CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP015590	Bacillus cereus strain AR156 plasmid pAR10, complete sequence	0 crisprs	NA	0	0	0
NZ_CP015592	Bacillus cereus strain AR156 plasmid pAR460, complete sequence	1 crisprs	cas14j,Cas14u_CAS-V,csa3	0	1	1
NZ_CP015589	Bacillus cereus strain AR156 chromosome, complete genome	2 crisprs	cas3,csa3,DEDDh,WYL,DinG,cas14k,Cas14u_CAS-V	3	1	5
NZ_CP015591	Bacillus cereus strain AR156 plasmid pAR41, complete sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015592_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015592_1

171923-172008

Orphan

Consensus_repeat	Method
TGTAAATATTTTTAATTTATTGTAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015592_1

>merge|NZ_CP015592|1|171923-172008|CRISPRCasFinder
TGTAAATATTTTTAATTTATTGTAAATTTAACTCCCTTATATTAGCACAATGTTAAAAAAGTGTAAATATTATTAATTTATTGTAA

>NZ_CP015592|1|1|171923-172008|CRISPRCasFinder
TGTAAATATTTTTAATTTATTGTAA	ATTTAACTCCCTTATATTAGCACAATGTTAAAAAAG
TGTAAATATTATTAATTTATTGTAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015592.1\|WP_071680111.1\|162432_163605_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|274042
NZ_CP015592.1\|WP_071680113.1\|166550_167759_-\|ATP-grasp-domain-containing-protein	unknown	unknown	gnl\|CDD\|235010
NZ_CP015592.1\|WP_071679257.1\|180305_180602_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015592.1\|WP_071680123.1\|184637_186485_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376899
NZ_CP015592.1\|WP_000439057.1\|180604_180901_-\|DUF2089-family-protein	unknown	unknown	gnl\|CDD\|378280
NZ_CP015592.1\|WP_071680110.1\|158948_161222_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|173886
NZ_CP015592.1\|WP_071680121.1\|183060_183579_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP015592.1\|WP_071680120.1\|177869_179102_+\|cytochrome-P450	unknown	unknown	gnl\|CDD\|225035
NZ_CP015592.1\|WP_071680114.1\|167778_168996_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015592.1\|WP_071680115.1\|168995_169538_-\|class-IV-adenylate-cyclase	unknown	unknown	gnl\|CDD\|224354
NZ_CP015592.1\|WP_071680116.1\|169534_170563_-\|radical-SAM-protein	unknown	unknown	gnl\|CDD\|274251
NZ_CP015592.1\|WP_071680281.1\|173920_176128_-\|MMPL-family-transporter	unknown	unknown	gnl\|CDD\|225272
NZ_CP015592.1\|WP_071680117.1\|170625_171822_-\|ATP-grasp-domain-containing-protein	unknown	unknown	gnl\|CDD\|273950
NZ_CP015592.1\|WP_071680119.1\|177064_177646_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP015592.1\|WP_082250349.1\|176404_176989_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP015592.1\|WP_042514298.1\|186474_187236_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224059
NZ_CP015592.1\|WP_071680112.1\|164008_165010_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|378935
NZ_CP015592.1\|WP_071680122.1\|183716_184427_-\|conjugal-transfer-protein-TraX	unknown	unknown	gnl\|CDD\|368639
NZ_CP015592.1\|WP_082250347.1\|165620_166544_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340887
NZ_CP015592.1\|WP_082250346.1\|165258_165603_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|340887

Protein	Function_ID	Function_description	E-value
NZ_CP015592.1\|WP_071680111.1\|162432_163605_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|274042	TIGR02224, Tyrosine_recombinase_XerC, tyrosine recombinase XerC. The phage integrase family describes a number of recombinases with tyrosine active sites that transiently bind covalently to DNA. Many are associated with mobile DNA elements, including phage, transposons, and phase variation loci. This model represents XerC, one of two closely related chromosomal proteins along with XerD (TIGR02225). XerC and XerD are site-specific recombinases which help resolve chromosome dimers to monomers for cell division after DNA replication. In species with a large chromosome and homologs of XerC on other replicons, the chomosomal copy was preferred for building this model. This model does not detect all XerC, as some apparent XerC examples score in the gray zone between trusted (450) and noise (410) cutoffs, along with some XerD examples. XerC and XerD interact with cell division protein FtsK. [DNA metabolism, DNA replication, recombination, and repair].	3.60376e-24
NZ_CP015592.1\|WP_082250347.1\|165620_166544_-\|MFS-transporter	gnl\|CDD\|340887	cd17329, MFS_MdtH_MDR_like, Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.02544e-36
NZ_CP015592.1\|WP_071680113.1\|166550_167759_-\|ATP-grasp-domain-containing-protein	gnl\|CDD\|235010	PRK02186, PRK02186, argininosuccinate lyase; Provisional.	5.86909e-39
NZ_CP015592.1\|WP_071680123.1\|184637_186485_-\|ABC-transporter-permease	gnl\|CDD\|376899	pfam02687, FtsX, FtsX-like permease family. This is a family of predicted permeases and hypothetical transmembrane proteins. Buchnera aphidicola LolC has been shown to transport lipids targeted to the outer membrane across the inner membrane. Both LolC and Streptococcus cristatus TptD have been shown to require ATP. This region contains three transmembrane helices.	7.97483e-05
NZ_CP015592.1\|WP_000439057.1\|180604_180901_-\|DUF2089-family-protein	gnl\|CDD\|378280	pfam09862, DUF2089, Protein of unknown function (DUF2089). This domain, found in various hypothetical prokaryotic proteins, has no known function. This domain is a zinc-ribbon.	9.88671e-13
NZ_CP015592.1\|WP_071680110.1\|158948_161222_-\|hypothetical-protein	gnl\|CDD\|173886	cd01951, lectin_L-type, legume lectins. The L-type (legume-type) lectins are a highly diverse family of carbohydrate binding proteins that generally display no enzymatic activity toward the sugars they bind. This family includes arcelin, concanavalinA, the lectin-like receptor kinases, the ERGIC-53/VIP36/EMP46 type1 transmembrane proteins, and an alpha-amylase inhibitor. L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "back face". This domain homodimerizes so that adjacent back sheets form a contiguous 12-stranded sheet and homotetramers occur by a back-to-back association of these homodimers. Though L-type lectins exhibit both sequence and structural similarity to one another, their carbohydrate binding specificities differ widely.	3.47539e-29
NZ_CP015592.1\|WP_071680121.1\|183060_183579_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.55573e-17
NZ_CP015592.1\|WP_071680120.1\|177869_179102_+\|cytochrome-P450	gnl\|CDD\|225035	COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism].	7.17673e-82
NZ_CP015592.1\|WP_071680115.1\|168995_169538_-\|class-IV-adenylate-cyclase	gnl\|CDD\|224354	COG1437, CyaB, Adenylate cyclase, class 2 (thermophilic) [Nucleotide transport and metabolism].	1.08064e-15
NZ_CP015592.1\|WP_071680116.1\|169534_170563_-\|radical-SAM-protein	gnl\|CDD\|274251	TIGR02668, moaA_archaeal, probable molybdenum cofactor biosynthesis protein A, archaeal. This model describes an archaeal family related, and predicted to be functionally equivalent, to molybdenum cofactor biosynthesis protein A (MoaA) of bacteria (see TIGR02666). [Biosynthesis of cofactors, prosthetic groups, and carriers, Molybdopterin].	5.55633e-18
NZ_CP015592.1\|WP_071680281.1\|173920_176128_-\|MMPL-family-transporter	gnl\|CDD\|225272	COG2409, COG2409, Predicted drug exporters of the RND superfamily [General function prediction only].	6.92105e-116
NZ_CP015592.1\|WP_071680117.1\|170625_171822_-\|ATP-grasp-domain-containing-protein	gnl\|CDD\|273950	TIGR02068, Cyanophycin_synthetase, cyanophycin synthetase. Cyanophycin is an insoluble storage polymer for carbon, nitrogen, and energy, found in most Cyanobacteria. The polymer has a backbone of L-aspartic acid, with most Asp side chain carboxyl groups attached to L-arginine. The polymer is made by this enzyme, cyanophycin synthetase, and degraded by cyanophycinase. Heterologously expressed cyanophycin synthetase in E. coli produces a closely related, water-soluble polymer with some Arg replaced by Lys. It is unclear whether enzymes that produce soluble cyanophycin-like polymers in vivo in non-Cyanobacterial species should be designated as cyanophycin synthetase itself or as a related enzyme. This model makes the designation as cyanophycin synthetase. Cyanophycin synthesis is analogous to polyhydroxyalkanoic acid (PHA) biosynthesis, except that PHA polymers lack nitrogen and may be made under nitrogen-limiting conditions. [Cellular processes, Biosynthesis of natural products].	2.98858e-09
NZ_CP015592.1\|WP_082250349.1\|176404_176989_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	3.13972e-06
NZ_CP015592.1\|WP_042514298.1\|186474_187236_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224059	COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms].	1.33757e-104
NZ_CP015592.1\|WP_071680112.1\|164008_165010_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|378935	pfam12728, HTH_17, Helix-turn-helix domain. This domain is a DNA-binding helix-turn-helix domain.	3.00558e-08
NZ_CP015592.1\|WP_071680122.1\|183716_184427_-\|conjugal-transfer-protein-TraX	gnl\|CDD\|368639	pfam05857, TraX, TraX protein. This family consists of several bacterial TraX proteins. TraX is responsible for the amino-terminal acetylation of F-pilin subunits.	4.2538e-24
NZ_CP015592.1\|WP_071680119.1\|177064_177646_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.46282e-05
NZ_CP015592.1\|WP_082250346.1\|165258_165603_-\|hypothetical-protein	gnl\|CDD\|340887	cd17329, MFS_MdtH_MDR_like, Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.01618e-10

>NZ_CP015592.1|WP_071680117.1|170625_171822_-|ATP-grasp-domain-containing-protein
MSIVILNRVSKNKKNYAEWLRESKEKIYLLNHQETVSSFKDTSLLRKGFNDFSINGLVDYEVVEIHKNDPIKALIALEEGEIIRAGYLRDYLGIEGQKLNSAMHFRDKYLMKTCLKQQGIRVPAFKKINNRVDLFEFINQEGYPVLIKPLSSWSSKGIEVLNNEQDLKKCLRKNTFESYMVEKYLDARVYHVDGLLINNEIVFCCASSYINTPLAYKENISFGSVLFEKGNVFAEKLIEFVKNSLEKMPLAKNMSFHVEVFHDEKSNELFICEMGSRTIGAGTEELIKYSYNLDLDRVLTQAQAEVPLDMNIIERNVSGQLFIRPQKGFLIDFPKEIPFDWCFNYEKRGILGEYYEGSAVKPSDSYAVVYFKGDNQKELFERVKILEQYFEENTIWES
>NZ_CP015592.1|WP_071680116.1|169534_170563_-|radical-SAM-protein
MKFNNKAEVLSFLSPKENSEVVPLKSIRIKITDRCHWNCWWCHNEGTGARNPKITKDIEFKGEFSEKFLDLCNSLEINEVHITGGEPTTYNGLVDSIKFLKKHGFTVKMTSVGNSEEIINKVIKSGIDGINFSLHAIETEELHSTQIDRSLKWTKIQQDRQFNSIFAAKEAGVKVKLNTVMASHKDISRIKEVIDWSFKHDIDMRILHEVNLLEESVNAVRELLDSYGAVEKRRKYIYGASSGTIFYDIPGKREIGFKILLPQFLESMCNSCELKKNDTCGEYFYGIRLENKLDEYNVRLCVHRTNENTYMGMEQFINSNHFNEIRKKQLEYKEQHKMEVQV
>NZ_CP015592.1|WP_071680115.1|168995_169538_-|class-IV-adenylate-cyclase
MKEVELRFKINNAEYIHGKLSDLNFTLLSEKRQIDEYFKHKGFEKEGDVVGSYIYRLRTDSQKGNSAVKKKTIEPGIWDELEINIDGDNLTFIRTLMEDSLSSILVIDKYRRTYKKDDFTLNIDIIKDLGEFVEVELLVLEESNEAMKKIENLILELGVNKSDIIREGYVTLIKKEKELV
>NZ_CP015592.1|WP_071680114.1|167778_168996_-|hypothetical-protein
MKVKSKEITNKFIEYFLDLDYILLHEKKIVRNNEETYFNMSAISANISLFNNLSNEKDSQNYVTKQAVFFGNKLDGVGDTPLANPTEVSLSIFNLASESPRYTLNHIFGFLEGLGLSKENLLFRIANEEEIRRSFILEGIQESQLFVWRNMEEFNIGSNRPKGFYTYPYYKYKNGCVPLGSISFIKHNGVWTSDIAIFQERLSLILNQLDKIVLIDSIFPLYNYVLTELNLKDTLIMKITLLLRSIAFLVKDGLVEVSASYHGHFLKKLMREVAASLNSINFSDANKNNIFKFLEASLNEQGYSIRDKNREFSYILDKINIYSVDIYKSILKQNSRFLKNGIVDIQNISQTFGIKPDWILASSMVDNMFKNEARKFVKSRNSIRNKALSLDSSINVDLKELLTEN
>NZ_CP015592.1|WP_071680113.1|166550_167759_-|ATP-grasp-domain-containing-protein
MSKHILVLGGFSEIHKRIKTLGAEISILNTTKKIKPYYSKIYDRVITLPESSSDEAFIEFARAINKVNKINFIATFHEDFQEIAFKISRELGISYDHNLDTINLVNNKFAFRQRLRELNIDNTKSILVDTFNDLNAFMKETKVPIILKPLNSTASTGIWKIESEYPDLEKDFKKYREKFSQYLLCAEEFICGEEYSVEAFTEDRKHKVYCITKKHKNNKNFVEIGHTVPSGLSEKESNEVKKFVKTVLDAIDIKNGPSHTEIMLTNNGPKAIETHVRLGGDMISKLYEIVSVDIDILEMTARNSIGEQVIDKIQDITHYKRYASIWFKEGEIGTVRTIINNNDTVQDENIVELSVGIKEGDQITDADSSFGRLGHVITKGNSAEKTLSAAQEAIAKIKVIMD
>NZ_CP015592.1|WP_082250347.1|165620_166544_-|MFS-transporter
MANLKEKDGILMFRKFHANIKIKLICSFFNRFATRTVLPFMALYFSDEIGKVLTGFLLTLNIILQFLSSLIGGYLADRYPRKKILLIGQLSNAISYLGMTIFLYPLINKVSGVIIFFMLSAIVGSLHKSAMDAIIIDSTTKDNRKSIYTFDYWLYNVSLSLGMVIGGLFYVKYRFELFTMLTIILFATTYIYQVFIDDKEDELNHLYNKETSISIKDMLLNYFLAAKDKKWLSFVVGGICIFSAELSLGNYIGVRLAEEFIPMKIFNFQLDGIKMMSLLVITNTILAVTLTFVVSNMIKKFNQRKVF
>NZ_CP015592.1|WP_082250346.1|165258_165603_-|hypothetical-protein
MIGYGVLAISNQWLVLMFFITIATIGELIYSPIRQVLQVELIPRDKRASYLALGSFSIQGASILASLGITIGTFLQSMTMSLIIVLIGGLGMLLSYFAVYSNAKQVENIKESAN
>NZ_CP015592.1|WP_071680112.1|164008_165010_+|helix-turn-helix-domain-containing-protein
MTQDLLFITKPTVTTKEAADLLGVTVQTILKKEKDGLIACVYKDNWKQFGSKIFYLEDIERLKNSEEIEGYSTKEAAEILNVAPSTVFTYIKSGKLPASKIEKRGKEVYIIDKNDLKTFQLTYEKTTSKERKTFITKIQDKDIYLYQLLTHQHTGKTARVIEINGADGKILTEDEEIFPLSTYKERDYAFEPFHKQAVITKRGYLSFSFKKPQLFHSLTYNLIHLFYKELGVANMRLSISSDTIKLEIKPFVLQVDPLQFQEEIKYLHSHMKSGTILPHVEGIYFKSNVESLTFHAGHEFKQKIVQMAADAGMGQEEFLLQAVKSYITNLEQQ
>NZ_CP015592.1|WP_071680111.1|162432_163605_-|tyrosine-type-recombinase/integrase
MDKQNEKENLPIIKNKSENIDTYVENIRDMVPFLHDSRYVDKVEEKMEVAEKEGKSKYTYLSDLEVIYHFVHLQKDMDEKKNRKEDTKKSYISEILSFCQCMVQHAEEFELNGEEVQQNDSLLKTLKPWHIRKYNAWLKQVENGRNGDTYAVATLAKKSVLIRSFLKHLHVFAYIERPVHEELQRANVNEQDRPNRDLSYDEVMKILRFYKEQGHLVNYSILLALASTGARIQELCSARVKDLHYDGKHWLKVRGKGDKVRELFVSEHLYQCICEVRRRRGFQTVLEKGDESPLFINQRGNAYNSKTLSNQVTDMIKKTNLEFLQYRENPVTAHTFRHAFAIMAVEQGNADLYHLMQTLGHENIQTTKIYLEKHMKRKNNVGTSFADLLM
>NZ_CP015592.1|WP_071680110.1|158948_161222_-|hypothetical-protein
MKKVITKSSFACILGALFLLSNHISVFAAENQDSPPSAIKLDNIFTVPSGSNSILIQNDKFDIVQLTDSVKDQSGAVWSTDENKMDLTKDFEAAMYIYFGDSGEDAADGMAFVMHNDKNGNNAFRTGEGARIGVWDSTKPKEFGLAIMNSFAVEFDTYFNKDFDRGVPKQNHIAWNYPGKKDTYDDSGLIFKDRRMIHNDLQFPGLLSNDTWRYFTVRWDSKQSILTYQLQGLKSVSVPINVNDVFGTTEVYWGFTGSTGGSFEMNRIVFDKVPGLVEAEVKEDILDITTNESIVGTKVASGTKLTYSLEANYIGGKQAWKNINVSSTIDSNVSYVPGSLRLKDASGKETPLDDSYWKDGMLNAPISDMDLNNSKQTILFDVKTNKVGQDTVVSEHSNFYGDNYHTKTAELNYTISANKAPEISLNQENETLKVPMGQDVEVSGKWKDEDGTKVTITYKLNGEVIGQNQLQSEQENTFQDWKYTIPKDKLQLGVNHLEVYATDEKGANSEVKSLEISISSPPTITLNEENKEEEIDYGKSFNFSGTVSDLDGADKELTLYYVIDDNEQVAFSKVTNSNPGEAINFAGEIPTSNVNEGPHTISVYAIDEDGLQSNISKFTLHVIKRLTFADDMQDLEFVTTQIGSTPKISERTTEYPIHIINSKGKGSKWKLKAELTKPLVSKENHTLEGLFFKKSNGETEELLLNTSVIVETGESPEDYSDINLNWKNDEGLLLKVDPSAHIGSYAGELTWTLEDAP
>NZ_CP015592.1|WP_071680281.1|173920_176128_-|MMPL-family-transporter
MAKYLYKLGNWAAKHGKGIIFSTLGILLILGVLAGSLGPSFNDELTIPGTPADKASKLLEKEFPESQSAGAQIKIVFKAPKDQTLDSEQINKVITDTLSDIKKDDSNVESIATPMQLKNLTKDNTMGYAVVNYKNDAEDIKESSKKNVLNKIEQTRDEGIQTELTGDVKFTVVESNGESEAIGIVIAFIILAITFTSFLAAGMPIITAIIGLGTGMLVVMIGSNYIELQDLSLSVAIMLGIAVGIDYALFIMTRFRQQLGEGHTVKESIAIATGTAGSAVVFAGITVIIGLLGLSVMQIPFLTKMGAVSSISILCAVLVSIIVLPAILGIVGHRFHPSTGNKFLKKITGAKEGKVPSNKWGKLVTKHPLVMSFLAIALLAVISIPFFHMNLGLPDDGDTMSKDTTERKAYDLMTEAYGEGVHSSLVVAAKIDSKKQNSQETQKAMAEITEEIGELKNVKSVTPAFPNSSGDVFIITVTPETGPNDIETKDLVKHIREKSNTTKKENDIELLVTGTTAVNIDITEKLNTALPIFAVLVVGLAYVLLVLVFRSLLLPLKAVVGFLLSLAATLGFAVFVIQDGNLLDLFGFPSSSAILAFLPILTIGILFGLAMDYEVFLASRMREVYTHTGNPKEAILAGMRDSGKVVAAAGLIMIAVFFGFMLMPDPMVKAIGMSLAFGVLFDAFVVRLTIVPAVMTLMGKAAWYMPKWLDKILPNIDVEGESILYKSESEDKRVG
>NZ_CP015592.1|WP_082250349.1|176404_176989_+|TetR/AcrR-family-transcriptional-regulator
MLALRNSRQDGIYSQEYITEALGLLLKEKKLEDITVTDLCKKAGVARVTFYKYYRTIYDVLNASMQKSIDKFLEEITYLDSHESLQLFIEGLISFMANERILMKNIIDSNMSGLLLDYVNSAIKSIFETDNPISNNMSRAQALFFIGGFFNVFIDWIKRSSRESPQSLVEKIYEMFPIKKKYREFFLLLTCSFL
>NZ_CP015592.1|WP_071680119.1|177064_177646_-|TetR/AcrR-family-transcriptional-regulator
MKNNEEQLDLRVRRTHKLLWESLFELMTHSKQKYSSITINQICNRAMVHRTTFYKHFEDKDALLAVGINKFQEEVFQIPLLDRLTRPFQVMEQCLHHKEFGKMLESQMDDEQFINRLQYQNHEMKKLENQELNQLCKNHTIPNELIIEFYSGVTGTLIAWWLQNRKSVSAEEMDKYFHQLINQDVFQFERECQ
>NZ_CP015592.1|WP_071680120.1|177869_179102_+|cytochrome-P450
MENTVISTSEIKDLKTKSEEFAPFSWYKKMLTEHPIYYHAGTDTWNVFKYEDVKRVLTDHELFSSKRHRSISQIGAETEEGSVPDRLKINETDPPEHRKSRSLLSSAFTPRSLKTWEPRIEQIINNLIAEIGDKSEIDIVKDFTTPLPIIVMADLLGVPHKDKLLFKKWVDILFMPFNSENAKEVSQQKAKAAMEYFNYLYPIVVEKRKQLSDDILSDLIQVEIEGEKFTDEEVVRVTMFLLAAGVETTSLLLANSFYALLYDAPKLYEELRSDINLVPNFVEEMLRYRFHVIALDREVKVDNNVLGVELKKGDLVITWNSAANFDEDVFEDPFTVNIHRKNNNRHQTFGNGPHFCLGAPLARLEANKAFKIFIETFSRIELVPSFNLEASLQTSAAGQALSSLPMKVHR
>NZ_CP015592.1|WP_071679257.1|180305_180602_-|hypothetical-protein
MKPVVGILVIVVIIVTQIFLSSRKTPYLGGILPVAYIGFIGFFFNKLIANGDYLSTWIMMMVGLCSFLSIWASGRKRFKKKRQKDIDLELGLIELQNL
>NZ_CP015592.1|WP_000439057.1|180604_180901_-|DUF2089-family-protein
MEREEIPSWILSLDKESLEFIRKFILNSGSLKNMSNLYDVSYPTVRAKLDRLIKKIEVHSKEDDVEFVNMIKGFVIDERISLDVAKIIIEKYKKERDV
>NZ_CP015592.1|WP_071680121.1|183060_183579_+|GNAT-family-N-acetyltransferase
MEIRKANKEDIKGVSKVYVNSWRTTYRGLVPDDYLDKLSYEDAAKRWIDFLNNENEPFIYVAINDTGNIIGFASGKRINEKNFDGELYSLYLLQECRGLGVGRQLISAIAKHFKEKGIYSMMVWVMKQNKSGLGFYERMGGKEYIHRTSTFGGTVVEDVAYAWKEISNLCVE
>NZ_CP015592.1|WP_071680122.1|183716_184427_-|conjugal-transfer-protein-TraX
MRLNAFQLKIFAMILMVIDHVYAYIPGMPMWMHHPGRIVAPIFFYFVVEGFFYTRNRNKYATRIFIWAAIMFAGSALIQYMFPRESGLHNNIFLSLGISIVLLCMIDYTKCTKNYLLGIPATIIVATLGMFTEASFMGVIMTLIFYFFKEKKIWLIITYVLLSLPEVPTLLMAGEIFTDMGLFGYNNQWMMVFALPFFFLYNGERGLNNRLTKYMFYIFYPVHLWIIYTVGYFLGK
>NZ_CP015592.1|WP_071680123.1|184637_186485_-|ABC-transporter-permease
MSFDHIVFQNILRDKWTYISYFLSSVFSILIFFLFSIIAFHPMAKVIQIGSTLSLGMILMSFIVYIFSFLFIFYSMFSFLKKKTKNLGIFMITGASMKQVRKMMFRENMIIAGAAIFTAIVLGLVIAPLFLMVTKTVLDTNSFGMYIPVQAVGLTIVLFTILFLLVSKFITRFINKEEAVHLLKADVTQEKLIEPAPWKLLLSMITSGFLVFSLMSEMNWIESYGMVFYILFFISSLLAIYFIITQGILFSIRVLQKRPSYLKKTNMLYISNLKAKGRSHAQLIYLLTILLLGVFLCAILLYSSYYNTDKVAESKSPYSFQYISLPENTTEKEDISFIEATLSKDGSYDAYYSAFKTDQQRNIGFMSVSNYNALGFHKTISLKDNEYYVAAGNYYELPNTDLIHEYPFPVEKLKYAGFEKRNILMTGHQRVYYIVPDTIYEKIDYPVLKVFAYELKGWSEKFALSETIFSKVSPTPNKHQIFSKIDINKTEKATASLFFFIGFMMSLIFLSAAMSILYFYLQTSIEREKEKYAGIRKIGFSVKELASVVTKELTTLIFIPFALAAVLLCGTTIGLSKHFSPAIYGVTAIGVGVFLILFVISFFVIRRSYLKKLMN
>NZ_CP015592.1|WP_042514298.1|186474_187236_-|ABC-transporter-ATP-binding-protein
MSKTILDVKDLQKEYNGEIVYKALKGIDFKLESNEFVAVMGPSGSGKTTFLNCISTIDQPTTGSVKINSKNPYELSDDGLAKFRRKELGFVFQDFNLVHTLTVEENILLPLVLDSVEAVEMNKRLEKVAMFLGIKEILKKRTFEISGGQKQRVAIARAVIHEPGLLLADEPTGNLDSKAVNDVMNLFESINKTFNTAILMVTHDPYVASFAHRVIFIKDGILYNEVYRGNNKKKFYQEIMDTLTFLGGGQYEF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP015592_1	1.1\|171948\|36\|NZ_CP015592\|CRISPRCasFinder	171948-171983	36	NZ_CP015592	Bacillus cereus strain AR156 plasmid pAR460, complete sequence	171948-171983	0	1.0

1. spacer 1.1|171948|36|NZ_CP015592|CRISPRCasFinder matches to NZ_CP015592 (Bacillus cereus strain AR156 plasmid pAR460, complete sequence) position: , mismatch: 0, identity: 1.0

atttaactcccttatattagcacaatgttaaaaaag	CRISPR spacer
atttaactcccttatattagcacaatgttaaaaaag	Protospacer
************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

37709 : 122904

Bacillus_phage(50.0%)

holin,protease,coat,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071680044.1\|37709_38831_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	2.8e-174	81.8
WP_082250337.1\|38925_39084_+	hypothetical protein	NA	NA	NA	NA
WP_000644860.1\|39264_40200_+	DUF3994 domain-containing protein	NA	NA	NA	NA
WP_071680045.1\|40510_40870_-	hypothetical protein	NA	NA	NA	NA
WP_061402264.1\|41078_41729_-	YIP1 family protein	NA	NA	NA	NA
WP_071680046.1\|42949_46231_+	VaFE repeat-containing surface-anchored protein	NA	NA	NA	NA
WP_061402266.1\|46523_47228_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_061402267.1\|47353_47893_+	hypothetical protein	NA	NA	NA	NA
WP_061402269.1\|49230_49494_+	hypothetical protein	NA	NA	NA	NA
WP_071680048.1\|50701_51445_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_071680049.1\|51992_53384_-	cell wall hydrolase	NA	NA	NA	NA
WP_071680050.1\|54154_55057_+	hypothetical protein	NA	NA	NA	NA
WP_071680051.1\|55737_58446_+	EAL domain-containing protein	NA	NA	NA	NA
WP_071680276.1\|58770_59154_+	hypothetical protein	NA	NA	NA	NA
WP_071680052.1\|59170_59809_+	NERD domain-containing protein	A0A2R2ZH57	Clostridioides_phage	4.8e-22	35.1
WP_071680054.1\|60310_60958_-	ABC-2 transporter permease	NA	NA	NA	NA
WP_071680055.1\|60947_61814_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-20	30.9
WP_000706801.1\|61810_62194_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_071680056.1\|63618_64125_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000481848.1\|65429_67412_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.7e-15	28.0
WP_048554447.1\|68045_68273_+	hypothetical protein	NA	NA	NA	NA
WP_000819409.1\|68589_69138_+	hypothetical protein	NA	NA	NA	NA
WP_164971102.1\|70782_70956_+	hypothetical protein	NA	NA	NA	NA
WP_071680277.1\|71957_73940_+	serine hydrolase	NA	NA	NA	NA
WP_071680057.1\|74241_74439_-	hypothetical protein	NA	NA	NA	NA
WP_071680058.1\|74604_75300_+	VanR-ABDEGLN family response regulator transcription factor	W8CYM9	Bacillus_phage	1.5e-37	38.2
WP_082250339.1\|75283_76444_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	3.8e-17	25.2
WP_071680278.1\|76624_77146_+	carboxypeptidase	NA	NA	NA	NA
WP_082189078.1\|77152_77257_+	hypothetical protein	NA	NA	NA	NA
WP_071680060.1\|78442_79426_+	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_164971103.1\|79486_79636_-	hypothetical protein	NA	NA	NA	NA
WP_164971097.1\|79733_79877_+	hypothetical protein	NA	NA	NA	NA
WP_071680061.1\|80228_81035_+	hypothetical protein	NA	NA	NA	NA
WP_071680062.1\|83976_85524_-	mosquitocidal toxin protein	Q38196	Clostridium_botulinum_phage	7.3e-08	36.8
WP_071680063.1\|85821_86748_-\|holin	choline-binding protein A	NA	NA	NA	NA
WP_071680065.1\|89191_90064_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_071680066.1\|90125_91328_-	glycosyl transferase	Q0IKX4	Leucania_separata_nucleopolyhedrovirus	3.0e-09	26.4
WP_071680067.1\|91867_93337_+	glutamate decarboxylase	NA	NA	NA	NA
WP_071680068.1\|93503_94013_-	ClbS/DfsB family four-helix bundle protein	NA	NA	NA	NA
WP_071680069.1\|94180_94942_-	glycosyltransferase	NA	NA	NA	NA
WP_071680070.1\|95396_95834_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_071680071.1\|96076_96901_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_071680072.1\|96924_97632_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_071680073.1\|97609_98230_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_071680279.1\|99702_100572_-	hypothetical protein	NA	NA	NA	NA
WP_071680074.1\|100692_101676_-	hypothetical protein	NA	NA	NA	NA
WP_071680075.1\|104118_104940_-	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	2.1e-54	46.0
WP_071680076.1\|105136_106426_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	7.5e-75	35.1
WP_071680077.1\|107378_108569_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_129075313.1\|108678_108864_-	helix-turn-helix domain-containing protein	A0A142F192	Bacillus_phage	2.8e-07	51.7
WP_129075306.1\|109029_109356_-	hypothetical protein	NA	NA	NA	NA
WP_071680078.1\|109436_109862_-	hypothetical protein	NA	NA	NA	NA
WP_071680079.1\|109863_110922_-\|coat	CotS family spore coat protein	NA	NA	NA	NA
WP_071680080.1\|110946_112083_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_071680081.1\|112235_113339_+\|coat	CotS family spore coat protein	NA	NA	NA	NA
WP_071680083.1\|114538_114763_+	DUF2187 domain-containing protein	NA	NA	NA	NA
WP_071680084.1\|115596_116829_-	cytochrome P450	NA	NA	NA	NA
WP_071680085.1\|117549_118950_-	phospholipase	NA	NA	NA	NA
WP_000516937.1\|120064_121009_+	nucleoside hydrolase	NA	NA	NA	NA
WP_071680087.1\|121824_122904_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0A8WI33	Clostridium_phage	4.9e-19	31.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP015589

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015589_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015589_1

2867286-2867394

Orphan

Consensus_repeat	Method
TGTATGATTACCTTCCGCATGAGAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015589_1

>merge|NZ_CP015589|1|2867286-2867394|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAAGAGAATCCGTTAGCGATAGTAGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGATTGTATGTTTACCTTCCGCATGAGAA

>NZ_CP015589|1|1|2867286-2867394|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAA	GAGAATCCGTTAGCGATAGTAGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGAT
TGTATGTTTACCTTCCGCATGAGAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015589.1\|WP_000754593.1\|2861227_2861401_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015589.1\|WP_000673185.1\|2864882_2865680_+\|NAD-kinase	unknown	unknown	gnl\|CDD\|235317
NZ_CP015589.1\|WP_000654708.1\|2868982_2870143_-\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NZ_CP015589.1\|WP_071679296.1\|2868167_2868908_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	unknown	unknown	gnl\|CDD\|184187
NZ_CP015589.1\|WP_071679299.1\|2873102_2873990_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375999
NZ_CP015589.1\|WP_071679298.1\|2871231_2871990_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP015589.1\|WP_071679295.1\|2865695_2866589_+\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NZ_CP015589.1\|WP_000428850.1\|2872134_2872980_-\|macrocin-O-methyltransferase	unknown	unknown	gnl\|CDD\|377550
NZ_CP015589.1\|WP_000043380.1\|2862523_2862922_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381281
NZ_CP015589.1\|WP_000676177.1\|2877471_2878209_+\|NTP-transferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|133019
NZ_CP015589.1\|WP_061403203.1\|2857986_2859231_+\|competence-protein	unknown	unknown	gnl\|CDD\|226875
NZ_CP015589.1\|WP_001067694.1\|2875391_2876081_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369778
NZ_CP015589.1\|WP_061403201.1\|2863100_2863679_-\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|143627
NZ_CP015589.1\|WP_001180001.1\|2863823_2864195_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015589.1\|WP_000654997.1\|2876776_2877457_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP015589.1\|WP_001081482.1\|2864225_2864864_+\|GTP-pyrophosphokinase-family-protein	unknown	unknown	gnl\|CDD\|225232
NZ_CP015589.1\|WP_001272381.1\|2876077_2876764_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP015589.1\|WP_061403202.1\|2859281_2861108_+\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NZ_CP015589.1\|WP_000360642.1\|2861630_2862524_-\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|372699
NZ_CP015589.1\|WP_071679297.1\|2870289_2871225_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|366154

Protein	Function_ID	Function_description	E-value
NZ_CP015589.1\|WP_071679296.1\|2868167_2868908_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	gnl\|CDD\|184187	PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional.	0
NZ_CP015589.1\|WP_000673185.1\|2864882_2865680_+\|NAD-kinase	gnl\|CDD\|235317	PRK04885, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional.	0
NZ_CP015589.1\|WP_071679297.1\|2870289_2871225_-\|glycosyltransferase	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	1.79666e-21
NZ_CP015589.1\|WP_000654708.1\|2868982_2870143_-\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	1.38078e-99
NZ_CP015589.1\|WP_071679299.1\|2873102_2873990_-\|hypothetical-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	1.29278e-17
NZ_CP015589.1\|WP_071679298.1\|2871231_2871990_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.47755e-18
NZ_CP015589.1\|WP_071679295.1\|2865695_2866589_+\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	1.08109e-99
NZ_CP015589.1\|WP_000428850.1\|2872134_2872980_-\|macrocin-O-methyltransferase	gnl\|CDD\|377550	pfam05711, TylF, Macrocin-O-methyltransferase (TylF). This family consists of bacterial macrocin O-methyltransferase (TylF) proteins. TylF is responsible for the methylation of macrocin to produce tylosin. Tylosin is a macrolide antibiotic used in veterinary medicine to treat infections caused by Gram-positive bacteria and as an animal growth promoter in the swine industry. It is produced by several Streptomyces species. As with other macrolides, the antibiotic activity of tylosin is due to the inhibition of protein biosynthesis by a mechanism that involves the binding of tylosin to the ribosome, preventing the formation of the mRNA-aminoacyl-tRNA-ribosome complex. The structure of one representative sequence from this family, NovP, shows it to be an S-adenosyl-l-methionine-dependent O-methyltransferase that catalyzes the penultimate step in the biosynthesis of the aminocoumarin antibiotic novobiocin. Specifically, it methylates at 4-OH of the noviose moiety, and the resultant methoxy group is important for the potency of the mature antibiotic. It is likely that the key structural features of NovP are common to the rest of the family and include: a helical 'lid' region that gates access to the co-substrate binding pocket and an active centre that contains a 3-Asp putative metal binding site. A further conserved Asp probably acts as the general base that initiates the reaction by de-protonating the 4-OH group of the noviose unit.	1.27737e-148
NZ_CP015589.1\|WP_000043380.1\|2862523_2862922_-\|hypothetical-protein	gnl\|CDD\|381281	cd14772, TrHb2_Bs-trHb-like_O, Truncated hemoglobins, group 2 (O); Bacillus subtilis TrHb like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). TrHb2's belonging to this group include monomeric Bacillus subtilis trHb (Bs-trHb), which exhibits an extremely high oxygen affinity, and a dimeric TrHb2 from the thermophilic aerobic spore forming bacterium Geobacillus stearothermophilus(Gs-trHb).	1.69795e-69
NZ_CP015589.1\|WP_000676177.1\|2877471_2878209_+\|NTP-transferase-domain-containing-protein	gnl\|CDD\|133019	cd02538, G1P_TT_short, G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase. This family is the short form of glucose-1-phosphate thymidylyltransferase. Glucose-1-phosphate thymidylyltransferase catalyses the formation of dTDP-glucose, from dTTP and glucose 1-phosphate. It is the first enzyme in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme.There are two forms of Glucose-1-phosphate thymidylyltransferase in bacteria and archeae; short form and long form. The homotetrameric, feedback inhibited short form is found in numerous bacterial species that produce dTDP-L-rhamnose. The long form, which has an extra 50 amino acids c-terminal, is found in many species for which it serves as a sugar-activating enzyme for antibiotic biosynthesis and or other, unknown pathways, and in which dTDP-L-rhamnose is not necessarily produced.	2.37027e-129
NZ_CP015589.1\|WP_061403203.1\|2857986_2859231_+\|competence-protein	gnl\|CDD\|226875	COG4469, CoiA, Competence protein CoiA-like family, contains a predicted nuclease domain [General function prediction only].	2.50619e-59
NZ_CP015589.1\|WP_001067694.1\|2875391_2876081_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369778	pfam08242, Methyltransf_12, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	3.32034e-18
NZ_CP015589.1\|WP_061403201.1\|2863100_2863679_-\|CYTH-domain-containing-protein	gnl\|CDD\|143627	cd07762, CYTH-like_Pase_1, Uncharacterized subgroup 1 of the CYTH-like superfamily. Enzymes belonging to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup are of bacterial origin and have not been characterized.	1.35693e-85
NZ_CP015589.1\|WP_001272381.1\|2876077_2876764_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	4.7405e-109
NZ_CP015589.1\|WP_000654997.1\|2876776_2877457_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	7.49705e-107
NZ_CP015589.1\|WP_001081482.1\|2864225_2864864_+\|GTP-pyrophosphokinase-family-protein	gnl\|CDD\|225232	COG2357, COG2357, PpGpp synthetase catalytic domain [General function prediction only].	1.66713e-95
NZ_CP015589.1\|WP_061403202.1\|2859281_2861108_+\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NZ_CP015589.1\|WP_000360642.1\|2861630_2862524_-\|DsbA-family-protein	gnl\|CDD\|372699	pfam13743, Thioredoxin_5, Thioredoxin.	7.3476e-93

>NZ_CP015589.1|WP_071679295.1|2865695_2866589_+|RluA-family-pseudouridine-synthase
MNRFTLKWDIDSAEEGTLVREFLKTKGISKAALTDIKFQGGAIEVNGQHASVRHQLQAGEKLRVFFPVEERSEGMIAEDIPLCIVYEDDAVLVINKEANMSTIPSREHPAGSVANALLSHYDKQHLASTVHIVTRLDRDTSGLMLIAKNRFVHHLLSKQHQQKAVKRTYEAIVHGEMVEREGTIDAPIGRKSDSIIERTVCEEGQRAVTHFRVIDSANHKTHVSLELDTGRTHQIRVHMAHIGHPLLGDNLYGGKRDEMKRQALHSTSLTFYHPILEKEMSFTTTIPSDMQAVVRHT
>NZ_CP015589.1|WP_000673185.1|2864882_2865680_+|NAD-kinase
MKFTIMSKGDQSSDALASTMKEYLLDFGFIMDEQEPDIVISVGGDGTLLYAFHRYYNRLDETAFVGVHTGHLGFYADWLPTEVEKLVIAIAKTPFQVVEYPLLEVIIRYVNGSKESQYLAMNEATVKSAEGTLVTEVEIRGEYFETFRGDGLCISTPSGSTAYNKALGGAIIHPSIEAIQIAEMASINNRVFRTVGSPLVLPKHHTCVLKPTAGMNLQITVDHLTMVHQDVKSIQYRVANEKVRFVRFRPFPFWKRVRDSFVADK
>NZ_CP015589.1|WP_001081482.1|2864225_2864864_+|GTP-pyrophosphokinase-family-protein
MNRNWEEFLAPYHQAVAELKVKLKGMRTQFAMLTEHSPIEFVTGRVKSVASIIDKAEKRNVPLDRLREDMQDIAGLRMMCQFVDEIKPVVEYLRKRNDFEIVEERDYVTQKKDSGYRSYHVVISYPVQTIQGEQKVLVEIQIRTLAMNFWATIEHSLNYKYSGRFPEDIKIRLQRAAEAAFLLDEEMSSIRLEIQEAQKAFSRKQETKDSES
>NZ_CP015589.1|WP_001180001.1|2863823_2864195_+|hypothetical-protein
MQNKIQVKSVEKRENALIFCAENSEIEVKELSARNHVLVDSDNLSFLYILENESSFIYVSIPHTCWEAMHEAMNNDMVMFVRVNDIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
>NZ_CP015589.1|WP_061403201.1|2863100_2863679_-|CYTH-domain-containing-protein
MTQEIEIEFKNMVTEEEFNTLCKSFSIEVFTKQVNHYFETPNFSLKEAGSALRIRHKGETYTLTLKQPAEVGLLETHQVVTEDEARMMMETNVIISGAVMDQLRKLQIPVSALTYMGSLTTERAETLFEGGTLVFDHSFYYNHDDYEIEFEVQDEETGKAAFIHLLTQHNIPIRHTNNKVKRFFLAKQNKAR
>NZ_CP015589.1|WP_000043380.1|2862523_2862922_-|hypothetical-protein
MSKQPMTPFEAIGGEQCIAILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPDETGEI
>NZ_CP015589.1|WP_000360642.1|2861630_2862524_-|DsbA-family-protein
MDKQEAKHINMPSPSACEHKSVEAYLFIDPLCKDCWEIEPFIIKLWLEYGKYFSIRHIVTGKVDGTNASSHKWNKPANIRFVWEKTTSLQGFSCDGKVHMQEASSTPYLVSMAIKAAELQGRKAGSKFLRKLQEYIFLENVSNPDCELLLACAKDSDIDVEEFKKDLYSASAKKAFQCDLKFTNEMHITEIPSLVFFHANSDEEGIKIAGTYSYDVYVQLLKELVKCEIEPEPLPPLEVLLEATQFISSKEVAFIYDCSKQEIERELKKLQLKRKVQMIDVKCERYWKWIAKEKDLV
>NZ_CP015589.1|WP_000754593.1|2861227_2861401_-|hypothetical-protein
MKKTYILLIILAVIVSFFLYILSLLQAFPKMIAFPLLFGVIVIALSYFNHKKRFKGF
>NZ_CP015589.1|WP_061403202.1|2859281_2861108_+|oligoendopeptidase-F
MSEQNTAKALPDRNEIEESSTWRLEDIFQTDAEWEKEFQAIKELLPKLTEFKGKLGDSANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAYIVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSSSSNTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNTFASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLVESVNDNLHLLHRYIDIRKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWVDVYENKGKRSGAYSSGAYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVYGDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHIIHKKVQEGHAVTPDMLTEIYYNLNKKYFGDALVIDEEIGLEWSRIPHFYYNYYVYQYATGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQVFEEKLNELEALLFEEK
>NZ_CP015589.1|WP_061403203.1|2857986_2859231_+|competence-protein
MIPMFIAKRENGEKIHLLDHHDEELLHRMRKRESFFCTACGKEVLMRLGKQKKWHFAHKKVDSCLAFYEAESIYHMHGKELLYRWLKRQNFHVEIEHYLPEIQQRPDIFIERAGRKIAIEYQCANLSIEQLYKRTHSYWRASIQVIWIIGGNQLKKHSAYWMKFSTLMAFSLQSYPQPLLIFFCSKRKLFMKCTFITSFSTSIFFSHIIYLPTETTTFEMLFSSVPFQKEILEREWKKRKDYFRKNALPIWNYNHKSLLRLLYQCKCTPANFPSEIGVPLPSSFAFQTNPFIWQAFIYMKCIGELAVGDCISLEYVCSYIKKYTKRRMLPYFSKHIWKVAVTEYMIFLCYVGVLQKVGTYKYRKKRRIVMLKTEEEVMKYDEVCLAYALSLFEAKYNMREGKGDIIKTDREGIT
>NZ_CP015589.1|WP_071679296.1|2868167_2868908_-|bis(5'-nucleosyl)-tetraphosphatase-PrpE
MKYDIIGDIHGCFHEFQDLTKKLGYNWNSDLPIHPDRRKLVFVGDITDRGPHSLRMIEIVWELVINKKVAYYAPGNHCNKLYRFFLGRNVTIAHGLETTVAEYETLPSHKQNMIKEKFITLYEHSPLYHVLDEKRLIVCHAGIRQDYIGRQDKKVQTFVLYGDITGEKHADGLPVRRDWAKEYRGTAWIVYGHTPVKEPRFVNHTVNIDTGAVFGGKLTGLRYPEMETVSVPSSLPFVPEKFRPIS
>NZ_CP015589.1|WP_000654708.1|2868982_2870143_-|rod-shape-determining-protein-RodA
MKDPNSQYQIDYVLLFILFAIGIVSCFAIASAQASLPPFLQNVNFVLKQIQWYFIGFIAIGMIMIIDFDRYQKIAWYLYSFALVLLIGLEFQVPGAITIKGATAWYRLPGIGNFQPSEIMKLFLIIVTGRIIANHNEKYFYRTIHDDFLLLGKICATSLPPLLLIAKEPDLGNTMVISAMLAAMILVSGIRWRFIFGLVSGIFAVGVTLTYIFFTHTKFFKAHILQEYQLNRFYGWLAPYKYDAQGYQLRQAFLATGSGEMQGKGWENGQVYFPEPHTDFIFTNVAEQFGFLGASVIIALFFLLIFRMIHIALESNDPFGSYICAGTIGMFTFQVFQNIGMTIGLLPITGITLPLMSYGGSSLLTYMIAIGFVLNVRSRTKIFMFN
>NZ_CP015589.1|WP_071679297.1|2870289_2871225_-|glycosyltransferase
MNNIKNPPLVSILIPTYNRPHYFKIALESALAQTYPNIEIIVGDDSTNDEIEILMQIHYLPNYKHITYIRNATTLGQFNNSLMLLKQSHGEYINFLMDDDIFYNSKIEKMMFYFQKDLDQNLALITSYRTWINDDGEVIEQHPSMKRLYDEDTLLNGTDLGNHMLILGQNIIGEPTTVLFRKRLLTEPFGTLNGRNYNCSVDMASWISLLSKGDAIYITEPLSSFRLHTGQQVHLKYLEGCEDFSHLVLNSKKYGFLQEIDYYKTSLLKACEWHKNATTFYQLYPELIPTTDTHIRLSHCLNIVTKELRAI
>NZ_CP015589.1|WP_071679298.1|2871231_2871990_-|class-I-SAM-dependent-methyltransferase
MNENEKKITLIPPPELVQYVGGDFEEVGKEFMQYFIEIGNLKSNETVLDVGCGIGRMAVPLMNYLSDDGTYYGFDLFNKGITWCKNNISTRRNNFHFEHVDIYNQFYNPDGKEDASQYKFPYEDESFDFIFLTSVFTHLLPKELEHYVCEIARVLKKDGRCFITFFLINPESSYYLNAGLSTLGFYHQIDNCYVLNKDIPNFAVAYPEEDIRTLLNKYGLEIQTPPHYGSWCGRTEHTSYQDIILTQKISER
>NZ_CP015589.1|WP_000428850.1|2872134_2872980_-|macrocin-O-methyltransferase
MENKSAVQLYLELLKKTILFEIWLEYEPYLPASLHISKELSYEPVTVPLPLFLKQYIENHNLKIVNPNVSNNERQGGKDWPRAAHSMVGRKRMNQLQEAMETVVRENIEGDFIETGVWRGGSCIFMNGFLQANNIKDRTVWVADSFEGLPAPNLEQYPKDYGDYLHTFDYLRVSLETVQENFRKYDLLNDQVKFLKGWFKDTLPSAPVEKIAIARLDGDMYESTMDSLVNLYDKVSTGGFIIIDDYGLITCAEAVTDFRSERNIKTPMTQIDDFGIYWRKE
>NZ_CP015589.1|WP_071679299.1|2873102_2873990_-|hypothetical-protein
MSNNNYSDGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTVPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGDTGTTGPTGPTGDTGATGPTGPTGDTGTTGPTGPTGDTGATGPTGATGPTGPTGPTGPTGPSGLGLPAGLYAFNSGGISLDLGINDPLPFNTVGSQFGTAISQLDADTFVISETGFYKITVIANTATVSALGGLTIQVNGVPVPGTGSSLISLGAPIVIQAITQITTTPSLVEVIVTGLGLSLALGTSASIIIEKIA
>NZ_CP015589.1|WP_001067694.1|2875391_2876081_+|class-I-SAM-dependent-methyltransferase
MNPEKSSLYEEKSEHYYNAANPNLLKHIKKEWKEVLDIGCSGGALGAAIKENGTRVSGIEAFPEAAEKAKERLDHVILGDIEKIDLPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKENGVILASIPNVAHISVLAPLLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYIDHKVYEPLIEELYGICKKYRLGSGFMAETVVFQYIIEAEKSQL
>NZ_CP015589.1|WP_001272381.1|2876077_2876764_+|streptomycin-biosynthesis-protein-StrF
MSAGEKTILFVTCINDRKMYAQCVRHILRLAVPPGYIVQFMPIRNAKSMTSGYNQAISHPAKYKVYIHQDVFIMNVAFLYGLLQLFNEHEHLGMIGMIGAQYVPPNGIWNEGKGVVGKVIGYMNDLFYMATQEQPYHESKTFMPVECIDGLLMATQYDIPWREDLFDGFDYYDVSQSFEFRKAGYTVGVPVQRDAWCIHYHIDVNMTNYDKYRKIFVENYMSDVNQDE
>NZ_CP015589.1|WP_000654997.1|2876776_2877457_+|streptomycin-biosynthesis-protein-StrF
MKDRTILVVVCVNNEELFEQCERQIRNLFVPPDYVVQIFPIRDAKSMASAYNRALSYPAKYKVYIHQDTYLINREMFYTLISLFKDNEKLGLIGVAGAQFLPSNGIWWEGKNLVGKVIEYRRRNYQLLNLDQGFYGSQSFMSVQAIDGLFMATQYDIPWREDLFQGFHFYDVSQSLEFQRAGYLIGIPNQSNLWCIHYNGDEFDADTYEKDRKVFVEQYKDILSPS
>NZ_CP015589.1|WP_000676177.1|2877471_2878209_+|NTP-transferase-domain-containing-protein
MKGIILAGGTGSRLYPITKVTNKHLLPVGRYPMIYHAVYKLKQCEITDIMIITGKEHMGDVVSFLGSGQEFGVSFTYRVQDKAGGIAQALGLCESFVGNDRMVVILGDNIFSDDIRPYVEEFANQKEGAKVLLQSVDDPERFGVANIQNGKIIEIEEKPKEPKSSYAVTGIYLYDSKVFSYIKELKPSARGELEITDINNWYLKREVLTYNEMSGWWTDAGTHVSLQRANTLARDINFGKQFNGE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015589_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015589_2

3088728-3089112

Orphan

Consensus_repeat	Method
TGNNNACCTTGAGGTCCTTGAGGTCCAGTAGCACC	CRT

6 spacers

The CRISPR arrays of NZ_CP015589_2

>merge|NZ_CP015589|2|3088728-3089112|CRT
TGAGGTCCTTGAGGTCCTTGAGGTCCAGTAGCACCAGTAGCCCCCGCAGGTCCTTGGATACCTTGAGGTCCTTGAGGTCCAGTAGCACCAGTAGCCCCCGCAGGTCCTTGGATACCTTGAGGTCCTTGAGGTCCAGTAGCACCAGTAGCCCCGCAGGTCCTTGGATACCTTGAGGTCCTTGAGGTCCAGTAGCGCCAGTAGCACCAGTAGCCCCTGCTGGTCCTTGGATACCTTGAGGTCCTTGAGGTCCAGTAGCACCTTGAACACCTGCTGGTCCTTGAGCACCTTGAGGTCCTTGAGGTCCAGTAGCACCTTGCGCACCCGCCGGTCCTTGAGGCCCGGTAGCACCAGTAGCACCCGCCGGTCCTTGAGGCCCAGTAGCACC

>NZ_CP015589|2|1|3088728-3089112|CRT
TGAGGTCCTTGAGGTCCTTGAGGTCCAGTAGCACC	AGTAGCCCCCGCAGGTCCT
TGGATACCTTGAGGTCCTTGAGGTCCAGTAGCACC	AGTAGCCCCCGCAGGTCCT
TGGATACCTTGAGGTCCTTGAGGTCCAGTAGCACC	AGTAGCCCCGCAGGTCCT
TGGATACCTTGAGGTCCTTGAGGTCCAGTAGCGCC	AGTAGCACCAGTAGCCCCTGCTGGTCCT
TGGATACCTTGAGGTCCTTGAGGTCCAGTAGCACC	TTGAACACCTGCTGGTCCT
TGAGCACCTTGAGGTCCTTGAGGTCCAGTAGCACC	TTGCGCACCCGCCGGTCCTTGAGGCCCGGTAGCACCA
GTAGCACCCGCCGGTCCTTGAGGCCCAGTAGCACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015589.1\|WP_001265563.1\|3087625_3088054_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015589.1\|WP_000380267.1\|3083515_3084514_-\|inorganic-phosphate-transporter	unknown	unknown	gnl\|CDD\|376541
NZ_CP015589.1\|WP_000110703.1\|3095329_3096037_-\|purine-nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|180275
NZ_CP015589.1\|WP_000231448.1\|3084525_3085146_-\|DUF47-domain-containing-protein	unknown	unknown	gnl\|CDD\|224310
NZ_CP015589.1\|WP_000882907.1\|3082072_3082300_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015589.1\|WP_001094858.1\|3092417_3092612_-\|DUF3924-domain-containing-protein	unknown	unknown	gnl\|CDD\|289807
NZ_CP015589.1\|WP_000806236.1\|3092723_3093254_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271192
NZ_CP015589.1\|WP_000583785.1\|3099777_3100167_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015589.1\|WP_000067568.1\|3100188_3100680_+\|YpuI-family-protein	unknown	unknown	gnl\|CDD\|379028
NZ_CP015589.1\|WP_000735531.1\|3079470_3079989_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015589.1\|WP_001978230.1\|3093361_3095173_-\|HAMP-domain-containing-sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|274368
NZ_CP015589.1\|WP_000794477.1\|3078258_3079356_+\|site-2-protease-family-protein	unknown	unknown	gnl\|CDD\|100081
NZ_CP015589.1\|WP_000010857.1\|3097005_3099591_-\|bifunctional-lysylphosphatidylglycerol-flippase/synthetase-MprF	unknown	unknown	gnl\|CDD\|225451
NZ_CP015589.1\|WP_000769279.1\|3085458_3087501_+\|PBP1A-family-penicillin-binding-protein	unknown	unknown	gnl\|CDD\|273955
NZ_CP015589.1\|WP_000947715.1\|3080148_3081357_+\|NO-inducible-flavohemoprotein	unknown	unknown	gnl\|CDD\|237337
NZ_CP015589.1\|WP_071679331.1\|3089846_3091118_-\|PAS-domain-containing-sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|236901
NZ_CP015589.1\|WP_000600577.1\|3081389_3081902_-\|Crp/Fnr-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223736
NZ_CP015589.1\|WP_071679332.1\|3091278_3092127_+\|DUF72-domain-containing-protein	unknown	unknown	gnl\|CDD\|224714
NZ_CP015589.1\|WP_000455757.1\|3082595_3083396_-\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
NZ_CP015589.1\|WP_061402064.1\|3096212_3097001_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP015589.1\|WP_000380267.1\|3083515_3084514_-\|inorganic-phosphate-transporter	gnl\|CDD\|376541	pfam01384, PHO4, Phosphate transporter family. This family includes PHO-4 from Neurospora crassa which is a is a Na(+)-phosphate symporter. This family also contains the leukaemia virus receptor.	4.53763e-106
NZ_CP015589.1\|WP_001094858.1\|3092417_3092612_-\|DUF3924-domain-containing-protein	gnl\|CDD\|289807	pfam13062, DUF3924, Protein of unknown function (DUF3924). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 60 amino acids in length.	1.20247e-25
NZ_CP015589.1\|WP_000231448.1\|3084525_3085146_-\|DUF47-domain-containing-protein	gnl\|CDD\|224310	COG1392, COG1392, Phosphate transport regulator (distant homolog of PhoU) [Inorganic ion transport and metabolism].	6.30259e-51
NZ_CP015589.1\|WP_000806236.1\|3092723_3093254_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271192	cd01192, INT_C_like_3, Uncharacterized site-specific tyrosine recombinase, C-terminal catalytic domain. Tyrosine recombinase (integrase) belongs to a DNA breaking-rejoining enzyme superfamily. The catalytic domain contains six conserved active site residues. The recombination reaction involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	2.9028e-41
NZ_CP015589.1\|WP_000010857.1\|3097005_3099591_-\|bifunctional-lysylphosphatidylglycerol-flippase/synthetase-MprF	gnl\|CDD\|225451	COG2898, COG2898, Uncharacterized conserved protein [Function unknown].	8.5969e-139
NZ_CP015589.1\|WP_000110703.1\|3095329_3096037_-\|purine-nucleoside-phosphorylase	gnl\|CDD\|180275	PRK05819, deoD, DeoD-type purine-nucleoside phosphorylase.	1.55798e-167
NZ_CP015589.1\|WP_000067568.1\|3100188_3100680_+\|YpuI-family-protein	gnl\|CDD\|379028	pfam13047, DUF3907, Protein of unknown function (DUF3907). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 160 amino acids in length. There is a conserved AYTG sequence motif.	1.50424e-78
NZ_CP015589.1\|WP_001978230.1\|3093361_3095173_-\|HAMP-domain-containing-sensor-histidine-kinase	gnl\|CDD\|274368	TIGR02966, Phosphate_regulon_sensor_protein_PhoR, phosphate regulon sensor kinase PhoR. Members of this protein family are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter in most Proteobacteria. Related proteins from Gram-positive organisms are not included in this model. The phoR gene usually is adjacent to the response regulator phoB gene (TIGR02154). [Signal transduction, Two-component systems].	1.09434e-60
NZ_CP015589.1\|WP_000794477.1\|3078258_3079356_+\|site-2-protease-family-protein	gnl\|CDD\|100081	cd06160, S2P-M50_like_2, Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with additional putative N- and C-terminal transmembrane spanning regions, relative to the core protein, and no PDZ domains.	7.01635e-43
NZ_CP015589.1\|WP_000769279.1\|3085458_3087501_+\|PBP1A-family-penicillin-binding-protein	gnl\|CDD\|273955	TIGR02074, Includes:_Penicillin-insensitive_transglycosylase, penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NZ_CP015589.1\|WP_000600577.1\|3081389_3081902_-\|Crp/Fnr-family-transcriptional-regulator	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	5.93702e-22
NZ_CP015589.1\|WP_071679331.1\|3089846_3091118_-\|PAS-domain-containing-sensor-histidine-kinase	gnl\|CDD\|236901	PRK11360, PRK11360, two-component system sensor histidine kinase AtoS.	9.51504e-68
NZ_CP015589.1\|WP_000947715.1\|3080148_3081357_+\|NO-inducible-flavohemoprotein	gnl\|CDD\|237337	PRK13289, PRK13289, NO-inducible flavohemoprotein.	0
NZ_CP015589.1\|WP_071679332.1\|3091278_3092127_+\|DUF72-domain-containing-protein	gnl\|CDD\|224714	COG1801, COG1801, Uncharacterized conserved protein [Function unknown].	9.71492e-74
NZ_CP015589.1\|WP_000455757.1\|3082595_3083396_-\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	4.79544e-37

>NZ_CP015589.1|WP_001265563.1|3087625_3088054_-|hypothetical-protein
MRVMSLIRIWFALMVCIILCVGFFLTLKYSTISKAERKTAPYKLLYTKQSNIPYSNATKNEKKVIKGMLITKASSSEALLQIAETIKDQYTNKKIDEITLSIHNENNGNYEEELPYEPISKGKIIVTYDSESFGSTNIVLNE
>NZ_CP015589.1|WP_000769279.1|3085458_3087501_+|PBP1A-family-penicillin-binding-protein
MKLKNTHLKKMQEWFNKRKKLRNSLIILGSLLATLFIAINIIISIQDISELKQAVPQPTLIYDANNEVATKLASSKTEGVKKKDIPDIMVQAIVAVEDKGFFNHHGIYYSGIISAVFKNITAGEVVAGGSTITQQLAKNVFLTQDRTYSRKIKEYFLTKKIERTYTKDEIIEMYMNQIYFGEGAWGIKRAAKSYFDKDVKDLTISEAATIAGLIKAPSAYSPYKNFNKSIERRNVVLSLMKEQGYISDEQYNKEKESGLVLKRGVDDKYKGKYSQYVDYIVREAMDKYELTQNEILAGGYRIYTELDPKKQQAVEDVVNNDSYFKDSGSDQLMQTGVVLMNPKTGGVPALVGGRGPYQFLQFNHATQLKRQPGSTLKPLAVYVPALEQGYEVYDILKDEPFNIKEYKPQNSDHTFHGDVTMYEAVAKSYNVSAVWLLEQIGLDKGLKSLERFGIPLVPEDRTYPIALGGMHVGTSPFVMAQAYSTFANDGVQVEAHAIREIQNAEGETLGKWYKKETRVTSEKISQKMTYLLKGVVEKGTGEKAKVNNVDTAGKTGTTQIVNGPSTGAKDSWFVGYTPDLVGAIWVGYDKTDSDHYVPGGSQITTTMFRDIMKKANANPAQKAFQLSLISEADYKKQLTTIEEEKRRKEEEKRRKEEEQQRKQEQQEWLDKVKEWIPSFW
>NZ_CP015589.1|WP_000231448.1|3084525_3085146_-|DUF47-domain-containing-protein
MVFKSKKDKFSEMLMNVSENLKEGAQFFVEYKIKNASDLKEFSMRMKEYESKGDSFIHEIIMELNKAFITPIEREDILQLAMSMDDVLDGLDHSAGLFEMYSITEADEYMIKFVEAINQCAIEIANSVELMSNKKLVDIRTNAIKIKDYESQCDDIRRHAIKHLFSREKDPIKIIQYKEIYEELEEVADSCQSVANVLETIIMKNA
>NZ_CP015589.1|WP_000380267.1|3083515_3084514_-|inorganic-phosphate-transporter
MDTLLILTVLVVICALAFDFINGFHDTANAIATAVSTKALKPRHAIIMAAIMNFLGAMTFTGVAKTITKDIVDPFALPNGSLVILAALLAAIAWNLITWYYGIPSSSSHAIIGSIAGAAIAAAGFSSLNFKGFIKILEALIISPIIAFVIGYIVYSIFKVVFKNFNLTKTNKNFRIFQIFTAALQAYTHGTNDAQKAMGIITMALMANNYHTSSDIPFWVQLSCAIAMGLGTSVGGWKIIKTVGGQIMKIRPVNGVAADLSSSLVIFGATFIHLPVSTTHVISSSILGVGASHRVKGVKWGTAKRMLITWVITLPISASLAALFYSLLHLIF
>NZ_CP015589.1|WP_000455757.1|3082595_3083396_-|sulfite-exporter-TauE/SafE-family-protein
MEYIMLLFIGLIAGTVGSLVGLGGGIIIVPLLIGLHSLSPQLAVGTSMVTVVFTGLSSTLTYMKHKRVDYKSGLILFIGSGPGGIIGSWANKFLNQDTFSLYFGIFLIFVSILLMLRDKLKPLSLSNMTVIKRSFTDNEGNTVHYQFPPLLAIFIAFIVGFISGLFGIGGGALLVPAMMLLFAFPAHIAVATSMFIVFLSAIVSSATHISLGNVSWIYALILIPGAWIGGKIGAYINTKLSGKAVINLLRITLIILGTRLIITSFL
>NZ_CP015589.1|WP_000882907.1|3082072_3082300_+|hypothetical-protein
MLDAIKMTDMRIPANAIIHVEEMKGGVVLSVEVDGQIIYTMAYDEETDSYAELYDRNDKRACQVHEDFMGWSLLH
>NZ_CP015589.1|WP_000600577.1|3081389_3081902_-|Crp/Fnr-family-transcriptional-regulator
MILHKGDVLFRQGEDGPLYFIKTGLLKVVRIEEDGTPFLFNIIVPGETIPHHSLISPKEYHGTAIALMKTEVEPIMSNEWYDQLQANPASYANIAMQLQSKLRMMQQRIDQLTTVSPKERLHRLQEWFTLYLGDIPIYEILTQTEIGQLIGIRRETVNRLLREQIKNEAK
>NZ_CP015589.1|WP_000947715.1|3080148_3081357_+|NO-inducible-flavohemoprotein
MLSEKTIEIVKSTVPLLQEKGVEITTRFYEILFSEHPELLNIFNHTNQKKGRQQQALANAVYAAATYIDNLEAIIPVVKQIGHKHRSLGIKAEHYPIVGTCLLRAIKEVAGAPDEVLNAWGEAYGVIADAFISIEAEMYEEAAHKEGGWKDFRNFVVVKKVKESDVITSFYVKPEDGGKVSSFIPGQYVTVQINIEGETYTHNRQYSLSDAPGKEYYRISVKKEKGVDTPDGKVSNYLHDHVKEGDTLPVSAPAGDFVLNMDSTLPVVLISGGVGITPMMSMLNTLIEQNSKRNVCFVHAAINSNTHAMKEHVEAVDNEYEQVKSYTCYSAPTEKDLEMKNFDKEGFVEREWLQTIIPTTEAEFYFCGPVAFMKQINAALTDLGVKQEHIHYEFFGPAASLQ
>NZ_CP015589.1|WP_000735531.1|3079470_3079989_+|hypothetical-protein
MKKLLSVFGIIIVMIIASYSLMKVLLHYANKPAGVSTTAEIEDVQEETKVLDFIRMTHESYNNFLNYGKAENYTEGDWNQFKQWFQQQESSLKNIHKDIKNEKIKRDVNRSYEIVKKGVELQNMEFVVYAHRVYHDLDIIVNKYRGETNIWGYTEFGDGKDIRVIEQAIQSK
>NZ_CP015589.1|WP_000794477.1|3078258_3079356_+|site-2-protease-family-protein
MKNNKKGLWGIIVAIGLFLLSKLKWVFAIFKLAKFSTVFSMFLSLGAYAVIYGWKFGVALIYLLFIHEMGHLWAAKRKGIPTSPAIFIPFMGALIGMKEMPKNAKDEAYIAYMGPLFGLLSFLPAIPLYMITKEPFWALIILLGSMINFFNLIPVSPLDGGRIISVISTKIWGAGLVLLLGYSIYFKSILGGLIFIIGCMELYRVIKRDEPIKELGYRIDGMKEYIASLEEELKETGAVHRNIYMMQHEINVLRQKEREKELKTGELQKIEVLEYLLRKFEPLDYVPYEDEKETHTIHIREAFEMSERKLQEWDAEKRQQENYYKVDTKTKWTVFACYIGLMAILGYTAYEGYIVLQEHLPTRNV
>NZ_CP015589.1|WP_071679331.1|3089846_3091118_-|PAS-domain-containing-sensor-histidine-kinase
MLPKDDIVSHEKRIEELENKVRFYEELVNQLPHHFTYKNPHIGLQIKKTRSTHSIQNIQKENKEADFQLTCDSLFLFKQLETYFVHIFDAFSHHVTFVDNKGNITLCNQAAADDFGVVRNDIIGKPIQQLLKLPEEKIKALETLRTGTEIYNEEVLDKNYGILNNRIIRDYNGEIFRVISVFHYLNTERDAEKFSLAGRIAAGIAHEVRNPLTTVRGYLQFLQESVSPSNKELFKNLLIPELDRANSIITKFLSISKTREFKREPFPINTFLREYIQQLLASEVFLHNISINYNFSTELDDILVHIDRHELVQVFLNLFQNAVDAQGEKKISIQIASYRLDNFVRITFTDNGTGIPPAIQEYIFDPFFSTKDSGTGLGLSVTKKIIQNHNGTLKMTSNEDGTTFTISIPILPKTALERLNQYK
>NZ_CP015589.1|WP_071679332.1|3091278_3092127_+|DUF72-domain-containing-protein
MLFIGVTGWGDHDSLYIDPYENRNKLRTYSEYFPIVEVDSSFYAMQPARNYTKWAMETPKDFSFIVKAYQGMTGHMKGEIPFSTFDEMFDVYKQSIFPLIEAGKLKTILFQYPPWFDCKKKNVDFLRYTKEKMEGLPCAIEFRNQTWFYPEMRDKTLQFLEQEKWIHTICDEPQAGMGSVPLVLEVTNAEMVLIRFHGRNVHGWLDKGENWRAVRCLYRYNNKELEEWVERLEQLKKKTKDIYVLFNNNSGGDAADNAKQLMKMMNITYGEPKPEQLNLFET
>NZ_CP015589.1|WP_001094858.1|3092417_3092612_-|DUF3924-domain-containing-protein
MNTLTIELPKETAEKLDLLKQAYEKKTGASISESTLVQTLISKEFIQAITPFDLQQFITGKEQH
>NZ_CP015589.1|WP_000806236.1|3092723_3093254_-|tyrosine-type-recombinase/integrase
MKQAGQPIQNEKQLETIKNILLQSSKRDGLLFVLAVNSGLKVSEILQLKVSDVIDENENVRHSILFYNEKVKKHKWFAVNEDLQHAIEDYMKERKTWKRNEPLLKSQKGTKSITRQHAWYILNKAAKEVGLEGISSHTLRKTWGYCAYKSGVDIAFLQHFFDHSTPSKTLKYIGIA
>NZ_CP015589.1|WP_001978230.1|3093361_3095173_-|HAMP-domain-containing-sensor-histidine-kinase
MKNRSIVFKLFLLTSTLFTIIFLLFFLGQSLFLEKFYINKKVKTVQTAFEKFVDTYEKSGKSSEEIRKLKQEFHDKTNADMQFLSPEGIIKSDNNYYIDVINPKNSETYSIPLNNLLTPEEYKKFENLGLKKDDMINVVGLVRGKTITPLELTTSYNRWQNERINSDFSSINGNPSKNRLTSRYKTVTQIEFTGIVSKLQLPSKAEVRLANDIETLQAVQYFAELIRNGTANSQQLNTYIIDGGENIKNSIFVKPIMENGKITEYAFAIASLQPVNEAMLVLKDYYVYALIIVFLVIILLSFYYSKIIVKPLIKINRVTKKMANFDFSEKLPVTADDEIGGLSGSINTLSVNLKDRIDRLNVANTKLQQDIERERQLEKTRKEFISGVSHELKTPLSVIRSFAEGIKDGVSKDTTYYTDVILEETENMNRLIVEMLELAKLESGTYKLDMTTFSIGELIQQVYTKLLFSMEEKHLQVNIDVEPSIFVKANRSRIEQVVVNLLSNAIRYTPDGEKIQVSVIAMEDTVKVEIENTGNPIPEESLEKIWDRFYRLDASRSRHTGGTGLGLSIVKNILDLHHTEYGVYNTTNSVVFYFNLQKVKEVK
>NZ_CP015589.1|WP_000110703.1|3095329_3096037_-|purine-nucleoside-phosphorylase
MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDIVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIALDAAIQQ
>NZ_CP015589.1|WP_061402064.1|3096212_3097001_+|hypothetical-protein
MVGDVLKNLVIGLVALLFVVVGGFYIKKYQETTETVSDVQEVKWDVSNRKGNEKADILFQLLNNKNSEVRGVNDQIRAVIVDGQLKHVQQMKPTFAGNGSYKVSSKIAKDEGYTIFLYEDKNKSVQSFAKKDFGKEIDEKNKKKVKFPIDSVLTKKIGEYEVSLLFGALHPNEPVTLTFQFQAKKGEKLKLHSERGEVEALYIVDETRENFLYAIPVDTDEQLQYRITFPAEGTYKIWGDFYINGKKYEKEFIVQVQKRKNS
>NZ_CP015589.1|WP_000010857.1|3097005_3099591_-|bifunctional-lysylphosphatidylglycerol-flippase/synthetase-MprF
MSFSWKRFLQIGKIIFPFVVLTIVFFQAKKELAGISFLEAINTIKNIPTGGVFLAITLGAFAVSTMFFYDYVMLRYLKADIPVQKIFRISWIANTLNGFIGFGGLVGAGVRTMLYRPYIKENGKLIKSIAWMTTAFINGLAILSFLGLIGILDTSFILHEKPWLWPVLIFFALFVPIYIGFSKLKNRKPKQTEGQDEGEEEKNPTVLYSLVSLVEWVSAGIVMYVILILFGIDIEFQKFLGVYVIAALAGVVSLVPGGLGSFDLVFLTGLGQYGIDTGVLLPAMLLYRLVYYILPFCLGLIFAAFEMTGVAIKKFEDKPFIAPALETTGVIWTLQRDFLGKLGSWASAALTVFAGLMVILSTILPTSINRAHALHILAPKHLIQFSFSLSLTFGILLLILSRGIYYGTKRSYYMTIISLIGAAIFNTLKGIDIEETFILLIVLAVLYMLRKRFVREKMEVSLSDIVKVFIFLLITLYLYKNLGILFAGAKEAFKPDFVVRNITQVKRSALAAAFFVPTFLLIGSLIANRYRNEFPGQPANDKRLQNFLDEHGGNVLSHLGFLGDKQFFFSSDGKALLLFSITGKRLVVLGDPIGDPSSYRTVLQEFLAEADRFGYICVFYQIESKWMSLYHDFGYNFFKLGEEAVVDLNTFTITGKKRAGMRATFNRFEREGYTFSIHQPPFSNELFEELRKVSDAWLGGKKEKSFSLGYFDREYISRAPIATLSDADGKIIAFTTFMPVYQDGSLSVDLMRYYPDAPSGIMDAIFIHLFQWAKENEYHSFNIGMAPLSNVGLSTQSFWSERVAAAIFNNVRYTYSFSGLRHFKEKYKPAWSGKYLAFRKNHSLPITMLSVTKLIGKRKNS
>NZ_CP015589.1|WP_000583785.1|3099777_3100167_+|hypothetical-protein
MIIIGYAGYELEKAKPNTSEDFFNRSEVTYILNDKERTFSVLYVRYFEEVLQEITPFEGNPVCKVENQDIYLRDIVAICCLLKENELRMQKRLYLNNIEEFQQYFDEEIVVKVQEILAELHKNKRVEIA
>NZ_CP015589.1|WP_000067568.1|3100188_3100680_+|YpuI-family-protein
MSNLMVENQTEQVSMFLEDVIHLITNYVNYHTLPSLLEETPAGNEQYYKGLLGSIRRLLVFCEEGHDACFVLLNSQPFRKTAAEKILYKIYHQVIAEFFSPKSDHWYENSRSAYTGKNSIVFQQTPPASIEQVMKNLEGKFQLMREELEYYETDYQTKMLHKY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP015589_2	2.1\|3088763\|19\|NZ_CP015589\|CRT	3088763-3088781	19	NZ_CP015589.1	3088700-3088718	0	1.0
NZ_CP015589_2	2.1\|3088763\|19\|NZ_CP015589\|CRT	3088763-3088781	19	NZ_CP015589.1	100-118	2	0.895
NZ_CP015589_2	2.2\|3088817\|19\|NZ_CP015589\|CRT	3088817-3088835	19	NZ_CP015589.1	3088700-3088718	0	1.0
NZ_CP015589_2	2.2\|3088817\|19\|NZ_CP015589\|CRT	3088817-3088835	19	NZ_CP015589.1	100-118	2	0.895
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NZ_CP015589.1	3088691-3088718	2	0.929

1. spacer 2.1|3088763|19|NZ_CP015589|CRT matches to position: 3088700-3088718, mismatch: 0, identity: 1.0

agtagcccccgcaggtcct	CRISPR spacer
agtagcccccgcaggtcct	Protospacer
*******************

2. spacer 2.1|3088763|19|NZ_CP015589|CRT matches to position: 100-118, mismatch: 2, identity: 0.895

agtagcccccgcaggtcct	CRISPR spacer
agtagcaccagcaggtcct	Protospacer
****** ** *********

3. spacer 2.2|3088817|19|NZ_CP015589|CRT matches to position: 3088700-3088718, mismatch: 0, identity: 1.0

agtagcccccgcaggtcct	CRISPR spacer
agtagcccccgcaggtcct	Protospacer
*******************

4. spacer 2.2|3088817|19|NZ_CP015589|CRT matches to position: 100-118, mismatch: 2, identity: 0.895

agtagcccccgcaggtcct	CRISPR spacer
agtagcaccagcaggtcct	Protospacer
****** ** *********

5. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to position: 3088691-3088718, mismatch: 2, identity: 0.929

agtagcaccagtagcccctgctggtcct	CRISPR spacer
agtagcaccagtagcccccgcaggtcct	Protospacer
******************.** ******

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	MN693405	Marine virus AFVG_25M416, complete genome	18916-18943	4	0.857
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	MN693333	Marine virus AFVG_25M417, complete genome	18916-18943	4	0.857
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NZ_CP010614	Phaeobacter inhibens strain P92 plasmid pP92_d, complete sequence	39012-39039	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NZ_CP010626	Phaeobacter inhibens strain P51 plasmid pP51_c, complete sequence	38706-38733	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NZ_CP010671	Phaeobacter inhibens strain P57 plasmid pP57_c, complete sequence	38791-38818	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NZ_CP010678	Phaeobacter gallaeciensis strain P75 plasmid pP75_e, complete sequence	39068-39095	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NC_023142	Phaeobacter gallaeciensis DSM 26640 plasmid pGal_F69, complete sequence	39097-39124	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NZ_CP010789	Phaeobacter gallaeciensis strain P63 plasmid pP63_e, complete sequence	39062-39089	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NZ_CP010598	Phaeobacter inhibens strain P10 plasmid pP10_c, complete sequence	39287-39314	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NZ_CP010633	Phaeobacter inhibens strain P78 plasmid pP78_d, complete sequence	41547-41574	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NZ_CP016368	Phaeobacter porticola strain P97 plasmid pP97_d, complete sequence	38570-38597	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NZ_CP010605	Phaeobacter inhibens strain P83 plasmid pP83_f, complete sequence	39153-39180	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NZ_CP010744	Phaeobacter inhibens strain P59 plasmid pP59_c, complete sequence	38768-38795	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NZ_CP010622	Phaeobacter inhibens strain P30 isolate M4-3.1A plasmid pP30_e, complete sequence	38791-38818	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NZ_CP010732	Phaeobacter inhibens strain P88 plasmid pP88_g, complete sequence	39009-39036	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NZ_CP010642	Phaeobacter gallaeciensis strain P73 plasmid pP73_f, complete sequence	39068-39095	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NZ_CP010655	Phaeobacter inhibens strain P54 plasmid pP54_e, complete sequence	38718-38745	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NZ_CP010711	Phaeobacter inhibens strain P66 plasmid pP66_f, complete sequence	39153-39180	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NZ_CP010702	Phaeobacter inhibens strain P24 plasmid pP24_f, complete sequence	38833-38860	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NZ_CP010748	Phaeobacter inhibens strain P48 isolate M21-2.3 plasmid pP48_c, complete sequence	38774-38801	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NZ_CP019311	Phaeobacter inhibens strain DOK1-1 plasmid pDOK1-1-4, complete sequence	6263-6290	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NZ_CP010593	Phaeobacter gallaeciensis strain P11 plasmid pP11_e, complete sequence	39094-39121	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NZ_CP010739	Phaeobacter inhibens strain P72 plasmid pP72_d, complete sequence	38930-38957	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NC_018288	Phaeobacter inhibens DSM 17395 plasmid pPGA1_65, complete sequence	27058-27085	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NZ_CP031955	Phaeobacter inhibens strain 2.10 plasmid unnamed3, complete sequence	32538-32565	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NC_018422	Phaeobacter inhibens 2.10 plasmid pPGA2_71, complete sequence	32302-32329	6	0.786
NZ_CP015589_2	2.4\|3088924\|28\|NZ_CP015589\|CRT	3088924-3088951	28	NC_017974	Cronobacter phage CR3, complete genome	7823-7850	6	0.786

1. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to MN693405 (Marine virus AFVG_25M416, complete genome) position: , mismatch: 4, identity: 0.857

agtagcaccagtagcccctgctggtcct	CRISPR spacer
agtagcaccagtagctccggctggtatt	Protospacer
***************.** ****** .*

2. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to MN693333 (Marine virus AFVG_25M417, complete genome) position: , mismatch: 4, identity: 0.857

agtagcaccagtagcccctgctggtcct	CRISPR spacer
agtagcaccagtagctccggctggtatt	Protospacer
***************.** ****** .*

3. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NZ_CP010614 (Phaeobacter inhibens strain P92 plasmid pP92_d, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

4. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NZ_CP010626 (Phaeobacter inhibens strain P51 plasmid pP51_c, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

5. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NZ_CP010671 (Phaeobacter inhibens strain P57 plasmid pP57_c, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

6. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NZ_CP010678 (Phaeobacter gallaeciensis strain P75 plasmid pP75_e, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

7. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NC_023142 (Phaeobacter gallaeciensis DSM 26640 plasmid pGal_F69, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

8. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NZ_CP010789 (Phaeobacter gallaeciensis strain P63 plasmid pP63_e, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

9. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NZ_CP010598 (Phaeobacter inhibens strain P10 plasmid pP10_c, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

10. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NZ_CP010633 (Phaeobacter inhibens strain P78 plasmid pP78_d, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

11. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NZ_CP016368 (Phaeobacter porticola strain P97 plasmid pP97_d, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

12. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NZ_CP010605 (Phaeobacter inhibens strain P83 plasmid pP83_f, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

13. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NZ_CP010744 (Phaeobacter inhibens strain P59 plasmid pP59_c, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

14. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NZ_CP010622 (Phaeobacter inhibens strain P30 isolate M4-3.1A plasmid pP30_e, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

15. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NZ_CP010732 (Phaeobacter inhibens strain P88 plasmid pP88_g, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

16. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NZ_CP010642 (Phaeobacter gallaeciensis strain P73 plasmid pP73_f, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

17. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NZ_CP010655 (Phaeobacter inhibens strain P54 plasmid pP54_e, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

18. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NZ_CP010711 (Phaeobacter inhibens strain P66 plasmid pP66_f, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

19. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NZ_CP010702 (Phaeobacter inhibens strain P24 plasmid pP24_f, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

20. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NZ_CP010748 (Phaeobacter inhibens strain P48 isolate M21-2.3 plasmid pP48_c, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

21. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NZ_CP019311 (Phaeobacter inhibens strain DOK1-1 plasmid pDOK1-1-4, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

22. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NZ_CP010593 (Phaeobacter gallaeciensis strain P11 plasmid pP11_e, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

23. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NZ_CP010739 (Phaeobacter inhibens strain P72 plasmid pP72_d, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

24. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NC_018288 (Phaeobacter inhibens DSM 17395 plasmid pPGA1_65, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

25. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NZ_CP031955 (Phaeobacter inhibens strain 2.10 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

26. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NC_018422 (Phaeobacter inhibens 2.10 plasmid pPGA2_71, complete sequence) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
cgcagcaccagaagcccctgcgggtcgg	Protospacer
 *.******** ********* ****

27. spacer 2.4|3088924|28|NZ_CP015589|CRT matches to NC_017974 (Cronobacter phage CR3, complete genome) position: , mismatch: 6, identity: 0.786

agtagcaccagtagcccctgctggtcct	CRISPR spacer
tgccgggccagttgcccctgctggtcct	Protospacer
 *. * .***** ***************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

786757 : 794437

Staphylococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000221087.1\|786757_787681_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.4e-46	44.0
WP_071678950.1\|787805_788741_-	HAMP domain-containing histidine kinase	Q8QNA2	Ectocarpus_siliculosus_virus	2.5e-11	25.9
WP_000018034.1\|788742_789435_-	response regulator transcription factor	B5LWA6	Feldmannia_species_virus	1.4e-06	28.8
WP_001293578.1\|789603_789777_+	hypothetical protein	NA	NA	NA	NA
WP_001014308.1\|789777_789972_+	YwbE family protein	NA	NA	NA	NA
WP_001255958.1\|790011_791211_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	6.1e-71	41.2
WP_000587814.1\|791507_791831_+	heme oxygenase	NA	NA	NA	NA
WP_033701790.1\|791896_792661_-	class B sortase	NA	NA	NA	NA
WP_000403735.1\|792693_793464_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.2e-13	26.1
WP_001036825.1\|793453_794437_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	5.5e-17	26.6

DBSCAN-SWA_2

1993656 : 2002028

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000625683.1\|1993656_1994964_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	6.4e-21	25.3
WP_001170542.1\|1995052_1995772_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	5.2e-49	44.3
WP_000278820.1\|1995764_1996019_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_000666779.1\|1996015_1996699_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000055574.1\|1996682_1998902_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	4.4e-163	41.3
WP_000879022.1\|1998886_2000302_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	9.5e-55	35.2
WP_001262445.1\|2000403_2001444_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	3.2e-68	45.9
WP_071679123.1\|2001440_2002028_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.0e-26	35.3

DBSCAN-SWA_3

3530090 : 3539407

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000755543.1\|3530090_3531359_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	7.6e-11	32.0
WP_000453900.1\|3532460_3534221_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.2e-270	96.7
WP_074562423.1\|3534282_3534987_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.9e-121	93.2
WP_071679420.1\|3534983_3536057_+	sensor histidine kinase	W8CYF6	Bacillus_phage	2.6e-169	87.4
WP_000818985.1\|3536863_3537583_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_000061723.1\|3537730_3538402_+	O-methyltransferase	W8CYT3	Bacillus_phage	7.7e-63	89.8
WP_061401780.1\|3538534_3539407_+	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	1.4e-64	44.0

DBSCAN-SWA_4

3951605 : 3989365

Bacillus_phage(76.92%)

capsid,terminase,head,portal,tail,protease,holin,integrase

attL 3951512:3951528|attR 3994623:3994639

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3951512:3951528	attL	NA	NA	NA	NA
WP_071679564.1\|3951605_3952712_-\|integrase	site-specific integrase	A0A0U3U8Y8	Bacillus_phage	9.8e-124	68.8
WP_000791796.1\|3954696_3954852_+	hypothetical protein	NA	NA	NA	NA
WP_000367270.1\|3955115_3955466_-	helix-turn-helix transcriptional regulator	A0A288WFW4	Bacillus_phage	4.8e-16	37.9
WP_001192728.1\|3955651_3955876_+	helix-turn-helix transcriptional regulator	A0A288WG89	Bacillus_phage	3.6e-09	45.1
WP_000522183.1\|3955916_3956183_+	helix-turn-helix domain-containing protein	A0A0U3ULL9	Bacillus_phage	2.0e-27	72.9
WP_000390253.1\|3956182_3956347_+	hypothetical protein	A0A0U3B230	Bacillus_phage	1.0e-13	63.0
WP_001048905.1\|3956376_3956553_+	hypothetical protein	A0A1B1P7U0	Bacillus_phage	9.4e-21	86.2
WP_071679565.1\|3956557_3957277_+	DnaD domain protein	A0A1B1P7T6	Bacillus_phage	5.8e-93	85.5
WP_071679566.1\|3957245_3958049_+	ATP-binding protein	A0A1B1P7U2	Bacillus_phage	3.3e-145	98.5
WP_071679567.1\|3958065_3958260_+	hypothetical protein	A0A0U3K3J8	Bacillus_phage	2.4e-25	85.9
WP_071679568.1\|3958285_3958459_+	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	6.2e-25	96.5
WP_071679569.1\|3958473_3958728_+	hypothetical protein	A0A0U3SU43	Bacillus_phage	6.1e-37	89.3
WP_071679570.1\|3958739_3959165_+	hypothetical protein	A0A1B1P8B9	Bacillus_phage	4.2e-14	41.9
WP_070184135.1\|3959180_3959636_+	nucleoside triphosphate pyrophosphohydrolase family protein	A0A0U4IBD0	Bacillus_phage	2.4e-20	48.2
WP_071679571.1\|3959708_3960239_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_065212698.1\|3960770_3960965_-	hypothetical protein	NA	NA	NA	NA
WP_001123250.1\|3961922_3962207_-	DUF4183 domain-containing protein	NA	NA	NA	NA
WP_071679572.1\|3962396_3962519_+	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_071679573.1\|3962539_3962722_+	hypothetical protein	NA	NA	NA	NA
WP_071679574.1\|3962828_3962999_+	hypothetical protein	A0A1B0T6D0	Bacillus_phage	2.4e-05	57.1
WP_071679575.1\|3963026_3963509_+	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	6.5e-72	81.9
WP_071679576.1\|3963508_3964051_+\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	1.0e-89	92.2
WP_071679577.1\|3964444_3964822_+	hypothetical protein	NA	NA	NA	NA
WP_071679578.1\|3965293_3966148_+	alpha/beta hydrolase	A0A2D1G9V4	Mycobacterium_phage	8.4e-06	24.6
WP_000858032.1\|3966321_3966522_-	hypothetical protein	NA	NA	NA	NA
WP_071679579.1\|3967132_3967834_+	hypothetical protein	NA	NA	NA	NA
WP_071679580.1\|3968388_3968955_-	hypothetical protein	A0A1C8E9C5	Bacillus_phage	5.5e-30	43.7
WP_164971083.1\|3969055_3969205_+	hypothetical protein	NA	NA	NA	NA
WP_071679581.1\|3969191_3969404_+	hypothetical protein	A0A0S2GM40	Bacillus_phage	5.6e-28	91.4
WP_071679582.1\|3969539_3969794_+	hypothetical protein	A0A2H4J3B1	uncultured_Caudovirales_phage	1.9e-38	88.1
WP_071679583.1\|3969783_3970161_+	HNH endonuclease	A0A0S2GLI5	Bacillus_phage	2.4e-66	95.2
WP_000242929.1\|3970290_3970794_+\|terminase	phage terminase small subunit P27 family	A0A2H4J8E3	uncultured_Caudovirales_phage	2.3e-88	100.0
WP_071679584.1\|3970795_3972490_+\|terminase	terminase large subunit	A0A2H4JB98	uncultured_Caudovirales_phage	3.1e-312	99.5
WP_071679585.1\|3972678_3973932_+\|portal	phage portal protein	A0A2H4J371	uncultured_Caudovirales_phage	1.8e-235	96.9
WP_071679586.1\|3973918_3974629_+\|protease	Clp protease ClpP	W8CYT5	Bacillus_phage	5.3e-123	94.5
WP_071679587.1\|3974666_3975839_+\|capsid	phage major capsid protein	A0A2H4J387	uncultured_Caudovirales_phage	2.5e-194	89.2
WP_000244595.1\|3975859_3976138_+\|head,tail	phage gp6-like head-tail connector protein	H0USW7	Bacillus_phage	9.9e-41	95.6
WP_071679588.1\|3976134_3976458_+\|head	phage head closure protein	H0USW8	Bacillus_phage	2.0e-53	91.6
WP_071679589.1\|3976450_3976888_+	HK97 gp10 family phage protein	A0A288WGM7	Bacillus_phage	3.0e-76	99.3
WP_071679590.1\|3976884_3977244_+	DUF3168 domain-containing protein	A0A0S2GLE3	Bacillus_phage	8.0e-59	94.1
WP_000896773.1\|3977244_3977853_+\|tail	tail protein	A0A288WG55	Bacillus_phage	1.1e-103	98.5
WP_000779129.1\|3977902_3978220_+	hypothetical protein	A0A288WFU6	Bacillus_phage	2.9e-52	98.1
WP_164971085.1\|3978249_3978426_+	hypothetical protein	I3WTY5	Bacillus_phage	2.7e-20	84.5
WP_071679591.1\|3978441_3982293_+\|tail	phage tail tape measure protein	A0A2H4J380	uncultured_Caudovirales_phage	0.0e+00	93.5
WP_071679592.1\|3982307_3983798_+\|tail	phage tail protein	Q2LIB8	Bacillus_phage	7.9e-294	99.4
WP_071679593.1\|3983794_3987790_+	peptidase S74	Q2LIB7	Bacillus_phage	0.0e+00	93.1
WP_000398745.1\|3987828_3988065_+	hypothetical protein	A0A2H4J382	uncultured_Caudovirales_phage	1.5e-18	96.2
WP_071679594.1\|3988064_3988304_+\|holin	holin	A0A2H4J378	uncultured_Caudovirales_phage	1.1e-32	97.5
WP_071679595.1\|3988300_3989365_+	N-acetylmuramoyl-L-alanine amidase	A0A1B1P878	Bacillus_phage	3.6e-192	92.7
3994623:3994639	attR	NA	NA	NA	NA

DBSCAN-SWA_5

4290571 : 4298990

Geobacillus_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000124911.1\|4290571_4291765_-	glycosyl transferase family 1	Q0IKX4	Leucania_separata_nucleopolyhedrovirus	1.3e-07	28.5
WP_001058133.1\|4291850_4292531_-	SUMF1/EgtB/PvdO family nonheme iron enzyme	A0A075BUR2	Microcystis_phage	2.7e-31	39.2
WP_000720536.1\|4292677_4293181_-	DNA topology modulation protein	A0A097BYE2	Leuconostoc_phage	7.3e-42	45.5
WP_000502494.1\|4293177_4294107_-	phosphotransferase	NA	NA	NA	NA
WP_001093435.1\|4294122_4294518_-	DUF2809 domain-containing protein	NA	NA	NA	NA
WP_000655488.1\|4294583_4295291_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	4.3e-16	26.5
WP_000859040.1\|4295312_4295666_-	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_000288950.1\|4295679_4296087_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_042990568.1\|4296517_4297903_+	MBL fold metallo-hydrolase	Q0H255	Geobacillus_phage	1.7e-77	59.9
WP_000820165.1\|4297905_4298118_+	DUF3006 domain-containing protein	Q0H256	Geobacillus_phage	1.1e-12	54.4
WP_000540642.1\|4298183_4298990_-	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	2.1e-107	68.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP015592

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP015589

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection