLKVGDTVDSWKVIIVEPEKQLALLFGMKAPGLGRLCFTLKDNGDHRELDVRAWWHPHGMPGLFYWLLMIPAHLFIFRGMAKRIAQLAEEKRENN
>NZ_CP011662.1|WP_017384852.1|3499139_3500153_+|NAD(P)-dependent-oxidoreductase
MKVLVTGATSGLGRNAVEFLRNKGISVRATGRNEAMGKLLQKMGAEFVHADLTELVSSQAKVMLAGIDTLWHCSSFTSPWGTQEAFDLANVRATRRLGEWAVAWGVRNFIHISSPSLYFDYHHHRDIQEDFRPARFACEFARSKAAGEEVIDLLAQSNPHTRFTVLRPQSLFGPHDKVFIPRLAQMMHHYGSVLLPRGGDALVDMTYYENAVHAMWLASQPECDKLVSGRAYNITNGEPCTLRSIVQRLIDELKIDCRIRSVPYPMLDMIARSMERFGSKSAKEPALTHYGVSKLNFDFTLDISRAENELGYKPIVSLDEGIVRTAAWLRDHGKLHR
>NZ_CP011662.1|WP_017693713.1|3500299_3502111_-|PKD-domain-containing-protein
MNKRTLLSVLIAGACVAPLMAQAANLKETSSEPYTIKASDLAKKEKELTDFPLMASVKETIQTLDNAQVELIEPGRAANPDNVKRVEGIVKASDWEYLFPLRAQAYTYSNFLKAVGKFPALCKTYNDGRDSDAICRKELATMFAHFAQETGGHESWRPEAEWRQALVHVREMGWSEGQKGGYNGECNPDVWQGQTWPCGKDKDGDFLSYFGRGAKQLSYNYNYGPFSEAMYGDVRTLLDKPELVADTWLNLASAIFFFAYPQPPKPSMLQVIDGTWQPNDHDKANGLVPGFGVTTQIINGGVECGGPTEIAQSQNRIKYYKEFANYLKVPVPANEVLGCANMKQFDEGGAGALKIYWEQDWGWSADTPDGKTYSCQLVGYQTPFSAFKDGDYSKCVQHFFNVKIVNDEGSSETPDETPVTPTPTPSDDETPAPTPTPDETPVVVNHAPVAQIAGPIGAVEAGAQVSLSAEGSTDPDGNTLTYTWRSQDGQTVTGQDKAVVTFTAPESATAQQYEVSLTVSDGELSSTTSYLLNVKAKAATPSGEDTSYPAWSANSKYNAGDIVNNHGKLFQCKPFPYSGWCNNAPTYYEPGAGLAWAEAWTAL
>NZ_CP011662.1|WP_017384854.1|3502245_3502686_-|type-III-secretion-system-invasion-protein-IagB
MKKLILLLLIISQSALANCWNKAAHYYHVDPYLLYAIANVESGMNPYAVGQNRDGTRDVGLMQINSSHFTALESRGIDEYRLITEPCTSIMVGASILAGMIRVYGYNWEAVGAYNAGLKKENYPQRMKYAHKVWAKYQQLKLAARY
>NZ_CP011662.1|WP_023303381.1|3502788_3505491_-|PKD-domain-containing-protein
MKFMKPKYLALFIAAATSSAFAAAPGAPTIGYGNDKFALVEVDQAAQDYNNLVKVHNDGVDVKVEWNVWSGDAPTSAKVLLDGQTVWTGAAGATGSATFKVKKGGRYQEQVEVCNASGCAKSASKLIIVADTDGSHLLPLNTSLKENNKAFAKHTDKVVAAYFPEWGVYDRNFPVDKIPAANLNHILYGFIPICGGDGINDGLKTIEGGNSFRVLQNDCKGRPDYTVAIHDPWAALQKPQAGVSGWDDPYKGNFGQLMALKKAHPDLKVLPSIGGWTLSDPFFHMGDPAIRARFVSSVKEFLQTWKFFDGVDIDWEFPGGGGVSENLGNPQQDKATYTALMHDLRTMLNELSAQTGRTYELTSAIGAGRDKIEDVDYTAAQQYLDHIFLMSYDFYGGWSNTVLGHQAALRAPAWRPDTDYTTENGVNALLSQGVQPGKIVVGAGMYGRGWTGVHGYTGNNPFTGTATGMVKGTWEPGVVDYRQIVNEYKGKPGWEYGYDADAEAPYVFNKTTGDLITYEDARSTTAKGKYVLANKLGGLFAWSIDSDTGDILNAMNESLLGGDATPVDPEVTNHAPIASSADQNVSGPVTVTLDGSASSDPDGDAITYKWTQVSGPSVTITNSTKAKATFNVAAATSDQTMVFRLTVTDAKGLSNAIDIQVVNKAPKANQAPVLNPMEAITLESGETYALHAQAADPDGDALTYAWSVPADMHATGSDSANVNITAPEVSSTSTYTLSVVVSDGKTSVQSNVQVTVNPKAAPAPVPDDEDTNPADDVTPPADDVTPPSDKGSCDAPVDANASKYAAWESSKIYNGGDTVSFDHLVWKAKYWTQGNQPGFGVDAWELVSNVKMNWRSDLVYNGGDTTTYEGNVYRAKWWTRGDNPANSDVWVKEGASTDCK
>NZ_CP011662.1|WP_023303380.1|3505745_3506543_-|prepilin-peptidase
MNTFSLMRDAFPVGFPIMSAILGGIVGSFLGVVAERVPGMVMDEEGSGNLLFPASNCPVCQHALAAWENIPLLSWLLLRGRCHQCGSAIPLRLFLVELISALFFGITAWCMPDVQALFSLWLLAAFLLPLAMIDWQHQLLPDCLTQPLLWAGLVLHAFDHTLPLRDALFGAVAGYLSLWLLYWAFRLITGREGLGYGDFKLLAALGAWCGWQVLPSIELAAALSGIVGYFAVNNLNKNNLTISFGPYLAFAGIVVFMSQQFAFTF
>NZ_CP011662.1|WP_017384857.1|3506539_3507025_-|type-II-secretion-system-protein-M
MKERIAQLKSRYQNYSTREKIILKICAVAIVGAVVYYTGVIPLDNMIQNSKSTLKRQKETLNWMRSEIDKNHLQVQIVKTNNPRTVVENSAHEINLSLTDMRQEGQTLSFVLNRVNVYELRSWLREINQTSGVRLQKINLTPVDHLSDVKAQVQLTWSKNA
>NZ_CP011662.1|WP_032103415.1|3507021_3508155_-|general-secretion-pathway-protein-GspL
MKQVLFVRPDSREGGKIMWCESGSERVEVVDSLEMLAEHPLATRVCLLLPASDMIFRHFTLPKKVASQAMAFSWMAEETLIGDVDNLHWTVLHKKGADVDAVAIDADRLRAALTRCQEAGLNVIQALPDAWLLPVTTGGSTLVAQDDSYWLRLSPHVAGEMEATLLPLLMQKAGVGEVWCYGDAPAKVHVDVQHAWQHPLALIQPQWQTCRVNLLHGEFSLKAGNGRAAKSMKAAMVAAGVLSVALLLGPRIAMAWMLVQQENRVQEEIVQVYQHHFPSMRQQTNIKYHFGQSLKKQSKGFFLQLDELENARQSVPAMEIELLEYDAQQNTLTLSVSAQNQPALQAFVNQTSENFDFTLQPVSTTEPYTAMIAGKHK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP011662_2	2.1\|3494503\|31\|NZ_CP011662\|CRISPRCasFinder	3494503-3494533	31	JF974302	Vibrio phage VBpm10, * SEQUENCING IN PROGRESS *, 8 unordered pieces	21037-21067	6	0.806
NZ_CP011662_2	2.1\|3494503\|31\|NZ_CP011662\|CRISPRCasFinder	3494503-3494533	31	MG592513	Vibrio phage 1.142.O._10N.261.49.E11, partial genome	26631-26661	7	0.774
NZ_CP011662_2	2.1\|3494503\|31\|NZ_CP011662\|CRISPRCasFinder	3494503-3494533	31	MG592412	Vibrio phage 1.028.O._10N.286.45.B6, partial genome	26631-26661	7	0.774
NZ_CP011662_2	2.1\|3494503\|31\|NZ_CP011662\|CRISPRCasFinder	3494503-3494533	31	MG592527	Vibrio phage 1.159.O._10N.261.46.F12, partial genome	26631-26661	7	0.774
NZ_CP011662_2	2.1\|3494503\|31\|NZ_CP011662\|CRISPRCasFinder	3494503-3494533	31	MG592588	Vibrio phage 1.217.O._10N.261.45.A1, partial genome	26631-26661	7	0.774
NZ_CP011662_2	2.1\|3494503\|31\|NZ_CP011662\|CRISPRCasFinder	3494503-3494533	31	MG592589	Vibrio phage 1.219.O._10N.261.45.E2, partial genome	26631-26661	7	0.774
NZ_CP011662_2	2.1\|3494503\|31\|NZ_CP011662\|CRISPRCasFinder	3494503-3494533	31	MG592524	Vibrio phage 1.156.O._10N.261.45.A6, partial genome	26631-26661	7	0.774
NZ_CP011662_2	2.1\|3494503\|31\|NZ_CP011662\|CRISPRCasFinder	3494503-3494533	31	MG592669	Vibrio phage 2.159.A._10N.261.46.F12, partial genome	26631-26661	7	0.774
NZ_CP011662_2	2.1\|3494503\|31\|NZ_CP011662\|CRISPRCasFinder	3494503-3494533	31	MG592670	Vibrio phage 2.159.B._10N.261.46.F12, partial genome	26631-26661	7	0.774
NZ_CP011662_2	2.1\|3494503\|31\|NZ_CP011662\|CRISPRCasFinder	3494503-3494533	31	MG592507	Vibrio phage 1.136.O._10N.261.45.E11, partial genome	26631-26661	7	0.774
NZ_CP011662_2	2.1\|3494503\|31\|NZ_CP011662\|CRISPRCasFinder	3494503-3494533	31	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1534665-1534695	7	0.774
NZ_CP011662_2	2.1\|3494503\|31\|NZ_CP011662\|CRISPRCasFinder	3494503-3494533	31	NC_015184	Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence	62534-62564	8	0.742
NZ_CP011662_2	2.1\|3494503\|31\|NZ_CP011662\|CRISPRCasFinder	3494503-3494533	31	NZ_CP035511	Haematobacter massiliensis strain OT1 plasmid pOT1-1, complete sequence	283146-283176	8	0.742
NZ_CP011662_2	2.1\|3494503\|31\|NZ_CP011662\|CRISPRCasFinder	3494503-3494533	31	NZ_CP054620	Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence	22328-22358	9	0.71
NZ_CP011662_2	2.1\|3494503\|31\|NZ_CP011662\|CRISPRCasFinder	3494503-3494533	31	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	475099-475129	9	0.71
NZ_CP011662_2	2.1\|3494503\|31\|NZ_CP011662\|CRISPRCasFinder	3494503-3494533	31	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	714186-714216	10	0.677
NZ_CP011662_1	1.1\|2873711\|58\|NZ_CP011662\|CRISPRCasFinder	2873711-2873768	58	NZ_LN868946	Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384 plasmid 4, complete sequence	15954-16011	12	0.793

1. spacer 2.1|3494503|31|NZ_CP011662|CRISPRCasFinder matches to JF974302 (Vibrio phage VBpm10, *** SEQUENCING IN PROGRESS ***, 8 unordered pieces) position: , mismatch: 6, identity: 0.806

aaaacacgctggcgcgtgtcggtgtcgccgt	CRISPR spacer
acaatgctctggcgcgtttcagtgtcgccgt	Protospacer
* **..* ********* **.**********

2. spacer 2.1|3494503|31|NZ_CP011662|CRISPRCasFinder matches to MG592513 (Vibrio phage 1.142.O._10N.261.49.E11, partial genome) position: , mismatch: 7, identity: 0.774

aaaacacgctggcgcgtgtcggtgtcgccgt	CRISPR spacer
actatgctctggcgcgtttcagtgtcgccgt	Protospacer
*  *..* ********* **.**********

3. spacer 2.1|3494503|31|NZ_CP011662|CRISPRCasFinder matches to MG592412 (Vibrio phage 1.028.O._10N.286.45.B6, partial genome) position: , mismatch: 7, identity: 0.774

aaaacacgctggcgcgtgtcggtgtcgccgt	CRISPR spacer
actatgctctggcgcgtttcagtgtcgccgt	Protospacer
*  *..* ********* **.**********

4. spacer 2.1|3494503|31|NZ_CP011662|CRISPRCasFinder matches to MG592527 (Vibrio phage 1.159.O._10N.261.46.F12, partial genome) position: , mismatch: 7, identity: 0.774

aaaacacgctggcgcgtgtcggtgtcgccgt	CRISPR spacer
actatgctctggcgcgtttcagtgtcgccgt	Protospacer
*  *..* ********* **.**********

5. spacer 2.1|3494503|31|NZ_CP011662|CRISPRCasFinder matches to MG592588 (Vibrio phage 1.217.O._10N.261.45.A1, partial genome) position: , mismatch: 7, identity: 0.774

aaaacacgctggcgcgtgtcggtgtcgccgt	CRISPR spacer
actatgctctggcgcgtttcagtgtcgccgt	Protospacer
*  *..* ********* **.**********

6. spacer 2.1|3494503|31|NZ_CP011662|CRISPRCasFinder matches to MG592589 (Vibrio phage 1.219.O._10N.261.45.E2, partial genome) position: , mismatch: 7, identity: 0.774

aaaacacgctggcgcgtgtcggtgtcgccgt	CRISPR spacer
actatgctctggcgcgtttcagtgtcgccgt	Protospacer
*  *..* ********* **.**********

7. spacer 2.1|3494503|31|NZ_CP011662|CRISPRCasFinder matches to MG592524 (Vibrio phage 1.156.O._10N.261.45.A6, partial genome) position: , mismatch: 7, identity: 0.774

aaaacacgctggcgcgtgtcggtgtcgccgt	CRISPR spacer
actatgctctggcgcgtttcagtgtcgccgt	Protospacer
*  *..* ********* **.**********

8. spacer 2.1|3494503|31|NZ_CP011662|CRISPRCasFinder matches to MG592669 (Vibrio phage 2.159.A._10N.261.46.F12, partial genome) position: , mismatch: 7, identity: 0.774

aaaacacgctggcgcgtgtcggtgtcgccgt	CRISPR spacer
actatgctctggcgcgtttcagtgtcgccgt	Protospacer
*  *..* ********* **.**********

9. spacer 2.1|3494503|31|NZ_CP011662|CRISPRCasFinder matches to MG592670 (Vibrio phage 2.159.B._10N.261.46.F12, partial genome) position: , mismatch: 7, identity: 0.774

aaaacacgctggcgcgtgtcggtgtcgccgt	CRISPR spacer
actatgctctggcgcgtttcagtgtcgccgt	Protospacer
*  *..* ********* **.**********

10. spacer 2.1|3494503|31|NZ_CP011662|CRISPRCasFinder matches to MG592507 (Vibrio phage 1.136.O._10N.261.45.E11, partial genome) position: , mismatch: 7, identity: 0.774

aaaacacgctggcgcgtgtcggtgtcgccgt	CRISPR spacer
actatgctctggcgcgtttcagtgtcgccgt	Protospacer
*  *..* ********* **.**********

11. spacer 2.1|3494503|31|NZ_CP011662|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

aaaacacg----ctggcgcgtgtcggtgtcgccgt	CRISPR spacer
----cccggcacctggcgcgtgacggtctcgccgt	Protospacer
    * **    ********** **** *******

12. spacer 2.1|3494503|31|NZ_CP011662|CRISPRCasFinder matches to NC_015184 (Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence) position: , mismatch: 8, identity: 0.742

aaaacacgctggcgcgtgtcggtgtcgccgt	CRISPR spacer
tgagatcgcgggcgagtgtcggtgtcgccgc	Protospacer
 .*.  *** **** ***************.

13. spacer 2.1|3494503|31|NZ_CP011662|CRISPRCasFinder matches to NZ_CP035511 (Haematobacter massiliensis strain OT1 plasmid pOT1-1, complete sequence) position: , mismatch: 8, identity: 0.742

aaaacacgctggcgcgtgtcggtgtcgccgt	CRISPR spacer
tagaactgctggcgcgtgtcggcatcgccga	Protospacer
 *.*  .***************..******

14. spacer 2.1|3494503|31|NZ_CP011662|CRISPRCasFinder matches to NZ_CP054620 (Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.71

aaaacacgctggcgcgtgtcggtgtcgccgt	CRISPR spacer
atcctgggctgccgcgtgtcgatgtcgccgg	Protospacer
*   .. **** *********.********

15. spacer 2.1|3494503|31|NZ_CP011662|CRISPRCasFinder matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 9, identity: 0.71

aaaacacgctggcgcgtgtcggtgtcgccgt	CRISPR spacer
atcctgggctgccgggtgtcggtgtcgccgg	Protospacer
*   .. **** ** ***************

16. spacer 2.1|3494503|31|NZ_CP011662|CRISPRCasFinder matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 10, identity: 0.677

aaaacacgctggcgcgtgtcggtgtcgccgt	CRISPR spacer
ctgcggcgctggcgcgggtcggagtcgcccc	Protospacer
  .  .********** ***** ****** .

17. spacer 1.1|2873711|58|NZ_CP011662|CRISPRCasFinder matches to NZ_LN868946 (Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384 plasmid 4, complete sequence) position: , mismatch: 12, identity: 0.793

gaaacgataaaaagccgggtggcggctacgccttacccggcctacatgttctacatat	CRISPR spacer
tcgcaaataaaaagccgggtggcggctacgccttacccggcctacatcgtctgcttga	Protospacer
  .  .*****************************************  ***.* *.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1035095 : 1077475

Erwinia_phage(38.1%)

portal,terminase,tail,head,integrase,lysis,plate,capsid,tRNA

attL 1029620:1029639|attR 1084493:1084512

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1029620:1029639	attL	NA	NA	NA	NA
WP_032618958.1\|1035095_1036655_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	9.6e-08	28.7
WP_017382401.1\|1036651_1037146_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_017692642.1\|1037291_1038056_+	siderophore-interacting protein	NA	NA	NA	NA
WP_017692643.1\|1038056_1039226_-	DNA repair ATPase	NA	NA	NA	NA
WP_032618959.1\|1039582_1040599_-\|integrase	tyrosine-type recombinase/integrase	A0A218M4I3	Erwinia_phage	8.6e-191	95.0
WP_080288393.1\|1040598_1041171_-	phage repressor protein CI	F1BUS8	Erwinia_phage	1.8e-76	74.1
WP_032618960.1\|1041295_1041559_+	hypothetical protein	A0A218M4I5	Erwinia_phage	5.0e-42	93.1
WP_032618962.1\|1041589_1042099_+	phage regulatory CII family protein	Q6K1F8	Salmonella_virus	8.6e-83	91.7
WP_071842907.1\|1042106_1042307_+	DUF2724 domain-containing protein	Q6K1F7	Salmonella_virus	1.3e-29	90.9
WP_032618963.1\|1042270_1042609_+	DUF5347 domain-containing protein	A0A218M4I7	Erwinia_phage	3.6e-53	92.9
WP_032618964.1\|1042675_1042903_+	DUF2732 domain-containing protein	A0A0M3UL87	Salmonella_phage	4.8e-17	70.1
WP_032618966.1\|1042902_1043124_+	TraR/DksA family transcriptional regulator	Q6K1F5	Salmonella_virus	1.1e-31	94.4
WP_032618967.1\|1043110_1045339_+	replication endonuclease	A0A218M4H2	Erwinia_phage	0.0e+00	89.6
WP_032665232.1\|1045461_1045659_+	hypothetical protein	A0A218M4I0	Erwinia_phage	1.5e-11	71.4
WP_032618969.1\|1045783_1046833_+	DNA cytosine methyltransferase	A0A0R6PG08	Moraxella_phage	5.7e-105	55.9
WP_032618970.1\|1046876_1048835_-	histidine kinase-, DNA gyrase B-, and HSP90-like ATPase	NA	NA	NA	NA
WP_047715938.1\|1049261_1050287_-\|portal	phage portal protein	Q6K1J0	Salmonella_virus	7.9e-168	82.7
WP_032618972.1\|1050288_1052058_-\|terminase	terminase ATPase subunit family protein	A0A218M4M1	Erwinia_phage	6.1e-301	85.2
WP_032618973.1\|1052223_1053078_+\|capsid	GPO family capsid scaffolding protein	S4TP53	Salmonella_phage	1.9e-114	73.6
WP_047715936.1\|1053133_1054189_+\|capsid	phage major capsid protein, P2 family	A0A0M4R4W2	Salmonella_phage	3.8e-165	82.8
WP_032618975.1\|1054192_1054948_+\|terminase	terminase endonuclease subunit	Q6K1I5	Salmonella_virus	9.8e-75	64.5
WP_023295250.1\|1055047_1055554_+\|head	head completion/stabilization protein	O80306	Escherichia_phage	4.4e-63	72.0
WP_017382979.1\|1055553_1055757_+\|tail	tail protein	Q858W3	Yersinia_virus	3.3e-25	79.1
WP_032618977.1\|1055747_1055969_+	hypothetical protein	A0A218M4L5	Erwinia_phage	7.1e-26	74.0
WP_023295248.1\|1055952_1056465_+	lysozyme	A0A218M4K3	Erwinia_phage	1.0e-83	89.4
WP_032618978.1\|1056461_1056893_+	hypothetical protein	A0A218M4L6	Erwinia_phage	2.8e-58	78.3
WP_032618979.1\|1056892_1057309_+\|lysis	LysB family phage lysis regulatory protein	A0A218M4K2	Erwinia_phage	2.1e-42	67.2
WP_032618981.1\|1057404_1057872_+\|tail	phage tail protein	A0A218M4K6	Erwinia_phage	2.3e-58	68.4
WP_032618983.1\|1057864_1058314_+	phage virion morphogenesis protein	O80313	Escherichia_phage	4.7e-48	65.8
WP_032618984.1\|1058382_1059018_+\|plate	phage baseplate assembly protein V	A0A2I8TV69	Erwinia_phage	8.2e-99	86.7
WP_032618985.1\|1059014_1059365_+\|plate	baseplate assembly protein	A0A0M4RE59	Salmonella_phage	6.2e-40	71.6
WP_032618987.1\|1059370_1060279_+\|plate	baseplate assembly protein	A0A0F7LCQ9	Escherichia_phage	3.0e-134	83.1
WP_032620226.1\|1060271_1060802_+\|tail	phage tail protein I	Q37841	Escherichia_phage	2.4e-91	87.5
WP_044489085.1\|1060813_1063162_+\|tail	tail fiber protein	A0A0F7LDR4	Escherichia_phage	3.0e-114	49.2
WP_032618988.1\|1063163_1063595_+\|tail	tail fiber assembly protein	B6SCW7	Bacteriophage	7.0e-17	41.1
WP_023323582.1\|1063969_1065163_+\|tail	phage tail sheath protein	A0A0F7LBW9	Escherichia_phage	2.4e-184	81.1
WP_017382996.1\|1065175_1065694_+\|tail	phage major tail tube protein	A0A218M4J0	Erwinia_phage	2.9e-78	81.4
WP_032618991.1\|1065751_1066075_+\|tail	phage tail assembly protein	A0A0F7LDQ8	Escherichia_phage	2.3e-25	66.3
WP_032665230.1\|1066107_1066230_+\|tail	GpE family phage tail protein	O80316	Escherichia_phage	7.7e-14	87.2
WP_032618993.1\|1066219_1068670_+\|tail	phage tail tape measure protein	Q858U7	Yersinia_virus	9.3e-308	74.1
WP_032618994.1\|1068680_1069145_+\|tail	phage tail protein	A0A218M4I2	Erwinia_phage	2.1e-59	70.8
WP_032618995.1\|1069141_1070311_+	phage late control D family protein	Q6K1G4	Salmonella_virus	2.5e-170	77.5
WP_063132245.1\|1070376_1070595_+	DNA-binding transcriptional regulator	A0A2I8TV89	Erwinia_phage	5.4e-34	86.1
WP_032618996.1\|1070617_1071265_-	hypothetical protein	NA	NA	NA	NA
WP_017384024.1\|1071544_1072051_+	G/U mismatch-specific DNA glycosylase	NA	NA	NA	NA
WP_015571912.1\|1072151_1073996_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	8.4e-35	33.7
WP_032618997.1\|1074148_1075894_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.4e-76	39.0
WP_001144069.1\|1076009_1076225_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_015571911.1\|1076461_1077475_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.4e-108	58.9
1084493:1084512	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1135413 : 1171921

Stx2-converting_phage(20.0%)

transposase,integrase

attL 1124405:1124419|attR 1137357:1137371

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1124405:1124419	attL	NA	NA	NA	NA
WP_007897923.1\|1135413_1136661_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_007897920.1\|1136647_1138414_+	hypothetical protein	NA	NA	NA	NA
1137357:1137371	attR	NA	NA	NA	NA
WP_017384059.1\|1138401_1140519_+	hypothetical protein	NA	NA	NA	NA
WP_017384060.1\|1140522_1140951_+	hypothetical protein	NA	NA	NA	NA
WP_085949497.1\|1141041_1142188_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.3e-147	92.6
WP_000019450.1\|1142472_1143453_+\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	1.8e-185	99.1
WP_017384068.1\|1143723_1144857_+	alcohol dehydrogenase catalytic domain-containing protein	NA	NA	NA	NA
WP_003846919.1\|1145711_1145882_-	hypothetical protein	NA	NA	NA	NA
WP_003846917.1\|1145938_1147192_-	lactose permease	NA	NA	NA	NA
WP_007894989.1\|1147243_1150318_-	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	96.8
WP_007851507.1\|1150439_1151522_-	DNA-binding transcriptional repressor LacI	C6ZCU4	Enterobacteria_phage	6.5e-189	98.1
WP_032435706.1\|1151891_1152884_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_000427614.1\|1153287_1154292_+\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA
WP_007898884.1\|1154553_1154832_+	EAL domain-containing protein	NA	NA	NA	NA
WP_007898888.1\|1155162_1155456_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	4.7e-49	95.9
WP_004152282.1\|1155554_1156322_-	Fe(3+) dicitrate ABC transporter ATP-binding protein FecE	G3M9Y6	Bacillus_virus	9.8e-14	25.2
WP_004118246.1\|1156322_1157279_-	Fe(3+) dicitrate ABC transporter permease subunit FecD	A0A2H4IY97	uncultured_Caudovirales_phage	5.3e-17	26.1
WP_004118243.1\|1157275_1158274_-	iron-dicitrate ABC transporter permease FecC	NA	NA	NA	NA
WP_007898890.1\|1158270_1159173_-	Fe(3+) dicitrate ABC transporter substrate-binding protein FecB	NA	NA	NA	NA
WP_022652364.1\|1159217_1161542_-	Fe(3+) dicitrate transport protein FecA	NA	NA	NA	NA
WP_023304425.1\|1161628_1162582_-	fec operon regulator FecR	NA	NA	NA	NA
WP_016151347.1\|1162578_1163100_-	RNA polymerase sigma factor FecI	NA	NA	NA	NA
WP_007896426.1\|1164343_1165669_-	pyridine nucleotide-disulfide oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	6.5e-114	48.1
WP_022649395.1\|1165822_1166791_+\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	6.9e-182	96.9
WP_016151369.1\|1168954_1169305_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	9.6e-41	65.5
WP_000227969.1\|1170844_1171921_+\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

1550333 : 1581789

Salmonella_phage(16.67%)

transposase,protease,integrase

attL 1547425:1547444|attR 1587678:1587697

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1547425:1547444	attL	NA	NA	NA	NA
WP_080288382.1\|1550333_1551302_+\|transposase	IS5-like element IS903B family transposase	A0A1B0VFY5	Salmonella_phage	5.1e-185	99.1
WP_032619181.1\|1551366_1553964_+	BREX-1 system phosphatase PglZ type A	NA	NA	NA	NA
WP_032619182.1\|1553974_1556044_+\|protease	protease Lon-related BREX system protein BrxL	NA	NA	NA	NA
WP_071842894.1\|1556158_1556785_-	inovirus Gp2 family protein	NA	NA	NA	NA
WP_001618770.1\|1556915_1558331_-	DUF3987 domain-containing protein	NA	NA	NA	NA
WP_001618769.1\|1558457_1558670_-	AlpA family transcriptional regulator	A0A1V0E8E5	Vibrio_phage	4.2e-07	43.3
WP_001618768.1\|1558795_1559674_+	hypothetical protein	NA	NA	NA	NA
WP_085949497.1\|1560124_1561272_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.3e-147	92.6
WP_001067212.1\|1562705_1563551_+	hypothetical protein	NA	NA	NA	NA
WP_000795663.1\|1563831_1564038_+	AlpA family transcriptional regulator	A0A0R6PGY4	Moraxella_phage	8.5e-05	41.1
WP_032619186.1\|1564653_1565856_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_032619187.1\|1565848_1567153_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_032619190.1\|1567149_1569024_+	DNA-binding protein	NA	NA	NA	NA
WP_001625709.1\|1569038_1569425_+	hypothetical protein	NA	NA	NA	NA
WP_032619191.1\|1569521_1569947_+	hypothetical protein	NA	NA	NA	NA
WP_032619193.1\|1569983_1570298_-	hypothetical protein	NA	NA	NA	NA
WP_032619194.1\|1570317_1570704_-	hypothetical protein	NA	NA	NA	NA
WP_032619196.1\|1571234_1572425_-	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_032620260.1\|1572393_1572771_-	hypothetical protein	NA	NA	NA	NA
WP_032619198.1\|1572947_1574309_-	hypothetical protein	NA	NA	NA	NA
WP_047685188.1\|1575036_1575243_-	hypothetical protein	NA	NA	NA	NA
WP_128302277.1\|1575246_1576149_-	hypothetical protein	NA	NA	NA	NA
WP_050019407.1\|1576470_1578606_+	AAA family ATPase	NA	NA	NA	NA
WP_080288391.1\|1578639_1580361_+	ATP-dependent helicase	A0A1P8CWU5	Bacillus_phage	9.6e-17	22.9
WP_032619204.1\|1580517_1581789_-\|integrase	tyrosine-type recombinase/integrase	A0A1B5FPC6	Escherichia_phage	1.4e-214	90.5
1587678:1587697	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1628973 : 1653463

Enterobacteria_phage(36.84%)

transposase,integrase

attL 1617302:1617317|attR 1644068:1644083

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1617302:1617317	attL	NA	NA	NA	NA
WP_006176728.1\|1628973_1629549_+	RNA polymerase sigma factor RpoE	A0A0F6TH34	Sinorhizobium_phage	8.2e-05	28.1
WP_015572138.1\|1629580_1630231_+	anti-sigma-E factor RseA	NA	NA	NA	NA
WP_023304255.1\|1630230_1631184_+	sigma-E factor regulatory protein RseB	NA	NA	NA	NA
WP_006811609.1\|1631180_1631657_+	SoxR-reducing system protein RseC	NA	NA	NA	NA
WP_006811608.1\|1632088_1633318_+\|integrase	site-specific integrase	H6WRW7	Salmonella_phage	9.9e-242	98.8
WP_022651668.1\|1633295_1633580_-	excisionase Xis	H6WRW8	Salmonella_phage	4.3e-39	83.0
WP_017692869.1\|1633626_1633869_-	DUF4060 family protein	K7PHF4	Enterobacteria_phage	7.8e-34	93.6
WP_032619244.1\|1633855_1634467_-	hypothetical protein	A0A077SLQ8	Escherichia_phage	1.8e-42	50.0
WP_022651666.1\|1634501_1635587_-	recombinase RecT	K7PKR8	Enterobacteria_phage	9.1e-106	53.5
WP_032619246.1\|1635596_1638656_-	exodeoxyribonuclease	K7PJT5	Enterobacteria_phage	0.0e+00	67.5
WP_022651664.1\|1638778_1639066_-	hypothetical protein	H6WRX2	Salmonella_phage	5.4e-34	67.4
WP_022651662.1\|1639317_1639503_-	YebW family protein	NA	NA	NA	NA
WP_032619247.1\|1639622_1639808_-	hypothetical protein	NA	NA	NA	NA
WP_017693529.1\|1639999_1640413_-	helix-turn-helix domain-containing protein	A0A1B5FPF4	Escherichia_phage	8.2e-07	42.4
WP_032619249.1\|1640766_1641309_+	hypothetical protein	M9NZI6	Enterobacteria_phage	4.3e-48	55.6
WP_032619250.1\|1641744_1642737_+	replication protein	A5VW95	Enterobacteria_phage	1.4e-49	75.0
WP_032619251.1\|1642720_1643413_+	phage replication protein P	G8C7U6	Escherichia_phage	2.4e-80	60.9
WP_032619252.1\|1643424_1644156_+	DUF1627 domain-containing protein	NA	NA	NA	NA
1644068:1644083	attR	NA	NA	NA	NA
WP_032619253.1\|1644142_1644403_+	DUF977 family protein	H6WRX9	Salmonella_phage	7.9e-24	62.5
WP_032619254.1\|1644399_1644879_+	hypothetical protein	NA	NA	NA	NA
WP_032619256.1\|1644880_1645138_+	hypothetical protein	NA	NA	NA	NA
WP_044489041.1\|1645134_1647210_+	DNA methyltransferase	H9C171	Pectobacterium_phage	1.6e-199	52.6
WP_032619258.1\|1647257_1648016_-	hypothetical protein	NA	NA	NA	NA
WP_032619259.1\|1648279_1648513_+	DinI family protein	K7PM44	Enterobacteria_phage	1.2e-28	79.2
WP_032619262.1\|1648919_1649519_+	DUF1367 family protein	H6WRY7	Salmonella_phage	2.9e-98	87.3
WP_155858305.1\|1649727_1649880_+	hypothetical protein	K7P7Q1	Enterobacteria_phage	4.4e-19	100.0
WP_085949497.1\|1649881_1651029_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.3e-147	92.6
WP_003860714.1\|1651657_1653463_+	elongation factor 4	E4ZFJ7	Streptococcus_phage	1.1e-23	25.9

DBSCAN-SWA_5

2117210 : 2128023

Hokovirus(12.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032619353.1\|2117210_2118629_+	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	8.9e-61	32.1
WP_032619354.1\|2118738_2120109_+	phosphomannomutase CpsG	A0A127AWJ1	Bacillus_phage	2.0e-33	27.7
WP_032619355.1\|2120274_2121681_+	NADP-dependent phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	4.7e-38	28.5
WP_032619357.1\|2121770_2122856_+	dTDP-glucose 4,6-dehydratase	A0A291LAD7	Escherichia_phage	8.2e-99	52.6
WP_017693099.1\|2122856_2123738_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	9.0e-104	62.7
WP_032619358.1\|2123976_2125143_+	UDP-glucose 6-dehydrogenase	A0A1J0FA55	Only_Syngen_Nebraska_virus	7.0e-112	54.0
WP_032619359.1\|2125192_2126197_-	NAD-dependent epimerase	A0A2K9L0I7	Tupanvirus	1.9e-33	29.0
WP_032619360.1\|2126391_2127372_+	LPS O-antigen chain length determinant protein WzzB	NA	NA	NA	NA
WP_017693103.1\|2127411_2128023_-	bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE	A0A2H4UVM0	Bodo_saltans_virus	1.6e-14	29.3

DBSCAN-SWA_6

2227910 : 2307956

Enterobacteria_phage(14.29%)

terminase,portal,tail,protease,holin,integrase,plate,coat

attL 2221626:2221641|attR 2240850:2240865

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2221626:2221641	attL	NA	NA	NA	NA
WP_032619465.1\|2227910_2228924_-\|integrase	tyrosine-type recombinase/integrase	H9C152	Pectobacterium_phage	5.6e-134	69.0
WP_032619466.1\|2228923_2229145_-	DUF4224 domain-containing protein	H9C153	Pectobacterium_phage	1.8e-08	42.9
WP_032619467.1\|2229204_2229447_-	DUF4060 family protein	M9P0E0	Enterobacteria_phage	4.2e-11	50.0
WP_032619468.1\|2229433_2231338_-	hypothetical protein	K7P6V4	Enterobacteria_phage	7.3e-18	29.8
WP_032619469.1\|2231560_2231833_-	hypothetical protein	K7P7B3	Enterobacteria_phage	2.7e-14	44.2
WP_155858306.1\|2232219_2232390_-	hypothetical protein	A0A1I9SEJ3	Klebsiella_phage	4.7e-09	50.9
WP_032619471.1\|2232675_2233167_-	helix-turn-helix domain-containing protein	A0A0R6PH50	Moraxella_phage	1.4e-16	55.0
WP_032619472.1\|2233239_2233509_+	hypothetical protein	H6WRX5	Salmonella_phage	2.2e-08	38.7
WP_032620290.1\|2233508_2233961_+	hypothetical protein	NA	NA	NA	NA
WP_032619473.1\|2233983_2234901_+	hypothetical protein	U5P0A0	Shigella_phage	2.4e-51	40.0
WP_032619474.1\|2234903_2235644_+	ATP-binding protein	S4TNF5	Salmonella_phage	1.1e-99	72.3
WP_032619475.1\|2235661_2236318_+	DUF1627 domain-containing protein	A0A088CE47	Shigella_phage	3.2e-13	26.9
WP_032619476.1\|2236513_2236747_+	hypothetical protein	S4TVX5	Salmonella_phage	2.8e-12	46.2
WP_032620293.1\|2237277_2237631_+	DUF550 domain-containing protein	K7PGV7	Enterobacterial_phage	5.4e-52	92.5
WP_032619477.1\|2237816_2238140_+	hypothetical protein	K7PGV5	Enterobacterial_phage	7.0e-30	60.8
WP_032619479.1\|2238625_2238922_+	DUF968 domain-containing protein	Q6V7S4	Burkholderia_virus	2.6e-23	59.1
WP_032619481.1\|2240730_2241087_+	RusA family crossover junction endodeoxyribonuclease	K7P6W0	Enterobacteria_phage	9.1e-39	59.3
2240850:2240865	attR	NA	NA	NA	NA
WP_032619482.1\|2241083_2241689_+	hypothetical protein	H9C175	Pectobacterium_phage	1.2e-75	67.3
WP_032619483.1\|2242027_2242432_+	exported phage-related protein	NA	NA	NA	NA
WP_044489029.1\|2242428_2242725_+\|holin	phage holin family protein	G8C7V9	Escherichia_phage	5.5e-05	33.8
WP_032619484.1\|2242721_2243351_+	glycoside hydrolase family 19 protein	G8C7W0	Escherichia_phage	5.1e-101	86.6
WP_032620296.1\|2243358_2243634_+	hypothetical protein	G8C7W1	Escherichia_phage	1.6e-22	65.9
WP_032619486.1\|2243759_2244017_+	hypothetical protein	Q8W634	Enterobacteria_phage	1.6e-16	53.3
WP_020690713.1\|2244165_2244369_+	hypothetical protein	A0A1W6JPG4	Morganella_phage	1.6e-11	52.9
WP_032619487.1\|2244441_2244669_+	hypothetical protein	A0A1L6Z528	Klebsiella_phage	2.1e-17	71.7
WP_032619488.1\|2244857_2245118_-	hypothetical protein	NA	NA	NA	NA
WP_032619489.1\|2245393_2245897_+	DUF1441 family protein	K7PJY2	Enterobacterial_phage	5.2e-48	62.3
WP_032619490.1\|2245900_2248021_+\|terminase	phage terminase large subunit family protein	A5LH27	Enterobacteria_phage	9.2e-304	74.7
WP_023299859.1\|2248017_2248233_+	hypothetical protein	NA	NA	NA	NA
WP_032619491.1\|2248241_2249762_+\|portal	phage portal protein	K7PHM5	Enterobacterial_phage	1.3e-153	55.4
WP_103848174.1\|2249754_2251812_+\|protease	Clp protease ClpP	S5M7Q8	Escherichia_phage	4.6e-199	53.2
WP_032619492.1\|2251880_2252216_+	DUF2190 family protein	NA	NA	NA	NA
WP_023303463.1\|2252215_2252572_+	hypothetical protein	NA	NA	NA	NA
WP_023299864.1\|2252573_2253236_+	hypothetical protein	R9TR34	Vibrio_phage	1.9e-21	36.7
WP_023303465.1\|2253244_2253799_+	hypothetical protein	NA	NA	NA	NA
WP_032619493.1\|2253791_2254415_+\|plate	phage baseplate assembly protein V	Q8HAB9	Salmonella_phage	7.2e-07	30.8
WP_032619495.1\|2254453_2255923_+\|tail	tail protein	R9TMQ0	Vibrio_phage	1.1e-77	47.1
WP_032619497.1\|2255919_2256426_+\|tail	tail protein	NA	NA	NA	NA
WP_032619498.1\|2256477_2256765_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_032619500.1\|2259008_2259479_+\|tail	phage tail protein	D4HTW5	Vibrio_phage	3.8e-16	33.8
WP_032620301.1\|2259453_2259669_+\|tail	tail protein	R9TR63	Vibrio_phage	1.8e-13	52.9
WP_032619501.1\|2259671_2260790_+	late control protein D	R9TNM7	Vibrio_phage	7.8e-36	32.6
WP_032619502.1\|2260826_2261180_+\|plate	baseplate assembly protein	E5FFH4	Burkholderia_phage	8.5e-21	50.0
WP_032619503.1\|2261163_2262078_+\|plate	baseplate assembly protein	V5YTH6	Pseudomonas_phage	1.6e-58	45.3
WP_032619504.1\|2262070_2262622_+\|tail	phage tail protein I	A0A0F7LDF3	Escherichia_phage	4.3e-27	41.0
WP_050019395.1\|2262624_2264802_+	hypothetical protein	A0A0M3ULF6	Salmonella_phage	3.9e-55	38.9
WP_032619505.1\|2264801_2265380_+\|tail	tail fiber assembly protein	E5G6P1	Salmonella_phage	5.2e-52	54.9
WP_032619506.1\|2265456_2266527_+	glycosyltransferase family 9 protein	NA	NA	NA	NA
WP_032619507.1\|2266567_2266972_-	type II toxin-antitoxin system HicB family antitoxin	Q775F5	Haemophilus_virus	3.1e-35	49.2
WP_004157630.1\|2266993_2267149_-	type II toxin-antitoxin system HicA family toxin	A0A0D4DC32	Acinetobacter_phage	1.2e-16	78.4
WP_032619509.1\|2267456_2268731_+	ATP-binding protein	NA	NA	NA	NA
WP_032619510.1\|2268727_2269261_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_017384434.1\|2270920_2271244_+	hypothetical protein	NA	NA	NA	NA
WP_032619511.1\|2271273_2272200_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_017384432.1\|2272205_2272676_-	hypothetical protein	NA	NA	NA	NA
WP_032619512.1\|2272841_2273558_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-11	25.5
WP_015570244.1\|2273554_2274430_-	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
WP_023303913.1\|2274426_2275701_-	high-affinity branched-chain amino acid ABC transporter permease LivM	NA	NA	NA	NA
WP_003859667.1\|2275712_2276627_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_003859669.1\|2276695_2277817_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003859671.1\|2278228_2278897_+	YecA family protein	NA	NA	NA	NA
WP_032620305.1\|2279213_2280425_-	tyrosine transporter TyrP	NA	NA	NA	NA
WP_003859673.1\|2280616_2280853_+	YecH family protein	NA	NA	NA	NA
WP_003859676.1\|2280889_2281387_-	non-heme ferritin	NA	NA	NA	NA
WP_015570249.1\|2281587_2281926_-	hypothetical protein	NA	NA	NA	NA
WP_003859680.1\|2282171_2282810_+	RpiB/LacA/LacB family sugar-phosphate isomerase	NA	NA	NA	NA
WP_017384426.1\|2282852_2284271_-	MFS transporter	NA	NA	NA	NA
WP_003859682.1\|2284485_2284569_+	stress response protein AzuC	NA	NA	NA	NA
WP_003859683.1\|2284675_2284927_+	DUF2766 domain-containing protein	NA	NA	NA	NA
WP_017693227.1\|2285007_2286351_-	anaerobic C4-dicarboxylate transporter	NA	NA	NA	NA
WP_032619513.1\|2286492_2286996_-	non-heme ferritin-like protein	NA	NA	NA	NA
WP_017384423.1\|2287499_2288057_+	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_017384422.1\|2288374_2289364_+	arabinose ABC transporter substrate-binding protein AraF	NA	NA	NA	NA
WP_032619514.1\|2289435_2290950_+	L-arabinose ABC transporter ATP-binding protein AraG	A0A285PWH2	Cedratvirus	6.9e-11	28.2
WP_003859689.1\|2290964_2291945_+	arabinose ABC transporter permease AraH	NA	NA	NA	NA
WP_023303910.1\|2292098_2292902_+	trehalose-phosphatase	NA	NA	NA	NA
WP_015570257.1\|2292876_2294301_+	alpha,alpha-trehalose-phosphate synthase	NA	NA	NA	NA
WP_017384418.1\|2294316_2294745_-	universal stress protein UspC	NA	NA	NA	NA
WP_006811111.1\|2295532_2295892_+	flagellar transcriptional regulator FlhD	NA	NA	NA	NA
WP_003859695.1\|2295894_2296473_+	flagellar transcriptional regulator FlhC	NA	NA	NA	NA
WP_003859696.1\|2296596_2297484_+	flagellar motor stator protein MotA	NA	NA	NA	NA
WP_017693230.1\|2297480_2298410_+	flagellar motor protein MotB	NA	NA	NA	NA
WP_017384416.1\|2298414_2300424_+	chemotaxis protein CheA	NA	NA	NA	NA
WP_003859699.1\|2300443_2300947_+	chemotaxis protein CheW	NA	NA	NA	NA
WP_023303909.1\|2301043_2302303_-	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_023303908.1\|2302730_2303303_+	fimbrial major subunit CsuA/B family protein	NA	NA	NA	NA
WP_015570265.1\|2303310_2303859_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_032619515.1\|2303875_2304637_+	molecular chaperone	NA	NA	NA	NA
WP_023303905.1\|2304612_2306997_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_017384412.1\|2306993_2307956_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA

DBSCAN-SWA_7

3194129 : 3252671

Enterobacterial_phage(33.33%)

tail,portal,terminase,protease,head,holin,integrase,capsid,tRNA

attL 3214246:3214261|attR 3249898:3249913

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032619843.1\|3194129_3195413_+	YeaH/YhbH family protein	A0A140HLI1	Bacillus_phage	2.5e-09	28.3
WP_022650865.1\|3195673_3195994_-	hypothetical protein	K7PGV5	Enterobacterial_phage	1.0e-25	53.8
WP_154232874.1\|3195981_3196221_+	hypothetical protein	NA	NA	NA	NA
WP_032636446.1\|3196315_3197629_-	hypothetical protein	K7PH95	Enterobacterial_phage	2.7e-112	52.6
WP_017382566.1\|3197687_3197921_-	hypothetical protein	E4WL42	Enterobacteria_phage	3.9e-30	78.9
WP_032619848.1\|3198028_3198700_-	hypothetical protein	A0A2P0WA07	Enterobacter_phage	9.9e-87	72.6
WP_022651029.1\|3198700_3199015_-	hypothetical protein	A0A2P0WA17	Enterobacter_phage	1.5e-32	64.7
WP_032619850.1\|3199058_3202904_-	DUF1983 domain-containing protein	Q9MCU0	Escherichia_phage	0.0e+00	62.7
WP_032619853.1\|3202956_3203544_-\|tail	tail assembly protein	A0A1P8DTG7	Proteus_phage	3.6e-48	47.4
WP_022648880.1\|3203543_3204254_-	C40 family peptidase	F1C573	Cronobacter_phage	1.5e-96	69.8
WP_032619855.1\|3204256_3205015_-\|tail	phage minor tail protein L	A0A1W6JNX9	Morganella_phage	3.9e-95	63.2
WP_022648882.1\|3205011_3205350_-\|tail	phage tail protein	K7PKL8	Enterobacterial_phage	7.3e-38	59.8
WP_032620356.1\|3205352_3208655_-\|tail	phage tail tape measure protein	K7P7L6	Enterobacteria_phage	0.0e+00	84.9
WP_032619857.1\|3208712_3209054_-	hypothetical protein	NA	NA	NA	NA
WP_032619858.1\|3209109_3209388_-	DUF4035 domain-containing protein	Q9MCS5	Enterobacteria_phage	1.8e-42	95.7
WP_001549114.1\|3209396_3209780_-\|tail	phage tail protein	K7PKV6	Enterobacterial_phage	4.4e-63	93.7
WP_006809155.1\|3209788_3210232_-	hypothetical protein	K7PHL2	Enterobacterial_phage	4.6e-72	93.8
WP_022648886.1\|3210291_3210639_-	DUF3168 domain-containing protein	Q9MCS8	Enterobacteria_phage	3.8e-58	99.1
WP_022648888.1\|3211081_3211420_-\|head	phage head closure protein	A0A2H4JHK5	uncultured_Caudovirales_phage	6.0e-40	73.2
WP_032619860.1\|3211428_3211755_-\|head,tail	phage gp6-like head-tail connector protein	K7PKT4	Enterobacteria_phage	3.4e-48	82.4
WP_023296252.1\|3211798_3213010_-\|capsid	phage major capsid protein	K7PM57	Enterobacteria_phage	9.5e-197	87.9
WP_032619863.1\|3213019_3213868_-\|protease	Clp protease ClpP	K7PH05	Enterobacteria_phage	9.2e-138	91.8
WP_032619865.1\|3213881_3215186_-\|portal	phage portal protein	K7PJU5	Enterobacteria_phage	1.6e-234	93.5
3214246:3214261	attL	NA	NA	NA	NA
WP_032619866.1\|3215185_3216943_-\|terminase	terminase large subunit	K7PKT2	Enterobacteria_phage	0.0e+00	96.6
WP_032619868.1\|3216942_3217416_-\|terminase	phage terminase small subunit P27 family	K7PHI2	Enterobacteria_phage	2.9e-85	98.1
WP_032619870.1\|3217573_3217924_-	HNH endonuclease	K7PHK9	Enterobacteria_phage	1.2e-51	81.9
WP_032619873.1\|3217923_3218514_-	hypothetical protein	K7PGW6	Enterobacterial_phage	9.3e-89	77.6
WP_032619877.1\|3218495_3219953_-	glycosyl transferase	K7PKP3	Enterobacterial_phage	2.0e-278	93.2
WP_032619880.1\|3220039_3220300_+	hypothetical protein	A0A089FW14	Salmonella_phage	2.5e-09	40.2
WP_047715785.1\|3220548_3220743_-	hypothetical protein	K7PM01	Enterobacterial_phage	1.3e-18	95.5
WP_032619884.1\|3220693_3220969_-	hypothetical protein	K7PGW4	Enterobacterial_phage	9.3e-07	96.0
WP_032619887.1\|3220965_3221508_-	glycoside hydrolase family 108 protein	A0A0U2I1S0	Escherichia_phage	2.3e-78	73.2
WP_000220248.1\|3221504_3221786_-\|holin	phage holin family protein	Q9MBZ4	Enterobacteria_phage	3.0e-05	35.9
WP_032264642.1\|3221782_3222187_-	exported phage-related protein	NA	NA	NA	NA
WP_032619892.1\|3222414_3223218_+	hypothetical protein	NA	NA	NA	NA
WP_032619895.1\|3223254_3223617_-	DUF1133 family protein	K7PGW2	Enterobacterial_phage	3.4e-57	90.8
WP_032619897.1\|3223631_3224621_-	DUF968 domain-containing protein	K7PJS6	Enterobacterial_phage	4.2e-182	92.1
WP_050595702.1\|3224617_3225343_-	antirepressor	G0ZND1	Cronobacter_phage	1.1e-54	52.7
WP_032619898.1\|3225358_3225748_-	RusA family crossover junction endodeoxyribonuclease	K7PKN5	Enterobacterial_phage	2.9e-62	88.9
WP_032619899.1\|3225744_3226068_-	LexA family transcriptional regulator	K7PHB4	Enterobacterial_phage	4.1e-46	90.4
WP_032619900.1\|3226064_3226724_-	DNA methyltransferase	I6PDF5	Cronobacter_phage	2.3e-96	77.9
WP_032619901.1\|3226723_3227218_-	hypothetical protein	NA	NA	NA	NA
WP_032634002.1\|3227214_3228093_-	GntR family transcriptional regulator	U5P0A0	Shigella_phage	1.7e-38	81.4
WP_032619902.1\|3228082_3228262_-	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	3.3e-13	69.2
WP_023315870.1\|3228425_3228980_-	hypothetical protein	S5FXP0	Shigella_phage	1.6e-45	53.6
WP_071842884.1\|3229008_3229260_-	hypothetical protein	A0A2I6PIE5	Escherichia_phage	7.9e-13	49.3
WP_032619903.1\|3229294_3230047_+	helix-turn-helix transcriptional regulator	G8C7U1	Escherichia_phage	4.5e-80	70.1
WP_032619905.1\|3230094_3230529_+	hypothetical protein	NA	NA	NA	NA
WP_032620359.1\|3230628_3230838_+	hypothetical protein	C6ZR45	Salmonella_phage	6.6e-13	60.9
WP_032103842.1\|3230865_3231075_-	hypothetical protein	G8C7T7	Escherichia_phage	3.0e-18	75.0
WP_032620361.1\|3231794_3232208_+	hypothetical protein	K7PJS4	Enterobacterial_phage	5.2e-54	83.2
WP_032619906.1\|3232207_3233035_+	hypothetical protein	K7PKM7	Enterobacterial_phage	1.5e-121	85.6
WP_032620364.1\|3233632_3233977_+	DUF550 domain-containing protein	K7PGV7	Enterobacterial_phage	2.7e-40	74.3
WP_032619908.1\|3234056_3234326_+	hypothetical protein	K7PKM4	Enterobacterial_phage	1.5e-30	74.2
WP_022650818.1\|3234358_3234622_+	hypothetical protein	NA	NA	NA	NA
WP_032619909.1\|3234596_3235739_+\|integrase	tyrosine-type recombinase/integrase	O21929	Phage_21	1.4e-93	49.0
WP_015570783.1\|3235958_3236459_+\|tRNA	YbaK/prolyl-tRNA synthetase associated domain-containing protein	NA	NA	NA	NA
WP_015570785.1\|3236867_3238199_+	sugar (Glycoside-Pentoside-Hexuronide) transporter	NA	NA	NA	NA
WP_032619910.1\|3238214_3240251_+	glycoside hydrolase family 31 protein	NA	NA	NA	NA
WP_003857881.1\|3240357_3240804_+	DUF441 domain-containing protein	NA	NA	NA	NA
WP_017384695.1\|3240787_3241579_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_017384696.1\|3241678_3242866_+	CynX/NimT family MFS transporter	NA	NA	NA	NA
WP_032619911.1\|3242897_3243605_-	CTP synthase	NA	NA	NA	NA
WP_015570789.1\|3243756_3244101_+	DUF488 domain-containing protein	NA	NA	NA	NA
WP_015570790.1\|3244101_3244407_-	hypothetical protein	NA	NA	NA	NA
WP_015570791.1\|3244487_3244742_-	DUF333 domain-containing protein	NA	NA	NA	NA
WP_032619912.1\|3245053_3246082_+	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	2.5e-12	31.4
WP_015570793.1\|3246127_3246226_+	YoaK family small membrane protein	NA	NA	NA	NA
WP_015570794.1\|3246226_3246301_+	protein YoaJ	NA	NA	NA	NA
WP_003857896.1\|3246354_3246603_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_071524166.1\|3246972_3247065_+	stress response membrane protein YncL	NA	NA	NA	NA
WP_023296321.1\|3247189_3248689_+	cyclic diguanylate phosphodiesterase	NA	NA	NA	NA
WP_015570796.1\|3248693_3248939_-	YmjA family protein	NA	NA	NA	NA
WP_003857898.1\|3249014_3250265_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	7.9e-21	94.4
3249898:3249913	attR	NA	NA	NA	NA
WP_032619914.1\|3250382_3251045_+	23S rRNA pseudouridine(2457) synthase RluE	NA	NA	NA	NA
WP_032619915.1\|3251044_3251518_+	NUDIX hydrolase	NA	NA	NA	NA
WP_032103856.1\|3251558_3252671_+\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA

DBSCAN-SWA_8

4474455 : 4481960

Enterobacteria_phage(85.71%)

integrase

attL 4468630:4468643|attR 4486194:4486207

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4468630:4468643	attL	NA	NA	NA	NA
WP_032620857.1\|4474455_4474905_-	hypothetical protein	Q7M298	Enterobacteria_phage	9.7e-46	70.8
WP_032620855.1\|4474897_4475197_-	hypothetical protein	Q7M2A0	Enterobacteria_phage	1.2e-31	70.1
WP_032620854.1\|4475189_4475744_-	ash family protein	Q7M2A7	Enterobacteria_phage	1.5e-35	72.1
WP_026094409.1\|4475740_4476007_-	AlpA family transcriptional regulator	Q7M299	Enterobacteria_phage	4.4e-22	62.5
WP_032620852.1\|4476569_4477313_+	hypothetical protein	NA	NA	NA	NA
WP_023323621.1\|4477315_4477534_+	phage transcriptional activator	Q7M294	Enterobacteria_phage	1.0e-16	68.2
WP_017692853.1\|4477562_4478126_+	Polarity suppression protein	Q7M2A1	Enterobacteria_phage	6.0e-61	65.9
WP_032620851.1\|4478464_4479604_+	ATP-binding protein	NA	NA	NA	NA
WP_080288371.1\|4479600_4480662_+	DUF4435 domain-containing protein	NA	NA	NA	NA
WP_032620849.1\|4480697_4481960_-\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	8.2e-74	40.4
4486194:4486207	attR	NA	NA	NA	NA

DBSCAN-SWA_9

4745066 : 4789126

Enterobacteria_phage(28.26%)

tail,portal,terminase,protease,integrase,tRNA

attL 4739609:4739624|attR 4797525:4797540

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4739609:4739624	attL	NA	NA	NA	NA
WP_032620558.1\|4745066_4746104_-\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_032620560.1\|4746191_4747286_+\|integrase	site-specific integrase	S5MDN5	Escherichia_phage	1.4e-178	83.7
WP_032620563.1\|4747505_4747751_+	DinI-like family protein	Q687E4	Enterobacteria_phage	2.2e-20	63.8
WP_128754880.1\|4747734_4748001_+	hypothetical protein	NA	NA	NA	NA
WP_032620566.1\|4748108_4748660_-	recombinase family protein	K7PJT4	Enterobacteria_phage	2.7e-66	67.0
WP_103848176.1\|4749508_4750090_-\|tail	tail fiber domain-containing protein	A0A2I6PD03	Escherichia_phage	4.3e-46	53.3
WP_162269496.1\|4750382_4750610_+	hypothetical protein	E4WL44	Enterobacteria_phage	2.9e-30	89.3
WP_080288370.1\|4750805_4754783_-\|tail	phage tail protein	M9P0D8	Enterobacteria_phage	0.0e+00	89.5
WP_128754879.1\|4754799_4755279_-	hypothetical protein	M9NZH8	Enterobacteria_phage	7.9e-78	98.0
WP_032620570.1\|4755364_4755982_-\|tail	tail assembly protein	M9NZA3	Enterobacteria_phage	2.6e-105	99.0
WP_032620572.1\|4755974_4756694_-	C40 family peptidase	M9NZD8	Enterobacteria_phage	9.8e-141	97.9
WP_032620573.1\|4756696_4757434_-\|tail	phage minor tail protein L	M9NYX1	Enterobacteria_phage	6.1e-146	99.6
WP_032620574.1\|4757489_4757828_-\|tail	tail protein	E4WL34	Enterobacteria_phage	5.2e-60	99.1
WP_032620577.1\|4757824_4761085_-\|tail	phage tail tape measure protein	K7PMB9	Enterobacterial_phage	0.0e+00	97.7
WP_071842901.1\|4761068_4761383_-\|tail	phage tail assembly protein T	E4WL32	Enterobacteria_phage	9.8e-53	95.2
WP_032620580.1\|4761391_4761832_-\|tail	phage minor tail protein G	K7PJY4	Enterobacterial_phage	3.8e-71	93.8
WP_032620582.1\|4761842_4762586_-\|tail	phage tail protein	K7PKX6	Enterobacterial_phage	3.9e-132	98.4
WP_001704117.1\|4762595_4762997_-\|tail	tail protein	K7PHM6	Enterobacterial_phage	4.1e-72	100.0
WP_020884618.1\|4762993_4763572_-\|tail	phage tail protein	K7PMB7	Enterobacterial_phage	4.5e-96	99.0
WP_032620586.1\|4763581_4763857_-	DNA breaking-rejoining protein	K7PH55	Enterobacterial_phage	1.2e-38	97.5
WP_032620588.1\|4763849_4764176_-	DUF2190 family protein	K7PJY3	Enterobacterial_phage	2.5e-51	96.3
WP_158650950.1\|4764258_4766265_-\|protease	Clp protease ClpP	K7PKX4	Enterobacterial_phage	0.0e+00	98.8
WP_032620589.1\|4766209_4767709_-\|portal	phage portal protein	K7PHM5	Enterobacterial_phage	2.5e-287	99.4
WP_032620591.1\|4767705_4767921_-	hypothetical protein	K7PMB5	Enterobacterial_phage	9.4e-31	97.2
WP_032620593.1\|4767917_4770020_-\|terminase	phage terminase large subunit family protein	K7PH52	Enterobacterial_phage	0.0e+00	99.3
WP_020884621.1\|4770019_4770508_-	DUF1441 family protein	K7PJY2	Enterobacterial_phage	6.5e-80	98.1
WP_080288384.1\|4770692_4771370_-	DUF1983 domain-containing protein	G8C7Q4	Escherichia_phage	2.3e-35	54.9
WP_032620596.1\|4771726_4771951_-	hypothetical protein	A0A2H4J182	uncultured_Caudovirales_phage	1.1e-18	58.1
WP_032620598.1\|4771980_4772502_-	hypothetical protein	K7PHH7	Enterobacteria_phage	3.7e-73	83.5
WP_032620601.1\|4772498_4773035_-	lysozyme	K7PM52	Enterobacteria_phage	7.7e-90	89.0
WP_014832171.1\|4773034_4773337_-	hypothetical protein	O64361	Escherichia_phage	3.1e-32	67.3
WP_032620604.1\|4774299_4774905_-	hypothetical protein	H9C175	Pectobacterium_phage	7.6e-70	62.9
WP_032620605.1\|4774921_4775989_-	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	1.4e-106	53.4
WP_032620607.1\|4775985_4777917_-	DNA methyltransferase	H9C171	Pectobacterium_phage	5.6e-199	53.2
WP_047715965.1\|4777909_4779247_-	phage N-6-adenine-methyltransferase	Q8HA94	Salmonella_phage	6.3e-117	51.3
WP_047715957.1\|4779249_4780113_-	GntR family transcriptional regulator	A0A1C9IHW0	Salmonella_phage	1.8e-56	80.0
WP_047715956.1\|4780109_4780289_-	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	1.0e-06	55.1
WP_080344883.1\|4780290_4781004_-	phage regulatory protein/antirepressor Ant	A0A2I7RHG4	Vibrio_phage	3.0e-49	51.1
WP_032634277.1\|4781164_4781722_-	hypothetical protein	A0A1C9II13	Salmonella_phage	4.0e-65	67.0
WP_032634276.1\|4781765_4781966_-	transcriptional regulator	U5P445	Shigella_phage	3.5e-24	84.6
WP_032634275.1\|4782054_4782729_+	LexA family transcriptional regulator	U5P0T5	Shigella_phage	1.1e-114	85.2
WP_047715955.1\|4782897_4783098_+	hypothetical protein	NA	NA	NA	NA
WP_032665243.1\|4783069_4783324_-	hypothetical protein	NA	NA	NA	NA
WP_154232880.1\|4783322_4783478_+	hypothetical protein	NA	NA	NA	NA
WP_032620624.1\|4783836_4784208_+	hypothetical protein	Q8HAA1	Salmonella_phage	3.8e-56	89.4
WP_032620626.1\|4784263_4785094_+	YfdQ family protein	Q8HAA2	Salmonella_phage	4.0e-138	90.1
WP_032620628.1\|4785229_4785772_+	hypothetical protein	A0A192Y8M4	Salmonella_phage	3.5e-74	75.7
WP_032620630.1\|4785756_4785957_+	hypothetical protein	NA	NA	NA	NA
WP_032620631.1\|4785953_4786280_+	hypothetical protein	NA	NA	NA	NA
WP_032620632.1\|4786276_4787008_+	site-specific DNA-methyltransferase	A0A0H5BBV5	Pseudomonas_phage	1.0e-84	65.2
WP_032620633.1\|4787004_4787202_+	hypothetical protein	NA	NA	NA	NA
WP_032620634.1\|4787201_4787771_+	3'-5' exoribonuclease	K7PLW7	Enterobacteria_phage	7.6e-80	74.6
WP_032620635.1\|4787809_4788082_+	pyocin activator protein PrtN	S5MQM5	Escherichia_phage	9.1e-39	89.8
WP_032620638.1\|4788116_4788578_-	hypothetical protein	NA	NA	NA	NA
WP_044488948.1\|4788583_4789126_-	SocA family protein	A0A139ZPG5	Marinitoga_camini_virus	3.7e-07	29.5
4797525:4797540	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP011661

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 39742

Escherichia_phage(29.41%)

integrase,transposase

attL 18746:18762|attR 41303:41319

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023302476.1\|0_867_+	replication initiation protein	A0A222YYK1	Escherichia_phage	2.6e-23	31.1
WP_006797591.1\|1792_2998_+	ParA family protein	A0A077SL49	Escherichia_phage	1.2e-162	69.1
WP_023302473.1\|2997_3972_+	ParB/RepB/Spo0J family partition protein	Q38420	Escherichia_phage	1.1e-86	54.1
WP_023302472.1\|4053_5325_-	Y-family DNA polymerase	F1C5A5	Cronobacter_phage	6.4e-151	63.3
WP_006796638.1\|5324_5756_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	2.1e-29	53.3
WP_074144872.1\|6087_7056_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	2.1e-178	96.0
WP_032413487.1\|7117_7453_-	C2H2-type zinc finger protein	NA	NA	NA	NA
WP_017900922.1\|7625_7904_+	hypothetical protein	NA	NA	NA	NA
WP_020805503.1\|8166_9120_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	3.6e-74	56.5
WP_023302470.1\|9289_9910_-	recombinase family protein	A0A219Y912	Aeromonas_phage	7.7e-09	31.5
WP_074142348.1\|10748_11717_+\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	1.0e-172	92.2
WP_004152397.1\|14862_16182_+\|transposase	IS1182-like element ISKpn6 family transposase	Q9MBP7	Staphylococcus_prophage	1.9e-12	24.2
WP_004199234.1\|16431_17313_-	carbapenem-hydrolyzing class A beta-lactamase KPC-2	A0A1B0VBP7	Salmonella_phage	2.2e-73	52.2
WP_004152394.1\|17511_18291_-	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	2.5e-89	61.8
WP_004199214.1\|18287_19313_-\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	1.4e-87	50.3
18746:18762	attL	NA	NA	NA	NA
WP_004152392.1\|19419_22449_-\|transposase	IS3-like element Tn4401 family transposase	NA	NA	NA	NA
WP_004152391.1\|22558_24274_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_001235713.1\|25388_25946_+	recombinase family protein	Q1MVP4	Enterobacteria_phage	7.0e-94	100.0
WP_000027057.1\|26128_26989_+	class A broad-spectrum beta-lactamase TEM-1	Q1MVP3	Enterobacteria_phage	4.6e-161	100.0
WP_003032490.1\|27151_27541_+	hypothetical protein	NA	NA	NA	NA
WP_162493700.1\|28566_28776_-	hypothetical protein	NA	NA	NA	NA
WP_000427614.1\|29253_30258_-\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA
WP_003100847.1\|30336_30894_-	recombinase family protein	A0A0C4UR34	Shigella_phage	3.3e-59	63.2
WP_003100853.1\|30887_31259_-	hypothetical protein	NA	NA	NA	NA
WP_003100856.1\|31255_31756_-	hypothetical protein	NA	NA	NA	NA
WP_003100858.1\|31752_32079_-	hypothetical protein	NA	NA	NA	NA
WP_000215515.1\|32333_32690_-	cupin domain-containing protein	NA	NA	NA	NA
WP_001293886.1\|32679_33081_-	DUF86 domain-containing protein	NA	NA	NA	NA
WP_001247892.1\|33077_33368_-	nucleotidyltransferase	NA	NA	NA	NA
WP_000427614.1\|33811_34816_-\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA
WP_003100881.1\|34894_37861_-\|transposase	Tn3-like element ISPa38 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.2
WP_000935451.1\|38026_39742_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
41303:41319	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP011662

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP011661

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection