CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP018029	Alteromonas mediterranea strain RG65 chromosome, complete genome	2 crisprs	DEDDh,cas3,Cas9_archaeal,csa3,WYL,DinG	0	0	3	0
NZ_CP018030	Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence	1 crisprs	DinG,csf5gr6,csf1gr8,csf2gr7,csf3gr5,DEDDh	0	15	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP018029_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018029_1

1747493-1747682

Orphan

Consensus_repeat	Method
TAGCGTGGGTGTCTTTGTAAG	CRT
TTTCATGATCGTTAGCGTGGGTGTCTTTGTAAGATGT	PILER-CR

3 spacers

DEDDh

The CRISPR arrays of NZ_CP018029_1

>merge|NZ_CP018029|1|1747493-1747682|CRT,PILER-CR
TAGTGTGGGTGTCATCGTTAGTTTCTGCATTTAACGCTGGGGCCAATTTTTCATTATCGTTAGCGTGGGTGTCTTTGTAAGTCGTCGCTACGGCTAATTGTTGTGTGCTGCTATCGTGGGTGTCTTTGTAAGATGTGTTCGACGCCTTCGGTGTTTCTTGCTCGTTAGCGTGGGTGTCTTTGTAAGCTGT

>NZ_CP018029|1|1|1747493-1747678|CRT
TAGTGTGGGTGTCATCGTTAG	TTTCTGCATTTAACGCTGGGGCCAATTTTTCATTATCGT
TAGCGTGGGTGTCTTTGTAAG	TCGTCGCTACGGCTAATTGTTGTGTGCTGC
TATCGTGGGTGTCTTTGTAAG	ATGTGTTCGACGCCTTCGGTGTTTCTTGCTCGT
TAGCGTGGGTGTCTTTGTAAG

>NZ_CP018029|1|1|1747541-1747682|PILER-CR
TTTCATTATCGTTAGCGTGGGTGTCTTTGTAAGTCGT	CGCTACGGCTAATTGTTGTGTGCTGCTATC
GTGGGTGTCTTTGTAAGATGTGTTCGACGCCTTCGGT	GTTTCTTGCTCGTTAGC
GTGGGTGTCTTTGTAAGCTGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018029.1\|WP_012518171.1\|1745124_1745544_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341392
NZ_CP018029.1\|WP_071951326.1\|1733672_1734908_+\|kynureninase	unknown	unknown	gnl\|CDD\|226363
NZ_CP018029.1\|WP_015067025.1\|1760561_1760864_+\|PilZ-domain-containing-protein	unknown	unknown	gnl\|CDD\|377796
NZ_CP018029.1\|WP_071968666.1\|1753198_1754590_+\|AraC-family-transcriptional-regulator-ligand-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|197666
NZ_CP018029.1\|WP_071968659.1\|1732540_1733680_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|224423
NZ_CP018029.1\|WP_071953208.1\|1735040_1736444_+\|transporter-substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270426
NZ_CP018029.1\|WP_071968668.1\|1762829_1763807_+\|NAD(P)H-quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|176180
NZ_CP018029.1\|WP_071968665.1\|1749091_1751797_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|273804
NZ_CP018029.1\|WP_071968661.1\|1740086_1743797_+\|response-regulator	unknown	unknown	gnl\|CDD\|236848
NZ_CP018029.1\|WP_071970573.1\|1738422_1739853_-\|exodeoxyribonuclease-I	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|236979
NZ_CP018029.1\|WP_015067023.1\|1754864_1756211_+\|Na+/H+-antiporter-NhaC-family-protein	unknown	unknown	gnl\|CDD\|224671
NZ_CP018029.1\|WP_012518176.1\|1752238_1753150_+\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|366403
NZ_CP018029.1\|WP_071968660.1\|1736640_1738296_-\|DUF342-domain-containing-protein	unknown	unknown	gnl\|CDD\|377177
NZ_CP018029.1\|WP_071968662.1\|1743916_1744960_+\|isoaspartyl-peptidase/L-asparaginase	unknown	unknown	gnl\|CDD\|366471
NZ_CP018029.1\|WP_071968667.1\|1756311_1760340_+\|ATP-dependent-RNA-helicase-HrpA	unknown	unknown	gnl\|CDD\|182986
NZ_CP018029.1\|WP_015066941.1\|1731271_1732447_+\|acetyl-CoA-C-acetyltransferase	unknown	unknown	gnl\|CDD\|180261
NZ_CP018029.1\|WP_012518181.1\|1761133_1761385_+\|DUF2061-domain-containing-protein	unknown	unknown	gnl\|CDD\|225746
NZ_CP018029.1\|WP_015066940.1\|1730518_1730926_-\|MerR-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133403
NZ_CP018029.1\|WP_071959068.1\|1761484_1762678_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|185082
NZ_CP018029.1\|WP_071968664.1\|1747903_1748950_-\|metallophosphoesterase	unknown	unknown	gnl\|CDD\|277324

Protein	Function_ID	Function_description	E-value
NZ_CP018029.1\|WP_012518171.1\|1745124_1745544_+\|CBS-domain-containing-protein	gnl\|CDD\|341392	cd04629, CBS_pair_bac, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains present in bacteria. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	9.06623e-51
NZ_CP018029.1\|WP_071951326.1\|1733672_1734908_+\|kynureninase	gnl\|CDD\|226363	COG3844, COG3844, Kynureninase [Amino acid transport and metabolism].	1.4591e-150
NZ_CP018029.1\|WP_015067025.1\|1760561_1760864_+\|PilZ-domain-containing-protein	gnl\|CDD\|377796	pfam07238, PilZ, PilZ domain. PilZ is a c-di-GMP binding domain which is found C terminal to pfam07317. Proteins which contain PilZ are known to interact with the flagellar switch-complex proteins FliG and FliM. This interaction results in a reduction of torque generation and induces CCW motor bias. This domain forms a beta barrel structure.	7.2413e-13
NZ_CP018029.1\|WP_071968666.1\|1753198_1754590_+\|AraC-family-transcriptional-regulator-ligand-binding-domain-containing-protein	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	1.98769e-12
NZ_CP018029.1\|WP_071968659.1\|1732540_1733680_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|224423	COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism].	1.18677e-13
NZ_CP018029.1\|WP_071953208.1\|1735040_1736444_+\|transporter-substrate-binding-domain-containing-protein	gnl\|CDD\|270426	cd13708, PBP2_BvgS_like_1, Putative sensor domain similar to BvgS; the type 2 periplasmic binding protein domain. BvgS is composed of two periplasmic domains homologous to bacterial periplasmic-binding proteins (PBPs), a transmembrane region followed successively by a cytoplasmic PAS (Per/ARNT/SIM), a Histidine-kinase (HK), a receiver and a Histidine phosphotransfer (Hpt) domains. The sensor protein BvgS can autophosphorylate and phosphorylate the response regulator BvgA. The BvgAS phosphorelay controls the expression of virulence factors in response to certain environmental stimuli in Bordetella pertussis. Its close homologs, Escherichia coli EvgS and Klebsiella pneumoniae KvgS, appear to be involved in the transcriptional regulation of drug efflux pumps and in countering free radical stresses and sensing iron limiting conditions, respectively. The periplasmic sensor domain of BvgS belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.7043e-86
NZ_CP018029.1\|WP_071968668.1\|1762829_1763807_+\|NAD(P)H-quinone-oxidoreductase	gnl\|CDD\|176180	cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase. PIG3 p53-inducible quinone oxidoreductase, a medium chain dehydrogenase/reductase family member, acts in the apoptotic pathway. PIG3 reduces ortho-quinones, but its apoptotic activity has been attributed to oxidative stress generation, since overexpression of PIG3 accumulates reactive oxygen species. PIG3 resembles the MDR family member quinone reductases, which catalyze the reduction of quinone to hydroxyquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	2.57213e-155
NZ_CP018029.1\|WP_071968665.1\|1749091_1751797_-\|TonB-dependent-receptor	gnl\|CDD\|273804	TIGR01782, TonB-dependent_receptor, TonB-dependent receptor. This model represents a family of TonB-dependent outer-membrane receptors which are found mainly in Xanthomonas and Caulobacter. These appear to represent the expansion of a paralogous family in that the 22 X. axonopodis (21 in X. campestris) and 18 C. crescentus sequences are more closely related to each other than any of the many TonB-dependent receptors found in other species. In fact, the Crescentus and Xanthomonas sequences are inseparable on a phylogenetic tree using a PAM-weighted neighbor-joining method, indicating that one of the two genuses may have acquired this set of receptors from the other. The mechanism by which this family is shared between Xanthomonas, a gamma proteobacterial plant pathogen and Caulobacter, an alpha proteobacterial aquatic organism is unclear. [Transport and binding proteins, Porins].	3.87061e-180
NZ_CP018029.1\|WP_071968661.1\|1740086_1743797_+\|response-regulator	gnl\|CDD\|236848	PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional.	8.06634e-60
NZ_CP018029.1\|WP_071970573.1\|1738422_1739853_-\|exodeoxyribonuclease-I	gnl\|CDD\|236979	PRK11779, sbcB, exonuclease I; Provisional.	0
NZ_CP018029.1\|WP_015067023.1\|1754864_1756211_+\|Na+/H+-antiporter-NhaC-family-protein	gnl\|CDD\|224671	COG1757, NhaC, Na+/H+ antiporter [Energy production and conversion].	1.24971e-69
NZ_CP018029.1\|WP_012518176.1\|1752238_1753150_+\|diguanylate-cyclase	gnl\|CDD\|366403	pfam00990, GGDEF, Diguanylate cyclase, GGDEF domain. This domain is found linked to a wide range of non-homologous domains in a variety of bacteria. It has been shown to be homologous to the adenylyl cyclase catalytic domain and has diguanylate cyclase activity. This observation correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. In the WspR protein of Pseudomonas aeruginosa, the GGDEF domain acts as a diguanylate cyclase, Structure 3bre, when the whole molecule appears to form a tetramer consisting of two symmetrically-related dimers representing a biological unit. The active site is the GGD/EF motif, buried in the structure, and the cyclic dimeric guanosine monophosphate (c-di-GMP) bind to the inhibitory-motif RxxD on the surface. The enzyme thus catalyzes the cyclisation of two guanosine triphosphate (GTP) molecules to one c-di-GMP molecule.	1.30206e-28
NZ_CP018029.1\|WP_071968660.1\|1736640_1738296_-\|DUF342-domain-containing-protein	gnl\|CDD\|377177	pfam03961, FapA, Flagellar Assembly Protein A. Members of this family include FapA (flagellar assembly protein A), found in Vibrio vulnificus. The synthesis of flagella allows bacteria to respond to chemotaxis by facilitating motility. Studies examining the role of FapA show that the loss or delocalization of FapA results in a complete failure of the flagellar biosynthesis and motility in response to glucose mediated chemotaxis. The polar localization of FapA is required for flagellar synthesis, and dephosphorylated EIIAGlc (Glucose-permease IIA component) inhibited the polar localization of FapA through direct interaction.	1.60678e-131
NZ_CP018029.1\|WP_071968662.1\|1743916_1744960_+\|isoaspartyl-peptidase/L-asparaginase	gnl\|CDD\|366471	pfam01112, Asparaginase_2, Asparaginase.	1.39697e-136
NZ_CP018029.1\|WP_071968667.1\|1756311_1760340_+\|ATP-dependent-RNA-helicase-HrpA	gnl\|CDD\|182986	PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional.	0
NZ_CP018029.1\|WP_015066941.1\|1731271_1732447_+\|acetyl-CoA-C-acetyltransferase	gnl\|CDD\|180261	PRK05790, PRK05790, putative acyltransferase; Provisional.	0
NZ_CP018029.1\|WP_012518181.1\|1761133_1761385_+\|DUF2061-domain-containing-protein	gnl\|CDD\|225746	COG3205, COG3205, Predicted membrane protein [Function unknown].	1.67334e-22
NZ_CP018029.1\|WP_015066940.1\|1730518_1730926_-\|MerR-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|133403	cd04776, HTH_GnyR, Helix-Turn-Helix DNA binding domain of the regulatory protein GnyR. Putative helix-turn-helix (HTH) regulatory protein, GnyR, and other related proteins. GnyR belongs to the gnyRDBHAL cluster, which is involved in acyclic isoprenoid degradation in Pseudomonas aeruginosa. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.89936e-57
NZ_CP018029.1\|WP_071959068.1\|1761484_1762678_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|185082	PRK15128, PRK15128, 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI.	0
NZ_CP018029.1\|WP_071968664.1\|1747903_1748950_-\|metallophosphoesterase	gnl\|CDD\|277324	cd07378, MPP_ACP5, Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain. Acid phosphatase 5 (ACP5) removes the mannose 6-phosphate recognition marker from lysosomal proteins. The exact site of dephosphorylation is not clear. Evidence suggests dephosphorylation may take place in a prelysosomal compartment as well as in the lysosome. ACP5 belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	1.09843e-68

>NZ_CP018029.1|WP_012518171.1|1745124_1745544_+|CBS-domain-containing-protein
MESLQVSDYMNTHPVKLNIDMPVAQAVEVLLASGQSGGPVLDTKGRVVGFLSEQDCIAQMIASSYYREQICRVGEIMKTPVVSVKPYMSVIELAQLLLKEKPRVYPVVDDDGVLLGCINRTAVLRAIDVQLNDGYQRAG
>NZ_CP018029.1|WP_071968662.1|1743916_1744960_+|isoaspartyl-peptidase/L-asparaginase
MNLARFSVSSNGWYKTLCTFSVVTAALLATNALAQEPKVAIAIHGGAGTILKSSMTAEQEAAYKNVLSKAVKHGYSLLKKGEKGEVAVVETIKILETSPLFNAGIGAVYTFDGEHELDASIMHGGSKNAGAVAGVKTIRSPIEAALLVMNESPHVMLSGEGAEQYAKENGLEQVKNTVFDTEFRKQALDKVKARMEKASSGYGTQQGNERFGTVGAVVLDRGGNIVAGTSTGGMTAKRYGRIGDSPVIGAGTYADNESCAVSATGHGEFFIRYHVAADICARMKYQGLTLAKAADTVVNDVLVKAGGDGGVIAIDSVGNIAMPFNSAGMYRASIDTEGKVSIAIYKD
>NZ_CP018029.1|WP_071968661.1|1740086_1743797_+|response-regulator
MSSFTPKSTLSEAKGTFGLTVVLAVVLVILVVGLFESNIKAAAKAQTYSALEKSAANAEAAADMQVLQYTNALNFLHQTPPISGIVRATANGNVDPKDSTTLEQWKHRLETIFVAFIENNSEIDQLRVIQANDEGSEVIRVEREGGAVIIASDIDLQTKASRNYFKESVKSNKGEFYISSINLNREYGKLEFPYKAVIRLSLPILSDANERYGFIIMNVNARFLLDQIKQALAENQSLYITDNEGYFTLHPDSDKSFSKDLNPSINWQSEFVQPLKAGRARLSPMEGENTLYSVSRAFTIGGGQQVAPFYLHVSTPKSYVTALINDKRMSVYSVLVAVTIIFTVALLFFYRSNRKNIELAKVRGESVAIVAISKDAIFSVDAFGKVKSWNMAAESLFGIPSQVIINQHFSSFKPLSPLGLETILTKGGKQETFTTPYIDGEKNEHKLLITASTIWGDNSQFSGVAVVIRDVTDEHKAKDAIERVNFKLEEKVVSRTKELTKATEEARKASSVKSSFISNISHEMRTPLNGVVGSLSLLKRQPLNDKAEQLVSMMEISCNNLSVLINDVLDLSKIEAGKLDINHQLFEPLTLIESLAKVFAVKAATKGLELIVDTTGLPRVEINSDRHRLNQVLSNLLNNAIKFTEKGHIQLNAALYENDAGLQQLHFSISDTGVGIAPESQPKLFTAFTQADASVATQYGGTGLGLSICKQLTQLLGGDITFKSVVDVGSTFSFYVTLTEKTPDTEASLERALEMESAMLSGISIGVSAGYSPLEENICSLAMHVGADAYVLDSNTDKIEWSTFNAVIVDESSPLINDLDNIWHAQTTEQEACALPVVFILQKIAGAPYQFNHIQPIYLPKPLFRSSFALVQQGIDAALGGYSSSMSELQPSEGNGTSDAAFETVKQTSDPQLSIEDANLLIVDDNLINREVAKGVLESLPGKMFTCCDGEEVIAFLQKCEKKGRRIHSILMDCQMPNMDGYETTRAIREGKAGPLHANVPIIAMTANAMLGEKEKCLEAGMDDFTTKPVIADVLIPKVKQWLIHQTMALKSEDAKRNNEIKSDAPALVDSLLNAINKEASCSGVQEEVSMDDLMSSHSDTNETDTSTSANESNAVSDIPAPDNGEVRESWDKDDAIARIMGDKALFSRVCELYSQSAPDKLKQLKGAVEEQDFAQVQVLSLKLKGMSADIGAVQLKKDFELVWELSKGAQWEKVKALLPSIDDDLNTFIELLAVA
>NZ_CP018029.1|WP_071970573.1|1738422_1739853_-|exodeoxyribonuclease-I
MHTPTFLWHDFETFGTSPQKDLPCQFAAVRTDMDLNVVGKPINIMSAIANDYLPHPEACLVTGITPQQTIRDGSNEADFAAKIYNEMSTPNTCSVGFNSIRFDDEVSRYLFYRNFYDPYSREWRNGNSRWDIIDVARACYALRPDGINWPLREDGSPSFRLEALTAANNIGHDNAHDALNDVYATISLAKLIKEKQPRLFDYALSLRNKHTVMQQIDLSKPSVLLHISSKLPASQGCCTWVMPIAKHPTNSNAFIVIDLSHDIDSVLNDSADEIKQALYAPSDTYDDARERPGLKLIHVNRSPFITTAKAMTEDNAQRLGLDRERCLDNYKKLASTPDLVSKIVAVYEEERHSSELDIDHALYSGGFLSDEDRRWCENVINAKPEDLATFGDKTQHEGLKKLLFRYRARNYPNTLTADEMTKWQYHRQARLTDPDFHGSITLETYMMRLESLAHEHSDNPEKQAILRALYQYAENL
>NZ_CP018029.1|WP_071968660.1|1736640_1738296_-|DUF342-domain-containing-protein
MNGVTISFDKSRTYINLMLNPSEFTSEVDIREIKKQLESGETKRLYVSEKALKSACDTANHYFKTSDGTIVQERIGERKNAEVEFRVPDDGMHANLVLTTPYGGKLPGLSTIKSLAIKNRVIRGVSTKKIESMLSNARRAEPGTVLEETIAKGLPAKNGKNSKFIPLVPNALERVLKPQADDGERVDMRNLGEIICVKVNTPVLRRTAPTQGRSGFDVKGNKLPAVAGEWVDFKMGSGTVVSDGDANLLMSAISGMPKYRDQIMNIDDTFISNGVNVGTGHVNYEGAVLVNGDVTEKMQIKAAGDVTINGFVESAHIEAGGDIIITEGAMGKVNDSQGEFQCKLVASGSIHVQHGQGIDIQCGGNITVGRQLAYSRLRCGGAVIVGQIDKPMGNLFACDIISQDRVEAGTLGAVSGSTLKVDFSPGFNQLLERKDSLDELLRQIRENNLKHKEKIALIQGKKIPKELQHKAAEALELFNNESALLEWLENKANDVKSAKENYQSDIKLIANKRLYPGVSAKLNNRNWRSEREYDRAQIHYDAHQWHYEPLI
>NZ_CP018029.1|WP_071953208.1|1735040_1736444_+|transporter-substrate-binding-domain-containing-protein
MLFLGASVFSAILKAGPEQQAAFTPSEEITYCIDPNWAPYEAIRNGIHVGISAQYMRLIAEIAELEFTLVPTESWQQSLEYVQQGKCKVIPMLNTSDYRKQFLDFSIPYFEAPNVLVAKAGTPMLQGYSGVGNRTVGIVQGYRQVEYISRHYPGLRLKLMPSEEEGLKQLANDEFDVMVGSLMSVNMHINNLKLKDINIVGYAEPFDSLAFGVNKSFGHLVDKLNFAIERIPESRKVEIYKQWNNVQIRYSRNYTVMILSTIIMLIGLLWLISRNRHVGAYKRIINQKNEEISSLQATLLEKNRTLGFLSAHDTITGLYNRNHMIQRAEEEISRFQRFQTTASLIILELTHSHDEGLSLEASSLEEPLKVVATQCLNTVREVDVVSRFSGEQFIILCPQTEVGAAKILADRLLNCVTSHYLLSDNFKVAIGMSELKQTEEFSDWMERTMKALYQSKRHGFGNVSIAP
>NZ_CP018029.1|WP_071951326.1|1733672_1734908_+|kynureninase
MINKVFSAEQLDDKDPLAHKAGAFSLPDNTIYLDGNSLGPLPKSAEKRAVEVVQEQWGQGLITSWNKHQWISLPQQVGDKIGELIGAQQGQVICCDSISINLFKVLSAALKMNPGRKVIATTRDNFPTDIYMVQGLLDLLGEEYSIRYVDEASISSQLTDDIAVLMLTQVNFRSGLKLDMKGITEQAHAKGILTLWDLAHSAGAFPVCLDDCNVDFAVGCSYKYLNGGPGAPAFIYVASRHQDSYQQPLSGWMGHSAPFSFSPDYAPDSSVKQNLCGTPGVIGMSILDAALDVFDDVSLKAIDEKSKKLQAFFIAEAKRAGVLEHFGVASPPINCRGSQLALAHDEAYAICQAWIAEGVIADFRAPNILRIGFAPLYLSFADVEKAVTRLAIIMNEKRYENATFQQRQSVT
>NZ_CP018029.1|WP_071968659.1|1732540_1733680_+|alpha/beta-fold-hydrolase
MKNTVHITTFTRALFIALISLQQLAVAQSATFKSGSEPKFNYKDTQDITAVNKDIHRINTASKDIHVKSDERPPQSAPEIKQPANSDVKRDDVKNDTHAKTSEIYKDTHDKPNELSASSKTLTQVPYAALGVLPTREHDELFSYGESLLQSVYVWHGRNTKHDKFAGKAVVFVHGGCWLNAYGYDHASGFYKALADLGMGVFVMEYRRVGDKDGGWPGSLNDVTEAMIMSLERIRGNGRYSKVYIAGHSAGGHLAMLAAQKLPQFTQSVSVEKVIGLAAITDINAYAVGANSCQTATAKFMHSMPDENPEAYQAATPNAKLINTPIVLMQGDADSIVPKLHATMAGAKQKIITNGGHFDWLHPDSTSFDALLEVIGEHD
>NZ_CP018029.1|WP_015066941.1|1731271_1732447_+|acetyl-CoA-C-acetyltransferase
MSNESVVIVAAKRTPMGGFNGSLSSLAATKLGEIAIKAACDEVDVSVIDEVIMGCVLPAGLGQSPARQASIGAGLPLSAGVTTINKVCGSGLKAVMMAHDLIKAGSASAVVAGGMESMSNAPYMLPKARTGYRMGHGQVIDHMMLDGLENAYDGKAMGCFAQDTADEENIGRGEMDEFALSSLSKAHEAINSGTFNDEIAPVTVSSRKGDTVVDTDEGPGSARPEKIPTLRPAFKKDGTVTAANSSSISDGAAALVVMSESKAKALGLTPLAKVVAHATNSIEPENFTVAPVGAMEKVLDKAGWTKEDVDLFEINEAFAMVTMLAIKKLGLDESKVNVKGGACALGHPIGASGARILVTLLHALKQSNGRKGIASLCIGGGEGVALAVEML
>NZ_CP018029.1|WP_015066940.1|1730518_1730926_-|MerR-family-DNA-binding-transcriptional-regulator
MNKYDDETTYAIGELAREFDITPRSIRFYEEQGLMSPSRTGQNRVYLNKDRVRLKLILRGKRLGFSLAEVKTLFDMYDTNPNSAVQLEAMLDMTEQKRAVLKQQLEDIQMLMTELDDVEARCREELAELKRGKIA
>NZ_CP018029.1|WP_071968664.1|1747903_1748950_-|metallophosphoesterase
MLCFACFFNSAWAQAKQQGPSQIGPTDIAPINTGPTQTAPYSHAYYEKTTIADLSVPDEAVSFLTLGDWGRNGHFYQKHVAKWLDIASYQLDAEFIATTGDNFYDNGIASVDDPYWISSYEAVYHQPHLFINWHPVLGNHDYRGNWQAQIDYSVKSRRWEMPAQYYSKTLALDDGATALLLFIDTSPLNPDYEREAKYQEAYEQGASEQLSWINTMLAQDQYTWKVVIGHHPLYSSGKRYGKTNAIKDVLEPVFHKHNVNLYIAGHEHDLQHNQLAGDELVHVVSGGGSEVRPVGNYEFTQFAKSTGGFVSVSMTAKSIFLNYIDHQGKKVYAHTINKPNTASSSSTL
>NZ_CP018029.1|WP_071968665.1|1749091_1751797_-|TonB-dependent-receptor
MKIKTAYSSLALACVTALGLSIASPVLAADGVIIGSVKDAAKARSYNGAKIKLIELGLVTEAGRDGTFRFPSIPKGTYTLEISYLGEDTVTQTIKVEDNDIARASVEFGTGETIDEILVRGQRSGQASAINQQRVSDRISSIVSADAIGQFPDQNAAESLQRLPGLSIERDQGEGRFVGIRGIDPNLNNVTINGLNIPSPESGVRSVALDVIPSELIQTLEVSKSVTPDMDGDAIGGSVAVKSVSAFDKARDTASVTVQASQNDLRDETSPKVSGTFTKKLSSKWGVAGAVSYFDRDFGSDNLESNGDDELEQRHYTITRERLGSALNIDFRPDFNNQYFLRTLYSEFSDDEYRQGNIFTFDGEDSEIERESKDRFESQSIFTVALGGEHQLDTWEANWQLGYAKSDEDEPDALYYIFKTENESIDADLNTMRPTVSQNADAMDLSTYEVDEISFEDNYTKDTETSIKFDAARPINVGGYIGELKFGSKYRSREKDRDSSITIFDGDFDDLDAAQFGAASPDYSLDNFGPGLNRGVMRSYFNDNRESLEVDSLNSDVESRGATYVNEEDIFAAYIMGSVDIEKLHLVAGVRYERTDFSTSGMRVELVENEQTDVEEVVNTPWEAERDYDHWLPSVNARYTFSDKLQLRTAYTQTISRPKFEDVAAFQIIESKTEEDDGVFVTEREAEVGNPELQPYEAQNVDLSLEYYPGDVGVISAGLFYKNIDNFVVYADVAGTAGWEGFEEVIQPINGDSADLTGLELSWVKAFNNGFIVSANATFTDSEATTFLDGEKFETQLPNQSDRIGNLTIGYEANDFSVRLATTYKSENFEEIDGDMLRFEDDHVQMDFMARYYINDTMQVYFNGINLGDEPFYNYFDTRSQNAQYEEYGRTFELGFTWQLN
>NZ_CP018029.1|WP_012518176.1|1752238_1753150_+|diguanylate-cyclase
MFSFTNTTQFRHHTWWLAFTVSIVAIAISLALFLGNPKQSADISGLDIVGEGSIVLLTLAWILAALASRPPGKVTSLLVFGLGFFLFSATLDFLDEFLRYPDDAHWISMIESYPAAVGMVVMTAALYQWHLEQRALNLQLRRREWDYRDHDKIDPITQLYRAEYWKEQIQKLQQFNKSAVLAIIDINNFSLFNQQYGYTEGDRYLHEIAQLLVMNLRQHDLACRYAGDRFAILLPDVSPTQADIIIDEIKASIQHLAFRHQLNTNAIYTSARSTHVTLLPNQTLSTVLNAMLTELERPQKSAA
>NZ_CP018029.1|WP_071968666.1|1753198_1754590_+|AraC-family-transcriptional-regulator-ligand-binding-domain-containing-protein
MEISLSNFTVAASSHSGEGGDTFVEKTKPIAELNELGVHAKKHVGVGVSVREGVDADSVGVSVRECVDADSVGVSVRECVDADSVGISVREGVGADSVGVSVREGGGADSVGVFASADVVQSTHDKVIAGYWLVIAVLDVALNRGANKNKLFRGTGIFEDALEPDSLISIKQYHLLLTNVQSQTKGADVSFLLGSALAAQWLHSPMHVLQPCDTLEALLTHLVQQQTFRWCSIPFCQFQCFTTNHKVMLIPQLTVGGAKLAQFVSEVSFASIVALLKGIAKQRVSVSFNFTCARPKNIADFETHLGLKVAFNCPFNSMCIEKHALNEPMSTPFIHSPNMVTDKELGRYRLFERYPLISLPDYVRCHVYQTISAHNMGSALPELAEKLAISPATLKRKLKEFNTSYRQLSEEVWRNYALVLLSVHKANNEEAARQMGINDLPNFRRTVKRLTGKTPSELRLSNA
>NZ_CP018029.1|WP_015067023.1|1754864_1756211_+|Na+/H+-antiporter-NhaC-family-protein
MRENNATAPNSVLPNPMGLTPILLFVVLVVVTGVTTNDITAMPILVAFFISAGYGLCLNPKGKKVSFSEKVQTFCQGGGDKNIILLVLIFLLAGAFYAVTIDIGARDATVNMALQFVPSALILPGLFLICCFISFSMGTSMGTITALSPIGAGLATNLGLPIEMALGIVVGGAMFGDNLSFVSDTTIAATRTQGVQLKDKFRANLMVAVPACIVTMALLLMVDVDTSGIVEGGNYDFWRIVPYLCIIAFALTGFNVISVLAVGIASACVVGLVQGSFTMLSMMQSIQKGMGWMQDLAMIAITIGGIVALMHANGGITWLIERLTRRVTSKKGAEFSIAGLVSFLDITTANNTIAIVTAGPIAKDLNEKYGVDPRRTASLLDIFSCSFQGLVPYGAQLLSAAAVVGISPLAITPYCWYPMLIFVFGVAAIWFGFPRFNTPQDDELTQSA
>NZ_CP018029.1|WP_071968667.1|1756311_1760340_+|ATP-dependent-RNA-helicase-HrpA
MSSPIAIKPLYNKLDDCLSADKFRLKRRITLLAQKAKGLGESKGAAPGDKSEASKRKAHGDSTSHSANKGSQKNAQKSAEESLSTQFEKLKADINGSIEKRNWRKANLPKVEYPPLPVSDKKEDIKDAIANNQVVIVAGETGSGKTTQLPKICLELGLGVNGMIAHTQPRRLAARSVATRIAEELNTPLGEKVGFKIRFSDQVSERSYVKLMTDGMLLAEMQQDRFLNQYDTIIIDEAHERSLNIDFLLGYLRQLLDKRPDLKLIITSATIDPERFSKHFNNAPIIEVSGRTYPVEVRYHAPEDFDEDRDQSDAIVHAVDELMREAPGDILVFLSGEREIRDTQDALSKQHYRNTEIVPLYARLSAAEQNRIFQSHSGRRIVLATNVAETSLTVPGIKYVIDPGFARISRYSARSKVQRLPIEPISQASANQRAGRCGRVSDGICIRLYSEDDYLGRPEFTDPEILRTNLASVILQMLALGLGDIAAFPFVQPPDNRNINDGFRLLEEIQAIGKGKGKQKGKMQLTPLGRQIARLPIDPRYARMVIEAERTNALSEVMVIAAGLSIQDPRERPQEKRQQADEKHSEYQDKDSDFISLYNVWVAFREQQNALSQNQLRKWCKQQFINYLRMREWQDIVSQLKKSIAELGFGISKQEADYQSIHQAIASGLLSHMGFKDKEREYMGSRNSRFLIFPGSGLSKSQPKWVMAAELVETSKLFARMVAKIDPTWVEPLAEHVVQRSYSEPHWSKKRGAVIAFEKVTLFGLPIVMKRAKVYSLIDPPICHELFIREALVEGNTKLNYSFLEENQALLEQADEFEQKTRRRDLIVDDEELVSFYAKRIPIEANNDAAFKKWFRQHGSNDSLTFKEEDVYRQQPGQSVANAFPDVWRQGNITLPLRYNFEPNAVDDGVTVVIPLPVLNQVDNIGFDWLVPGLRHDLIVGLIKTLPKRLRRNFVPAPNFAEACLADISETDKNNRPVPLLEAVTDKLRKMTGVIIESDEWNLAQLDKHLKMHFAVVNDNGDDIAKGDDLHALKQQCAGQVKQTFEKAATPELERSNIEQWDFESLPETFVQKVGGFEVQAFPALVEKGDKVDIALIEEADKAQALHKQGVNVLIKNAMPSPLNYLQSKLPNKAKLGLYFNPFGQVKALIDDCIFAGIDAIVTDYCEANKTDIRNKADFESCLDIARANINDKVLEIAKQVEQGLTLAHQCQKQMKGNVPLTMINALGDCKAHLAQLVFPGFVSQIGEARLDDWNRYIKGLARRLEKLPIDPNKDRMHQVTVEKSTKEWEKTCSKYPKGKVPQALLDVRWMIEELRVSLFAQQLGTAYPISAKRITLHLAEY
>NZ_CP018029.1|WP_015067025.1|1760561_1760864_+|PilZ-domain-containing-protein
MLGYDDKRNFFRMMVNSPCQLQITDDESSRTMQAMCKDISATGMSLEVDEPSIEVGTQVSVAIESSSSQIPSLAALATVVRCEPESESSCIIGVEISQMK
>NZ_CP018029.1|WP_012518181.1|1761133_1761385_+|DUF2061-domain-containing-protein
MKKTITFAVMHFAVAFTVAYLLTGSVVVGGAVALVEPAINTVAFYFHEMVWKKIEARKEGATTELASETSAPVRRNQDISFAS
>NZ_CP018029.1|WP_071959068.1|1761484_1762678_-|class-I-SAM-dependent-methyltransferase
MSAQVILQPSRDKSLRRKHPWVFESAVAELKGRARIGDTVDVFDDEGDWLGRGAYSPHSKIRVRMWTFKKDESIDNGFFLRRLETALALRKRLFDPNKTNAFRWIASESDGLPGVTIDLYDNVAVVQLLSAGGEKHRSKIVWAITKLMPDVHVYERSDVDVRKKEGLEPVTGVLHGQPPMQVTVKENGINIVVDIESGHKTGFYLDQRDSRAAAAHYAKDADVLNCFSYTGTFSCYALSGGAKSVTNVDVSQPALDLAKHHVAINGYDDKRAHYLNKDVFKALREYHEQNKQFDMVILDPPKFVDNKASLNRAARGYKDINMYGIHAVKSGGLLLTFSCSGLMPADLFQKVVADAALDAGRTIKIIARLNQASDHPIIGSYPEGYYLKGLVCEVTDD
>NZ_CP018029.1|WP_071968668.1|1762829_1763807_+|NAD(P)H-quinone-oxidoreductase
MHYVDFAKGCKPDELTVKEQAGYSLTAGKVKVEVKAFGVNRADTLQRQGNYPPPPGESEILGLEVAGVVSEVASDVSSFKEGDRVCGLVAGGGYATEALVNPAHLMRIPQGMPFFEAAGLTEVFLTAFQCLRTIAHIKPAQRALIHGGASGVGLAATQLCRYWGVHSAVTASSQEKLSLCEKNGAEQLINYKQQAFDEVLKKAWPEGVDMVLDMVGGDYLNRNLQVLKRDGSVVYLAMLAGRYADNLDMAMLLGKRASIIGTTLRNRSDEYKANLIGEFETACIPAFESKELTVNIDTHYSIKDIDKPHGRLENNDTQGKLVVSW

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP018029_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018029_2

2030700-2030773

TypeII

Consensus_repeat	Method
ACTTAACAAGACAGGCATGTTTG	CRISPRCasFinder

1 spacers

Cas9_archaeal

The CRISPR arrays of NZ_CP018029_2

>merge|NZ_CP018029|2|2030700-2030773|CRISPRCasFinder
ACTTAACAAGACAGGCATGTTTGCGGTACTTTGGGGTGGGGAGTCCAATTGACTTAAAAAGACAGGCATGTTTG

>NZ_CP018029|2|1|2030700-2030773|CRISPRCasFinder
ACTTAACAAGACAGGCATGTTTG	CGGTACTTTGGGGTGGGGAGTCCAATTG
ACTTAAAAAGACAGGCATGTTTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018029.1\|WP_071968784.1\|2034671_2034923_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018029.1\|WP_071968786.1\|2035589_2036639_+\|DUF2157-domain-containing-protein	unknown	unknown	unknown
NZ_CP018029.1\|WP_081367578.1\|2037702_2038656_+\|succinylglutamate-desuccinylase/aspartoacylase-family-protein	unknown	unknown	gnl\|CDD\|349472
NZ_CP018029.1\|WP_071968775.1\|2018848_2020363_+\|sodium/proline-symporter-PutP	unknown	unknown	gnl\|CDD\|273981
NZ_CP018029.1\|WP_015067154.1\|2023859_2024414_-\|HNH-endonuclease	Cas9_archaeal	cas9_archaeal	gnl\|CDD\|372995
NZ_CP018029.1\|WP_071968783.1\|2034426_2034651_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018029.1\|WP_071968780.1\|2032283_2033261_-\|transposase	unknown	unknown	unknown
NZ_CP018029.1\|WP_020743512.1\|2021485_2022733_+\|glutamate-5-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|234685
NZ_CP018029.1\|WP_071968785.1\|2034968_2035520_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018029.1\|WP_012518321.1\|2031762_2032143_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|366361
NZ_CP018029.1\|WP_043960494.1\|2024808_2026920_+\|polyribonucleotide-nucleotidyltransferase	unknown	unknown	gnl\|CDD\|236995
NZ_CP018029.1\|WP_071968779.1\|2030814_2031396_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018029.1\|WP_071968776.1\|2020379_2021489_+\|glutamate-5-kinase	unknown	unknown	gnl\|CDD\|184032
NZ_CP018029.1\|WP_071968782.1\|2033919_2034324_+\|MAPEG-family-protein	unknown	unknown	gnl\|CDD\|227639
NZ_CP018029.1\|WP_155761739.1\|2028322_2028835_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018029.1\|WP_071959178.1\|2022863_2023814_+\|mechanosensitive-ion-channel-family-protein	unknown	unknown	gnl\|CDD\|223740
NZ_CP018029.1\|WP_012518312.1\|2027082_2027376_+\|DUF1244-domain-containing-protein	unknown	unknown	gnl\|CDD\|226023
NZ_CP018029.1\|WP_071968781.1\|2033568_2033886_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018029.1\|WP_071968774.1\|2017355_2018408_+\|DNA-topoisomerase-IB	unknown	unknown	gnl\|CDD\|226099
NZ_CP018029.1\|WP_020743524.1\|2029625_2030156_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237495

Protein	Function_ID	Function_description	E-value
NZ_CP018029.1\|WP_071968775.1\|2018848_2020363_+\|sodium/proline-symporter-PutP	gnl\|CDD\|273981	TIGR02121, Osmoregulated_proline_transporter, sodium/proline symporter. This family consists of the sodium/proline symporter (proline permease) from a number of Gram-negative and Gram-positive bacteria and from the archaeal genus Methanosarcina. Using the related pantothenate permease as an outgroup, candidate sequences from Bifidobacterium longum and several from archaea are found to be outside the clade defined by known proline permeases. These sequences, scoring between 570 and -40, define the range between trusted and noise cutoff scores. [Transport and binding proteins, Amino acids, peptides and amines].	0
NZ_CP018029.1\|WP_071968782.1\|2033919_2034324_+\|MAPEG-family-protein	gnl\|CDD\|227639	COG5331, COG5331, Uncharacterized protein conserved in bacteria [Function unknown].	1.60438e-15
NZ_CP018029.1\|WP_020743512.1\|2021485_2022733_+\|glutamate-5-semialdehyde-dehydrogenase	gnl\|CDD\|234685	PRK00197, proA, gamma-glutamyl phosphate reductase; Provisional.	0
NZ_CP018029.1\|WP_071959178.1\|2022863_2023814_+\|mechanosensitive-ion-channel-family-protein	gnl\|CDD\|223740	COG0668, MscS, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane].	6.53517e-13
NZ_CP018029.1\|WP_043960494.1\|2024808_2026920_+\|polyribonucleotide-nucleotidyltransferase	gnl\|CDD\|236995	PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional.	0
NZ_CP018029.1\|WP_071968776.1\|2020379_2021489_+\|glutamate-5-kinase	gnl\|CDD\|184032	PRK13402, PRK13402, glutamate 5-kinase.	0
NZ_CP018029.1\|WP_081367578.1\|2037702_2038656_+\|succinylglutamate-desuccinylase/aspartoacylase-family-protein	gnl\|CDD\|349472	cd06254, M14_ASTE_ASPA-like, Peptidase M14 Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA)-like; uncharacterized subgroup. A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases. ASTE catalyzes the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway, and aspartoacylase (ASPA, also known as aminoacylase 2, and ACY-2; EC:3.5.1.15) cleaves N-acetyl L-aspartic acid (NAA) into aspartate and acetate. NAA is abundant in the brain, and hydrolysis of NAA by ASPA may help maintain white matter. ASPA is an NAA scavenger in other tissues. Mutations in the gene encoding ASPA cause Canavan disease (CD), a fatal progressive neurodegenerative disorder involving dysmyelination and spongiform degeneration of white matter in children. This enzyme binds zinc which is necessary for activity. Measurement of elevated NAA levels in urine is used in the diagnosis of CD.	1.17291e-84
NZ_CP018029.1\|WP_012518321.1\|2031762_2032143_+\|VOC-family-protein	gnl\|CDD\|366361	pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily.	1.93523e-10
NZ_CP018029.1\|WP_012518312.1\|2027082_2027376_+\|DUF1244-domain-containing-protein	gnl\|CDD\|226023	COG3492, COG3492, Uncharacterized protein conserved in bacteria [Function unknown].	3.14416e-40
NZ_CP018029.1\|WP_071968774.1\|2017355_2018408_+\|DNA-topoisomerase-IB	gnl\|CDD\|226099	COG3569, COG3569, Topoisomerase IB [DNA replication, recombination, and repair].	2.10681e-63
NZ_CP018029.1\|WP_015067154.1\|2023859_2024414_-\|HNH-endonuclease	gnl\|CDD\|372995	pfam14279, HNH_5, HNH endonuclease. This domain is related to other HNH domain families such as pfam01844. Suggesting that these proteins have a nucleic acid cleaving function.	8.81504e-22
NZ_CP018029.1\|WP_020743524.1\|2029625_2030156_+\|hypothetical-protein	gnl\|CDD\|237495	PRK13765, PRK13765, ATP-dependent protease Lon; Provisional.	0.00333427

>NZ_CP018029.1|WP_020743524.1|2029625_2030156_+|hypothetical-protein
MEYAITIITGVLSGIAASALFLWFSFSYFKPKIEISPNLAVHESGSDAPYIEVKFLNLTPRDLNDVKVEVLKSEIRNVNGGRSIIHYELSQRDIYHVSSFDKKDKDARYAFRVTEELDLNDIWKSDSTEFITVMIHATDAMSGFSQSFRREYTNKATCIKIGRHAFGKDFSVSPTT
>NZ_CP018029.1|WP_155761739.1|2028322_2028835_+|hypothetical-protein
MTISDWIMILAVFLGPIVAVQLTKYLDAKKEKRQRKLDIFKTLMATRSYSTSWDHVMTLNRIDLEFERSNPKEKAVIDSWKQYLDLLGDKTIKGEQWGAKRIELLVELLYKMALVLDYDFDKTHIKNSAYSPIAHGNIDIQQAKIREGIIDILEGNRNIPMRVTNLPEQS
>NZ_CP018029.1|WP_012518312.1|2027082_2027376_+|DUF1244-domain-containing-protein
MDKQTQTEVEAAVFRRLVEHLDANKDVQNIDLMILADFCRNCLAKWYSAAASEQGADIDYEAAREVVYKMPYSEWKEKHQLPATDEQLEKLAARQGK
>NZ_CP018029.1|WP_043960494.1|2024808_2026920_+|polyribonucleotide-nucleotidyltransferase
MTPITKSFQYGQHTVTLETGVIARQATAAVLASMDDTSVLVTVVGKKEAKPDQDFFPLTVNYQEKAYAAGKIPGGFFKREGRPSEGETLTARLIDRPIRPLFPEGFKNEVQVVVTVMSANPDIPTDIISMIGTSAALAISGIPFNGPIGAARVGFSNGEYILNTRAEEQAESQLDLVVAGTEGAVLMVESEADVLSEETMLGAVMFGHEQLQTVVSAVNEFAAEVGTEKWDWAPEAENTALKDKVKALAEAEMTAAYQISDKLERKDAVTAVTEKALEAILAEDEEQDKKEVLDLLHDLESDVVRSRILSGAPRIDGREPAMIRALDVATGILPRTHGSALFTRGETQAIVAATLGTERDAQMIDELQGKRDSRFMLHYNFPPYCVGETGMIGSPKRREIGHGRLAKRGIQAVMPSEEEFPYVVRVVSEITESNGSSSMASVCGTSLALMDAGVPIKASVAGIAMGLVKSDDNFVVLSDILGDEDHLGDMDFKVAGTTDGITALQMDIKIEGITKEIMQIALKQAKEARLHILNVMDEAIGGHREELSEFAPRIYTMKIDQDKIRDVIGKGGAMIRQITEESDTNIEIEDDGTIKIFATERAKADIAIGKIEQVTAEIEVGKTYNGKITRIVDFGAFVEVLPGKEGLVHISQIAHERVNKVTDYLKEGEMVDVKVMEIDRQNRVRLSIKELLEKPAPKSDDAE
>NZ_CP018029.1|WP_015067154.1|2023859_2024414_-|HNH-endonuclease
MLVLRLNKAGMPQEWIDVEQAAKLYSQDKVLFELGSDGITLKGGWNHQGLQSQLTLSSIIACDGKVTDLSGKVALTNRYLFRRDSYLCMYCGQTFTPKQLTRDHIIPRSRGGKDVWTNVATACQRCNHAKGAKTPEEANMPLLAVPFRPNVYERFYLMNRRILADQMAFLEGHFSHQRNWTCHE
>NZ_CP018029.1|WP_071959178.1|2022863_2023814_+|mechanosensitive-ion-channel-family-protein
MEIVIDPTQLWEQLIAFANEYKLLTSLVLLIVLHFTKKGVLLLIRRISSQRGEDRRNQINILEQLGNAFIIIVLMMVWSSEIQTLAISIAAFMVAIVLATREFIQCFMGFIYYLGARPFRVGDWIQMNNIIGEVVEMDWAKTALLEVDPETFNYTGKHVYVPNSQLVTQTVRNLNFMRRYRLHSFEIVNEPTVNAYSLLPAFHARAQAHCEYFRDVAERYKGLIERHLEQEFIRIDPEVEIKTNELAKVVVKVSLFCPTAEAHELEHKMCSDWLSLWFRAQKEEQAMLMQQQSEFNTNISPSATTTDQQTTSSTGL
>NZ_CP018029.1|WP_020743512.1|2021485_2022733_+|glutamate-5-semialdehyde-dehydrogenase
MSIITELAQQAKKAARTLAILSESQKNAVLTDMAAAIRENKSKIIEVNEKEVARAKDNNLDAAMIDRLILNEERIESMAEGIEVIVELDDPVGKERVIGTRPNGIEIKKMRIPLGVVCMIYEARPNVTADAGALCFKSGNAVILRGGKEALDTSLAIAELMQDVLEKHNLPKALVTVVPNPDRALMQELMEQRDYIDVIIPRGGEGLINYVTDNAKVPVIQHFKGVCHLYVDKDADLEKALAILLNGKTQRTGVCNALEGLVVHQAVAGDFLPKVADAFKEKGVKVHVNQKGSQYFDGADVIAEDAYGEEYLGLEIAIRVVDDFEGAVDHIAQFGSNHTEVIITEDAEKGKLFQRAVDASVVMVNASSRFSDGSQLGLGAEIGIATTKLHAYGPMGLESLTSEKYLVNGEGQIRD
>NZ_CP018029.1|WP_071968776.1|2020379_2021489_+|glutamate-5-kinase
MSHPNWKRVVIKVGSALISPNQQGCSSHYLLSIAQFIVRCRANGTQVVLVSSGSVAAGAHLFPEQEKSDIAVKKAMAAAGQTEMIATWDRLFDFPSAQMLLTHADLRDRERYVSIRETIFSLLDNNILPIVNENDTVTTDKLKVGDNDNLSAMVASAAEADALIICSDIDGLYDKNPHEHDDAKMLKSVDTIDQSIYDMAGGAVKGGVGTGGMRTKIEAAEKAVSHGIDTYIINGFTELSFNMLLSGDNPGTHFKPHAKPMQENVHWMRHTSNAQGEVIVEGDFDDSLHSDAEQLTSSEIIDVKGEFSVGDTILVRKEDGTKLVKAKSNYSSCLLNFIANQENDEFAHEFEEKTGPIISDQHIANLEKE
>NZ_CP018029.1|WP_071968775.1|2018848_2020363_+|sodium/proline-symporter-PutP
MPMESYLSLAVYFIAMLGIGLFAYRQSTSDISGYILGGRQVSPQVTALSAGASDMSGWMLMGLPGAMYLTGFDAVYIAIGLVAGALANYLLVAPKLRVYTEVADDSLTVPEFFAKRFNTPNASLRIVSAVIIVLFFTLYTSAGLVAGGKLFESAFSVDYQLGLFITLGVVVSYTLLGGFLAVSLTDFVQGCIMFVALVLVPIVAFTEFDSVSQMTSAAYQSVPDFSASLETLTIVGLLSSLGWGLGYFGQPHIIVRFMAIRSVNAISTARNIGMSWMTVTIIGALATGFVGIAYANQFGLAVDDPETIFIIFSQLLFHPLISGFLMAAILAAIMSTISSQLLVSASSLTEDIYRVLVNKKSPQKTLSEKQTVTIGRYGVAGVAVVALLLAMDASNTILSLVSNAWAGFGAAFGPLVLFCLYKKDLTAKAAMAGMVSGAVTVLFWIYAPVLADGKTLSSVIYEIIPGFAVSTLTLYGVSHFGENPSKNVQATFAQASEELANQQS
>NZ_CP018029.1|WP_071968774.1|2017355_2018408_+|DNA-topoisomerase-IB
MKKRIKGYCNVHEDDSHLSIKRIACGNKRFYYRYVSGKKVTGQRVINRIKKLVIPPNWRDTYISRDSKASVQAIGYDEKGRKQYIYHEKWHEQQQVQKFERLIAFGNALPTFREHCISLISQPSWTLERACALVCLLLDYTGARVGNTQYSKENNTYGLTTLRRKHVQAQCDDSVELAYIGKHGKPRTLKVNDPELASLICDCAQQRGYCLFRYQDHRKQWHDVTSEDVNAFIHEKLSEQFSCKDFRTWASSRFALTVMPNVYERVASSKTKKWESTLSKTVSAELGNTPAVCRKYYIHPKLFAIKKQGDAFENTLNRVRSLAGEDCTHITHLLPVEKLLLDVISTKSNV
>NZ_CP018029.1|WP_071968779.1|2030814_2031396_+|hypothetical-protein
MKLIKVALFTLFISQIAAAEINVSLANGTEKEELKREQIFRLIEQHDLKKWWFTDKIVIDESARSPFSHPVLTLKASMPNNDHAGLSQLLHEQIHWFEDSRKEEVDNTVAELRNIYSSVPVGFPDGARSEFSTYLHLAVCLMELDALTQILGKEKAEAVIANNGKYFYKWIYKTVLQDQAQIREILKNNRLYI
>NZ_CP018029.1|WP_012518321.1|2031762_2032143_+|VOC-family-protein
MEMNQVTLPVKNMEEAVKFYLVLGFIQIVDTPHYARFSCPKGNSTFSLSLELEEFKNGAIIYFETEKLDMLAESLVAKGVIFEQLPTEQRYLWKEAVLKDPSGNKIKLFWAGENRLSPPWKVEKRG
>NZ_CP018029.1|WP_071968780.1|2032283_2033261_-|transposase
MPKARKSQISLSDTPYYHCVSRCVRRAFLCGEENGRSFEHRRQWVEDRIHVLSEVFAIDVCAYAVMSNHTHLVLHVNKEKADALSTEDVIQRWHRLYKGTLLSQRYMSPDSRKDLHETQIKAVELAAEVWRKRLFDISWLMRALNEYIARTANREDDCTGHFWEGRFKSQALLDESALAACMAYVDLNPVRAKIAKTPETSDHTSIQYRINAAKVGKTPKRLMPFAGNQRQEMPHGLPFTLPDYLQLVDITSRYIHPNKRGKVEHSLPTILERLNIEHEHWLTLTTQFETCFKQAAGKVIHLEQYAHNQHQQRVQGRQSAMRLLG
>NZ_CP018029.1|WP_071968781.1|2033568_2033886_+|hypothetical-protein
MKNWIFIFAICFLVIGCAATNKPPKSAGKGMLLMSTDTSYIVDGKQIDKTNGEAFLSAIDATGFKKLIVIERDIEHLLTLREQLKAKGYSLYYIDSERRVKAVSL
>NZ_CP018029.1|WP_071968782.1|2033919_2034324_+|MAPEG-family-protein
MNTLLTPVFLHIVWCALLYALLTVTRAPAVWGVGQSKNGSNPFHTIQPKISANLSNQFEWPIFFHIACVLLIAMDEPIDSMQVYLAWVFVIGRVLHSIVQIFTNNIRLRGMVFTINFIAALAMWTLIFIGEIGL
>NZ_CP018029.1|WP_071968783.1|2034426_2034651_+|hypothetical-protein
MEDVLEPLGRSILRILKWIVVEAIIEFVLKGTGHVVLNLLTFGNYPRTGRDEGRSIAVGFVSLIVVFVCLVLIA
>NZ_CP018029.1|WP_071968784.1|2034671_2034923_+|hypothetical-protein
MKMEKWAQIREKGKQRFVLINGVLGWGVTTAIFWAVLMEFIEPSENIWVRPIIALIIFPIAGIAFGHLMWNKSEKTYEKEKAL
>NZ_CP018029.1|WP_071968785.1|2034968_2035520_+|hypothetical-protein
MLSIKKIIFVSFTLFVAGCANIPISTMLEFRSFDEAKFVQLDPNHLLTKIHLDKPAEIKPDKTWLTLGVSSAQEERSFKYNLEVISEKTLPAESGWLSDIPSRTEYILGLSPKAIKEFTQLKDFMKSASPTGFDLHVSTGFKESESELNTVTMSIFLKLYANEDYFTLFDRAVLDVEKESKKG
>NZ_CP018029.1|WP_071968786.1|2035589_2036639_+|DUF2157-domain-containing-protein
MEVTKASIQKAVAKNIISEQQGVDLYNFFQTESQHSPAFTFTHILYYLGGLIAIGAMTLFMNLGWEQFGGLGIIFISLLYAGVGLKLANFLASKNLIIPAGICATFVVCLTPLAIYGFQQWLGLWPEDDTVYRQFHTRIKWLWLYMELGTLVTGLIVAWRYKYPFLIMPIAVTLWYISMDAVMLLIDQDDMWNSYTWEFRAQVSMYFGIVMTLLAFWVDLRSRHTADYAFWLYLFGVLAFWGGLTSQNSDSELSKFFYFCINLAMVGLGALLVRKVFVIFGALGCCFYLGHLASNVFKDSWLFPIALTAIGLGVVYVGIWWQKNEVRITRKTRNVLPKPLQELLDKKLG
>NZ_CP018029.1|WP_081367578.1|2037702_2038656_+|succinylglutamate-desuccinylase/aspartoacylase-family-protein
MGVTTQTGEKASYFAKERSITLPVTVVNGKEDGPVLLLTAGIHGDEFPSMYALQQLQQNLNPNEMSGVLVVLHLANLDGFHANRIALNPKDEKNLNREFPGSADGTPTEQIAELLTREFIGKADFMIDMHSGSANQTLLNHVYSPFVGDEELDALTCEFAKATGMQHIVMYGDRPRDPNNSISYPNTAMTKGKPGLTTEIGHLAQTDEQSVAKALEVAKNAMYFLKMLPEKPKPHPEPIIYETIKYPKSSKTGFFKASVVIGEKVSTGQDIGTVTDYFGNLVETLKSPVDGTVMMVNQMPAIKDDQSVMAIGVEKSE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

919021 : 927687

Streptococcus_phage(16.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071968328.1\|919021_920314_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	2.2e-135	59.7
WP_012517444.1\|920373_922005_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	3.2e-147	50.2
WP_071968329.1\|922141_924733_-	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	8.4e-33	21.7
WP_012517446.1\|924894_925434_+	CinA family protein	B5TK85	Pseudomonas_phage	1.0e-25	45.2
WP_012517447.1\|925554_926601_+	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	2.5e-116	62.8
WP_012517448.1\|926865_927687_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	1.4e-26	33.2

DBSCAN-SWA_2

1905714 : 1974178

Liberibacter_phage(14.29%)

protease,integrase,holin,tRNA

attL 1910289:1910319|attR 1935713:1935743

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081367518.1\|1905714_1906776_-\|integrase	site-specific integrase	A0A1W6JTA0	Pseudomonas_phage	4.8e-51	35.5
WP_071968719.1\|1906780_1906957_-	excisionase	NA	NA	NA	NA
WP_071968720.1\|1907060_1907990_+	hypothetical protein	NA	NA	NA	NA
WP_071968721.1\|1908020_1908440_-	SEC-C domain-containing protein	NA	NA	NA	NA
WP_071968722.1\|1908483_1910061_-	replication endonuclease	Q94N00	Haemophilus_virus	5.8e-61	33.2
1910289:1910319	attL	NA	NA	NA	NA
WP_155761737.1\|1910394_1910547_-	hypothetical protein	NA	NA	NA	NA
WP_071968723.1\|1910641_1911043_+	hypothetical protein	NA	NA	NA	NA
WP_071968724.1\|1911106_1912051_-	hypothetical protein	NA	NA	NA	NA
WP_071968726.1\|1913201_1914176_-	hypothetical protein	NA	NA	NA	NA
WP_071968728.1\|1915279_1916542_+	hypothetical protein	NA	NA	NA	NA
WP_155761738.1\|1916736_1916892_+	hypothetical protein	NA	NA	NA	NA
WP_071968729.1\|1917231_1918557_+	DUF3883 domain-containing protein	NA	NA	NA	NA
WP_071968730.1\|1918826_1919147_+	hypothetical protein	NA	NA	NA	NA
WP_071968731.1\|1919502_1920117_+	hypothetical protein	NA	NA	NA	NA
WP_071968732.1\|1920141_1920795_+	hypothetical protein	NA	NA	NA	NA
WP_071968733.1\|1920921_1922610_+	type I restriction-modification system subunit M	A0A220A2U5	Liberibacter_phage	2.9e-34	26.9
WP_071968735.1\|1923984_1925292_+	hypothetical protein	NA	NA	NA	NA
WP_071968736.1\|1925270_1926425_+	DUF4268 domain-containing protein	NA	NA	NA	NA
WP_071968737.1\|1926436_1929625_+	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	3.9e-72	29.7
WP_071968738.1\|1929688_1930930_+	hypothetical protein	NA	NA	NA	NA
WP_071968739.1\|1931089_1931326_-	hypothetical protein	NA	NA	NA	NA
WP_071968740.1\|1931563_1931893_+	hypothetical protein	NA	NA	NA	NA
WP_071968742.1\|1932571_1932763_+	hypothetical protein	I6PBM8	Cronobacter_phage	6.2e-10	46.6
WP_071968743.1\|1932779_1933955_+\|integrase	site-specific integrase	I6PDJ1	Cronobacter_phage	2.5e-61	38.3
WP_071968744.1\|1934137_1934578_+	hypothetical protein	NA	NA	NA	NA
WP_015067082.1\|1936457_1937681_+	NADH:flavin oxidoreductase/NADH oxidase family protein	NA	NA	NA	NA
1935713:1935743	attR	NA	NA	NA	NA
WP_012518302.1\|1937783_1938263_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	3.8e-24	45.0
WP_012518303.1\|1938408_1938840_+	type II toxin-antitoxin system RatA family toxin	NA	NA	NA	NA
WP_071968745.1\|1938836_1939184_+	RnfH family protein	NA	NA	NA	NA
WP_012518305.1\|1939256_1939733_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_071968746.1\|1939765_1941736_-\|holin	choline BCCT transporter BetT	A0A2I7QNT1	Vibrio_phage	4.4e-26	26.4
WP_071968747.1\|1942059_1944762_+	TonB-dependent receptor	NA	NA	NA	NA
WP_071968748.1\|1944926_1946906_+	sulfotransferase	NA	NA	NA	NA
WP_071968749.1\|1947207_1947921_+	diguanylate cyclase	NA	NA	NA	NA
WP_071951433.1\|1948096_1948909_-	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_071968750.1\|1949181_1951554_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	2.3e-178	38.4
WP_023559661.1\|1951879_1952029_+	hypothetical protein	NA	NA	NA	NA
WP_071968751.1\|1952649_1954911_-	xanthine dehydrogenase family protein molybdopterin-binding subunit	NA	NA	NA	NA
WP_071968752.1\|1954907_1955414_-	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_015067092.1\|1955779_1955995_-	tellurium resistance protein TerC	NA	NA	NA	NA
WP_015067093.1\|1956313_1956730_+	DUF4826 family protein	NA	NA	NA	NA
WP_071968753.1\|1956746_1957205_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_071968754.1\|1957214_1958381_-	cupin domain-containing protein	NA	NA	NA	NA
WP_081367519.1\|1958553_1959294_-	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_071951439.1\|1959348_1960716_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	1.9e-108	46.2
WP_071959150.1\|1960729_1961356_-	high frequency lysogenization protein HflD	NA	NA	NA	NA
WP_155761628.1\|1961355_1962483_-\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_015067100.1\|1962817_1963360_-	rRNA large subunit pseudouridine synthase E	NA	NA	NA	NA
WP_071951442.1\|1963858_1966078_+	NADP-dependent isocitrate dehydrogenase	NA	NA	NA	NA
WP_014949330.1\|1966602_1966821_-	cold shock domain-containing protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	2.7e-17	63.1
WP_014949331.1\|1967062_1967383_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	4.2e-11	43.6
WP_071968756.1\|1967407_1969684_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	7.1e-169	42.2
WP_008844395.1\|1969864_1970083_-	translation initiation factor IF-1	NA	NA	NA	NA
WP_081367520.1\|1970158_1970905_-	arginyltransferase	NA	NA	NA	NA
WP_071970597.1\|1970877_1971624_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_020743481.1\|1971669_1972635_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	3.3e-59	40.7
WP_071951446.1\|1973213_1973663_+	DUF412 domain-containing protein	NA	NA	NA	NA
WP_071959157.1\|1973722_1974178_-\|protease	SprT family zinc-dependent metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_3

2280765 : 2290416

uncultured_Caudovirales_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071968883.1\|2280765_2281155_+	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	1.7e-14	36.4
WP_071968884.1\|2281154_2281523_+	DsrE family protein	NA	NA	NA	NA
WP_071968885.1\|2281522_2281867_+	hypothetical protein	NA	NA	NA	NA
WP_071968886.1\|2281863_2282211_+	TusE/DsrC/DsvC family sulfur relay protein	A0A060BH02	Podovirus	9.0e-07	33.7
WP_071968887.1\|2282574_2283012_+	host attachment protein	NA	NA	NA	NA
WP_071968888.1\|2283088_2283802_-	SOS response-associated peptidase family protein	NA	NA	NA	NA
WP_071968889.1\|2283912_2286819_-	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	3.8e-26	24.1
WP_071968890.1\|2287318_2288611_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	5.6e-94	44.8
WP_071968891.1\|2288621_2289005_-	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	7.6e-07	32.4
WP_071951624.1\|2289108_2290416_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	4.6e-72	37.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP018030

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP018030_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018030_1

130950-131455

TypeIV-A

Consensus_repeat	Method
GTGTGTCACCGCGTAGGTGATTTAGAAGA	CRISPRCasFinder
GTGTGTCACCGCNTAGGTGATTTAGAA	CRT

8 spacers

csf3gr5,csf2gr7,csf1gr8,csf5gr6,DinG

The CRISPR arrays of NZ_CP018030_1

>merge|NZ_CP018030|1|130950-131455|CRISPRCasFinder,CRT
GTGTGTCACCGCGTAGGTGATTTAGAAGGATGAGATCATCGAGCGTTTTTAACTGAATAAGTGTGTCACCGCGTAGGTGATTTAGAAGATTGTAGAGAAGCTAGATAAGCCGGTTGCGTTGTGTGTCACCGCGTAGGTGATTTAGAAGAATCTGTTAGATGGACAAGTGAACGGTATTTTGTGTGTCACCGCGTAGGTGATTTAGAAAGATTGCGTGAATAAATTCAAGGGGTGTAGGCTGTGTGTCACCGTGTAGGTGATTTAGAAGGAGCTTCAAAATCGGAAGAAAACGTTATTTCAGTGAGTCATCGCGTAGGTGATTTAGAAGAAGCTTCAAAATCGGAAGAAAACGTTATTTCAGTGAGTCATCGCATAGGTGATTTAGAAGTCAATGTACACGAAATTCCAAACGAAAAAATATGTGTCACCGCACAGGTGATTTAAAATGATAGTGGTGCGTAGCACGGATATCGATAAAAATGTTTCACCGTTTTGGTGATTTTAAG

>NZ_CP018030|1|1|130950-131397|CRISPRCasFinder
GTGTGTCACCGCGTAGGTGATTTAGAAGG	ATGAGATCATCGAGCGTTTTTAACTGAATAA
GTGTGTCACCGCGTAGGTGATTTAGAAGA	TTGTAGAGAAGCTAGATAAGCCGGTTGCGTT
GTGTGTCACCGCGTAGGTGATTTAGAAGA	ATCTGTTAGATGGACAAGTGAACGGTATTTT
GTGTGTCACCGCGTAGGTGATTTAGAAAG	ATTGCGTGAATAAATTCAAGGGGTGTAGGCT
GTGTGTCACCGTGTAGGTGATTTAGAAGG	AGCTTCAAAATCGGAAGAAAACGTTATTTCA
GTGAGTCATCGCGTAGGTGATTTAGAAGA	AGCTTCAAAATCGGAAGAAAACGTTATTTCA
GTGAGTCATCGCATAGGTGATTTAGAAGT	CAATGTACACGAAATTCCAAACGAAAAAAT
ATGTGTCACCGCACAGGTGATTTAAAATG

>NZ_CP018030|1|1|130950-131455|CRT
GTGTGTCACCGCGTAGGTGATTTAGAA	GGATGAGATCATCGAGCGTTTTTAACTGAATAA
GTGTGTCACCGCGTAGGTGATTTAGAA	GATTGTAGAGAAGCTAGATAAGCCGGTTGCGTT
GTGTGTCACCGCGTAGGTGATTTAGAA	GAATCTGTTAGATGGACAAGTGAACGGTATTTT
GTGTGTCACCGCGTAGGTGATTTAGAA	AGATTGCGTGAATAAATTCAAGGGGTGTAGGCT
GTGTGTCACCGTGTAGGTGATTTAGAA	GGAGCTTCAAAATCGGAAGAAAACGTTATTTCA
GTGAGTCATCGCGTAGGTGATTTAGAA	GAAGCTTCAAAATCGGAAGAAAACGTTATTTCA
GTGAGTCATCGCATAGGTGATTTAGAA	GTCAATGTACACGAAATTCCAAACGAAAAAAT
ATGTGTCACCGCACAGGTGATTTAAAA	TGATAGTGGTGCGTAGCACGGATATCGATAAAA
ATGTTTCACCGTTTTGGTGATTTTAAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018030.1\|WP_155761788.1\|138681_139158_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018030.1\|WP_071971133.1\|136232_136547_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018030.1\|WP_071971109.1\|123028_124819_-\|DNA-cytosine-methyltransferase	unknown	unknown	gnl\|CDD\|223348
NZ_CP018030.1\|WP_071971103.1\|120553_120970_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018030.1\|WP_081367604.1\|129030_130146_+\|type-IV-CRISPR-associated-protein-Csf2	csf2gr7	cd09706_csf2gr7_CAS-IV-A	gnl\|CDD\|274435
NZ_CP018030.1\|WP_071971137.1\|137908_138664_-\|excalibur-calcium-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|377566
NZ_CP018030.1\|WP_071971124.1\|133315_133708_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018030.1\|WP_071971105.1\|121599_121839_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018030.1\|WP_071971122.1\|132686_133094_-\|phosphate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270371
NZ_CP018030.1\|WP_155761787.1\|133925_134291_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018030.1\|WP_071971120.1\|131516_132677_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018030.1\|WP_071971113.1\|127558_128263_+\|hypothetical-protein	csf5gr6	mkCas0159_csf5gr6_CAS-IV-A	unknown
NZ_CP018030.1\|WP_071971111.1\|124982_127481_-\|hypothetical-protein	DinG	cd09708_DinG_CAS-IV-A	gnl\|CDD\|274436
NZ_CP018030.1\|WP_155761786.1\|121391_121562_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018030.1\|WP_071971128.1\|134412_135912_+\|N-6-DNA-methylase	unknown	unknown	gnl\|CDD\|274377
NZ_CP018030.1\|WP_071971118.1\|130149_130851_+\|hypothetical-protein	csf3gr5	cd09707_csf3gr5_CAS-IV-A	gnl\|CDD\|187838
NZ_CP018030.1\|WP_071971135.1\|136572_137877_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018030.1\|WP_071971115.1\|128250_129024_+\|hypothetical-protein	csf1gr8	cd09705_csf1gr8_CAS-IV-A	gnl\|CDD\|187836
NZ_CP018030.1\|WP_071971131.1\|135868_136159_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018030.1\|WP_071971107.1\|122364_122565_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP018030.1\|WP_071971109.1\|123028_124819_-\|DNA-cytosine-methyltransferase	gnl\|CDD\|223348	COG0270, Dcm, Site-specific DNA methylase [DNA replication, recombination, and repair].	0.00543727
NZ_CP018030.1\|WP_071971122.1\|132686_133094_-\|phosphate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270371	cd13653, PBP2_phosphate_like_1, Substrate binding domain of putative ABC-type phosphate transporter, a member of the type 2 periplasmic binding fold superfamily. This subfamily contains uncharacterized phosphate binding domains found in PstS proteins that serve as initial receptors in the ABC transport of phosphate in eubacteria and archaea. After binding the ligand, PstS interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The PstS proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.22611e-09
NZ_CP018030.1\|WP_081367604.1\|129030_130146_+\|type-IV-CRISPR-associated-protein-Csf2	gnl\|CDD\|274435	TIGR03115, cas7_csf2, CRISPR type IV/AFERR-associated protein Csf2. Members of this family show up near CRISPR repeats in Acidithiobacillus ferrooxidans ATCC 23270, Azoarcus sp. EbN1, and Rhodoferax ferrireducens DSM 15236. In the latter two species, the CRISPR/cas locus is found on a plasmid. This family is one of several characteristic of a type of CRISPR-associated (cas) gene cluster we designate Aferr after A. ferrooxidans, where it is both chromosomal and the only type of cas gene cluster found. The gene is designated csf2 (CRISPR/cas Subtype as in A. ferrooxidans protein 2), as it lies second closest to the repeats.	1.16821e-48
NZ_CP018030.1\|WP_071971111.1\|124982_127481_-\|hypothetical-protein	gnl\|CDD\|274436	TIGR03117, cas_csf4, CRISPR type AFERR-associated DEAD/DEAH-box helicase Csf4. Members of this family show up near CRISPR repeats in Acidithiobacillus ferrooxidans ATCC 23270, Azoarcus sp. EbN1, and Rhodoferax ferrireducens DSM 15236. In the latter two species, the CRISPR/cas locus is found on a plasmid. This family is one of several characteristic of a type of CRISPR-associated (cas) gene cluster we designate Aferr after A. ferrooxidans, where it is both chromosomal and the only type of cas gene cluster found. The gene is designated csf4 (CRISPR/cas Subtype as in A. ferrooxidans protein 1), as it lies farthest (fourth closest) from the repeats in the A. ferrooxidans genome.	2.68804e-80
NZ_CP018030.1\|WP_071971137.1\|137908_138664_-\|excalibur-calcium-binding-domain-containing-protein	gnl\|CDD\|377566	pfam05901, Excalibur, Excalibur calcium-binding domain. Extracellular Ca2+-dependent nuclease YokF from Bacillus subtilis and several other surface-exposed proteins from diverse bacteria are encoded in the genomes in two paralogous forms that differ by a ~45 amino acid fragment, which comprises a novel conserved domain. Sequence analysis of this domain revealed a conserved DxDxDGxxCE motif, which is strikingly similar to the Ca2+-binding loop of the calmodulin-like EF-hand domains, suggesting an evolutionary relationship between them. Functions of many of the other proteins in which the novel domain, named Excalibur (extracellular calcium-binding region), is found, as well as a structural model of its conserved motif are consistent with the notion that the Excalibur domain binds calcium. This domain is but one more example of the diversity of structural contexts surrounding the EF-hand-like calcium-binding loop in bacteria. This loop is thus more widespread than hitherto recognized and the evolution of EF-hand-like domains is probably more complex than previously appreciated.	9.81796e-08
NZ_CP018030.1\|WP_071971128.1\|134412_135912_+\|N-6-DNA-methylase	gnl\|CDD\|274377	TIGR02987, m6_adenine_and_m5_cytosine_DNA_methyltransferase, type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family. Members of this family are the m6-adenine DNA methyltransferase protein, or domain of a fusion protein that also carries m5 cytosine methyltransferase activity, of type II restriction systems of the Alw26I/Eco31I/Esp3I family. A methyltransferase of this family is alway accompanied by a type II restriction endonuclease from the Alw26I/Eco31I/Esp3I family (TIGR02986) and by an adenine-specific modification methyltransferase. Members of this family are unusual in that regions of similarity to homologs outside this family are circularly permuted. [DNA metabolism, Restriction/modification].	4.97319e-08
NZ_CP018030.1\|WP_071971118.1\|130149_130851_+\|hypothetical-protein	gnl\|CDD\|187838	cd09707, Csf3_U, CRISPR/Cas system-associated RAMP superfamily protein Csf3. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein.	2.67863e-48
NZ_CP018030.1\|WP_071971115.1\|128250_129024_+\|hypothetical-protein	gnl\|CDD\|187836	cd09705, Csf1_U, CRISPR/Cas system-associated protein Csf1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Zn-finger domain containing protein; also known as Csf1 family.	6.55595e-29

>NZ_CP018030.1|WP_071971118.1|130149_130851_+|hypothetical-protein
MMEPLKITFELGSAICLPRHPLHLDALIAYINTQKGLITLDEPYSRDALMALADDLPFACYGDGEDWVYKASALQPVGDLKHTSRFFTNKNDKTGIATAVKNDQIQLKRQVSALEKMSHAGQLDFNRGHQRNALIYHSITYVEKMEAYCIGDKDLLQEALSSGHLTHLGKLHRMGFGFIKHITIEECEEAKTKWKNRVKPFEEKGDIPVTSPIRPPYWDLEAKTLSFMPSELI
>NZ_CP018030.1|WP_081367604.1|129030_130146_+|type-IV-CRISPR-associated-protein-Csf2
MTMTKFHVQNNAIHVILKTTSNWNVAYPDGADENNTTLTVKKRINGNNVPYFPANGLRGRFRRYIAKRAIDAMVSTQGQLSLETHIALQSGSSHTQPDKANSSIEELVRASGHVYMGVFGGGSRMLESRYAVSDIHPILNSTVENGVVQAPLALVQEIIEKQNFGSDGDVKQLQPYQIIERRSFIKVDDISRGNNIVDVTQNVEGGESAIADYLEGVSKNQQERKAQKSKGEDVAKKLTLSNILGVESICAGVDMHFRIDVSPDLTEAQVGALLVALEDLANVNYLGGWGRTGFGRFKISAVHADLPALDISETIIDELYQGEHFSFDNTSLSSLTAEAHEAIQAIDKEEMVDYFTPREVAIKRGKDKLKG
>NZ_CP018030.1|WP_071971115.1|128250_129024_+|hypothetical-protein
MPDLIYPSELVIKGAGLADSFPQGVEAETSGHCGICGKPHDEGDMVDFLMLTKSFTVENAIFDPHAPYRCLHCAAIMDEKEFIFRWGSAVVTLDGLYPCLKRVHRGYWFLNPPEPPFAFYLQVSKSQHVAWRSPVNYSKDVVFFRLGEDVHKIRTQKVQDGLEATISLIEAHKALHAKKAIKRKPMRTALSFCDMKGQRVGQSELYQWVNEVTDLMPEMQAHVKQLLSLTSSEAYALDFVLTENLELPEPVRTANIK
>NZ_CP018030.1|WP_071971113.1|127558_128263_+|hypothetical-protein
MQQTFVKFTLPAGTYIHANEMREAVAKGLDGQMFQSKPGLFNYLTETKTNCNRPENRFIGGLGWVGFVSDNDPLMTTQVVAPAISFLMGKGFSPDTRVGEKDKRAVLTDEPNVYRLTGLVDQRDKRRESETGVVESAADLVKRHVIAMFEVAFDKGVIDSPFTDDDLNIMVLESRRSGESVKFRNGGQKAVAKVRATFAMQVRLEGIWQAGHLQSRGYGLVYSVNKGKYTQCPI
>NZ_CP018030.1|WP_071971111.1|124982_127481_-|hypothetical-protein
MAVSIRIPETLTKNLFPNTPFDELNDAQITHTKKCAKQLIERAIIENKPPASVRLESENDFVGHLTINILNKYNRAIIKHARQNKTPEAVIALGYLVCALNHDWHLSLIENEETRLSDYLNAMNYEVRDEQQRFYRFLDDTITKQKIGLIEASTGVGKSLAILSQANERALNENKVCVISTNSLANIEQYIADYRNLTAKDVEMSPLYLIIGRQNFVSSERLYAWIDSCELPINKDRIEAWLNRGGRNENEPDYLPAMSLASLKDCEPMVIDSEVTLDSNVSDNDKGYLAYQAQFTLSHGTQHAILLVTHTMLCIDAKFRRLHQDLEPDVIDEIKSLRAEVDRRFKRYDELELGDKKDKAYEAYSNARLAYNECRMAALRSSTPSLLPNYQYLFVDEGHLLENAMCNVTSENISLRSIIRDVKQYSGTGKATKSKISEAENAITELIGSQQKIKTEQLVLSKQTEHHNYLLHTICNALIGNTKKAKIDAPWRGQLISLKASLNRIGKRNFACILSFSPVRHYPQINTGETNTLGYLSDIWARAEAVAIVSATLYIKRYNTYSSNYISNILGITRQRRIEYPPIVARWTKDIVKTVYMPPADKQLSDDLTPVGRSFRGNDKERSEKKSRWHNAVAERIINVYTNAPGGTLVLMTAYADCIAVSEIIKSNLTDIPLVVANNNTTLNEQKIKYIELTKSGTKPLWLAVGNAWVGLDINGKSIGLAQEDIFEKDNVITDLVIPKIPFGANNSLSHILRMMKLDNNTSDIELMETMMKFKQGLGRLVRLEQQKPNRQIHILDGRLNQPRYKGFLSLIRALINTYPNVLSMNRKDNRY
>NZ_CP018030.1|WP_071971109.1|123028_124819_-|DNA-cytosine-methyltransferase
MFSIKKTKLHKALAHALGNLEALTKRLKVMQESPDSPRKKIVISSKELYVSSLGEGTKMVVEAHSDKSALFIRPARLSDEKTRVVSKRTYKNRDYVEPVVDIRHQRDINATIGDAEYVHVIFQKDGAWVRPATKYQEIALKQPSGARFDMTMPDEEGLYSQILKAIKITKQSHFSSIILNTSDDFLQSKEYVILCVQLRRLGFAIKEMNNLVYAKLPRSPELDSHKYIDLANYNYKTNFKSMATRFNFSEPLSSFAACTAGVDIHAMENEGFKTTSILEYRPPEKRDFKKSIDKTTGETVIKHNDKTDTGALCALLNSKHAKVVFNEDIYEFDFYRVSKLLPKFNHLHCSIQCDDFSNMKSNSLKDISIDDLSTTIDMFIPALELADMTNTPTMLVENVANFGKSIECRLLTTGLKWLGHEVETHNYNAADFNGMTKRVRAYLFSSQLGLDDIKATPVPRQAHAWNDVIAPRLNELRDVTHCKTIKKGIDTGRIRVINVGDAIVPTIVKSQSRQVKDSVYVYMNGRYYMPSNDMLKALMGIPADFNTGPFSEEITSEITGQSIEYPMHQAICGKIKQHIYQFMKSFFDLKMITVHA
>NZ_CP018030.1|WP_071971107.1|122364_122565_+|hypothetical-protein
MTVDKKESKDLKYNKKRKPLFRVEIVPSDNAEFLEQIKSDLIAKSGNPKQAIIEMYQFAKEKGYFN
>NZ_CP018030.1|WP_071971105.1|121599_121839_+|hypothetical-protein
MNDFILKYKITFDKLLAYLSFYYLISFYCAAAIPKNFFGLLVVVALVSVPFVLIPKVVKNAVFGIGGGTQKESESTAFK
>NZ_CP018030.1|WP_155761786.1|121391_121562_+|hypothetical-protein
MSRAMPNKEENVPAWRLMLLLFIKPTAVIIIFAVIIFIGTTGSSLFFEEIYKGLSK
>NZ_CP018030.1|WP_071971103.1|120553_120970_-|hypothetical-protein
MQNFIDFLKEEIDTSTKALNSYYDQIEKYAQKAQDAHADRDNTKVRISVVNHLTKAVENVEYEEATLHIYTMTLKNLETHIEENTIDDFVETLLKSLSREIGENNFGNNKLSQKDKAYAEANFYMFKKIIPYVGYAGN
>NZ_CP018030.1|WP_071971120.1|131516_132677_-|hypothetical-protein
MKKTLLATTILATTLLAPITASADIRINGFANFVAGATTNDDESFNNYTGDIDYSNDSLFALQVSSDINSRMTATAQILARGNNDYNAELEWAYITYAGDNDMTYTAGRFRMPLFAYSASLDVGYSYHWLAAPQLVYDVPYRNMDGLKINKAFSGLGFDYNLALSHGNVSGETLGAELTVDQTTLLSLEATNFEWTARAVYGIGDVTLDLNNTDPLLQQLSDFNQAVNAYGFAELGSNILVEDDQGTFVGASLFYDNSKFFAGAEFTVTDLENSFSSKDTAYYFTGGYRFGKWTTSLTYENFESEGDVNYLDDINELAAIDDFSQQLALFAVGVQAGQISETESITATVRYEAARSTALTLESNHVNDKLTDDTATLVRLGVSYVF
>NZ_CP018030.1|WP_071971122.1|132686_133094_-|phosphate-ABC-transporter-substrate-binding-protein
MIKKLTSLGALLCLSFTAFADVSVIINKNNANQLDKDEISKIFLGKAQTFPDGNTVIPVNLASSETRSEFDTTVLGRSSSQINAYWSKAIFTGAGNPPKEVASESELLKLVANNPNVIGYVDSSLVDDSVKVINL
>NZ_CP018030.1|WP_071971124.1|133315_133708_-|hypothetical-protein
MNYVLETFSPAQHLPVNTTSDGMKLLAEALNEKQDSNIIFVAIGECEESTDELVCKTLKEHFQSVFTEALDEECEFIVFMLSDDDSEKTLYCTECGNDMKIDENGISNHIDNDGSIDYELDADHVAIAEE
>NZ_CP018030.1|WP_155761787.1|133925_134291_+|hypothetical-protein
MNIAKFTRKYKYHPLALLIVMIGALIYFSHESEPVSVVIEKKPFIVEEDFSDIKTIIPHEISHIIGARDGEFNKRTVFTASGDTFNLFWDAELLPNMKFEVRELHSGGRLFCVFEKCSVII
>NZ_CP018030.1|WP_071971128.1|134412_135912_+|N-6-DNA-methylase
MKYNLVSNSVCKDEYSELLARIDSNSDYWRNATSPVEKKLRGQHFTPLSMAVQLSVMSSPNVSVKSVIGDPGAGTGILSAALASRLQNQNVSKHFSIYGFETDQRLHEDLSRAWSFFSSQAESNSDYQIQSDFTVHANSLLERGEIDGLSKPDFITTNPPYNKLSSKEPLSLLLKKHGISSPNLYSAFMVLAAKWVADDGHLLAVLPRSFCSGAYFKDFRKFLLENLSIEHITLYKSRSCFKNVLQENILIYARKRKQAGRIRITVAKDPDSKPEYDLVLPSADILNESHWSLPRTVKDIHLYLKNQKRNRTFPDAGYRLSTGKLELHRQSGHLTTKVVYSSDFDNAGSWTWGEKKKPRLLETNSKNRLSLPTSGGYVVLKRISSNDGDEPKRLMPAWLSRTTIGVDVVALENHVQYIHKKGEPLSEDEGKALVEFLSSDEAQAVMRTINGTTQINKPDMDRLNIPFGNSNEIRKSKTMPKVPLESGGKSSRYSEWIQH
>NZ_CP018030.1|WP_071971131.1|135868_136159_+|hypothetical-protein
MAVNPHDIPNGYSIEKHKALSSTIVEPNDIEGQLRNTELKVMTCHETERSHCVGWLYNQLGSGNNIALRIAMMSYENAGDIEVFGEQHKCFQETLR
>NZ_CP018030.1|WP_071971133.1|136232_136547_+|hypothetical-protein
MDKKRVESHTIKTVKYKEERGLIFLMLEVNEFNFQPNSELFYDVTGDETLVVIKNKAFILFSEKFKLTNKAILKKLADQKVCEIVIKHGEELLKGKFLNRGLFT
>NZ_CP018030.1|WP_071971135.1|136572_137877_+|hypothetical-protein
MKIINNVLLTTALLSSTAFAQEVAIIDSAEAGGFQSIEFEVVDSQVAIDDLTSELDTPNLTKLSQTNYNLLADELKGYSSSDIGPSASWLEKETGYHDFETGESVLLGDLFNENCLCIDENGNKVLVVQSLDDVNQLGNEKFFNGQDNADYIESLAEQHSALKSGEGLAAFVLQDESKQDTVPIAVISKTGMMSLFNGLEDEADSGKLNEYTTGAMLYNIIQHELFHSTDYIEHDANLMDKAFIETKAEAVGFFESSKQIIEDGMLSELQNYTDVYNSYVSSLDFYTDSQQDLFKNMGAMYSAVEKNDEALLGNIQDPQIAQFTKSILDGGVDENTVSRLAQGVNSLKSPYLFATASAEIAEQLIAQPELLAEMDDDSVTEMSIKIASKIVETQENSDYFNIEYTQNVPQNVTIGFDLEMDGYEYDEVARHQFN
>NZ_CP018030.1|WP_071971137.1|137908_138664_-|excalibur-calcium-binding-domain-containing-protein
MKFITVLFTLLVVSNTTLAQDTWRGLIIAPENRCSPYDKKSQYPYPQSVEDIIVANMGGIVYGPYTGRIFENDRKTDIEHILSTSEAHDSGLCAASPEVRKQFATDPLNLTLAAPEVNRCNPGGKCGFDAAEWMPEKNKCWFSNRIVELRQKYKLTIDINEARTLENTLRNCESFEMIMFEGRPEQSDLNAISNVQEPNISQKSALTLYDDNGNGKITCKEARAHGIAPVTQDHPAYQYMYDPDKDGVVCE
>NZ_CP018030.1|WP_155761788.1|138681_139158_-|hypothetical-protein
MQSSAIIKKPVTETENLLANLSLVIELNQKVSMSDLNFTAVFIKNGDRCYPLAIDPNTLSSRQITEGLYQCLCKFSYQMDEVRSFFQIFFSGNFHFVLDSSILNSIDSTAYINIVGYDHNTKVDEALGNIYLTLDNTSQYMPLNSLEHHVNVVNDKTL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP018030_1	1.1\|130979\|31\|NZ_CP018030\|CRISPRCasFinder	130979-131009	31	NZ_CP018030	Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence	130979-131009	0	1.0
NZ_CP018030_1	1.2\|131039\|31\|NZ_CP018030\|CRISPRCasFinder	131039-131069	31	NZ_CP018030	Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence	131039-131069	0	1.0
NZ_CP018030_1	1.3\|131099\|31\|NZ_CP018030\|CRISPRCasFinder	131099-131129	31	NZ_CP018030	Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence	131099-131129	0	1.0
NZ_CP018030_1	1.4\|131159\|31\|NZ_CP018030\|CRISPRCasFinder	131159-131189	31	NZ_CP018030	Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence	131159-131189	0	1.0
NZ_CP018030_1	1.5\|131219\|31\|NZ_CP018030\|CRISPRCasFinder	131219-131249	31	NZ_CP018030	Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence	131219-131249	0	1.0
NZ_CP018030_1	1.5\|131219\|31\|NZ_CP018030\|CRISPRCasFinder	131219-131249	31	NZ_CP018030	Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence	131279-131309	0	1.0
NZ_CP018030_1	1.6\|131279\|31\|NZ_CP018030\|CRISPRCasFinder	131279-131309	31	NZ_CP018030	Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence	131219-131249	0	1.0
NZ_CP018030_1	1.6\|131279\|31\|NZ_CP018030\|CRISPRCasFinder	131279-131309	31	NZ_CP018030	Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence	131279-131309	0	1.0
NZ_CP018030_1	1.7\|131339\|30\|NZ_CP018030\|CRISPRCasFinder	131339-131368	30	NZ_CP018030	Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence	131339-131368	0	1.0
NZ_CP018030_1	1.8\|130977\|33\|NZ_CP018030\|CRT	130977-131009	33	NZ_CP018030	Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence	130977-131009	0	1.0
NZ_CP018030_1	1.9\|131037\|33\|NZ_CP018030\|CRT	131037-131069	33	NZ_CP018030	Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence	131037-131069	0	1.0
NZ_CP018030_1	1.10\|131097\|33\|NZ_CP018030\|CRT	131097-131129	33	NZ_CP018030	Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence	131097-131129	0	1.0
NZ_CP018030_1	1.11\|131157\|33\|NZ_CP018030\|CRT	131157-131189	33	NZ_CP018030	Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence	131157-131189	0	1.0
NZ_CP018030_1	1.12\|131217\|33\|NZ_CP018030\|CRT	131217-131249	33	NZ_CP018030	Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence	131217-131249	0	1.0
NZ_CP018030_1	1.13\|131277\|33\|NZ_CP018030\|CRT	131277-131309	33	NZ_CP018030	Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence	131277-131309	0	1.0
NZ_CP018030_1	1.14\|131337\|32\|NZ_CP018030\|CRT	131337-131368	32	NZ_CP018030	Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence	131337-131368	0	1.0
NZ_CP018030_1	1.15\|131396\|33\|NZ_CP018030\|CRT	131396-131428	33	NZ_CP018030	Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence	131396-131428	0	1.0
NZ_CP018030_1	1.12\|131217\|33\|NZ_CP018030\|CRT	131217-131249	33	NZ_CP018030	Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence	131277-131309	1	0.97
NZ_CP018030_1	1.13\|131277\|33\|NZ_CP018030\|CRT	131277-131309	33	NZ_CP018030	Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence	131217-131249	1	0.97
NZ_CP018030_1	1.5\|131219\|31\|NZ_CP018030\|CRISPRCasFinder	131219-131249	31	NZ_CP015608	Bacillus safensis strain U14-5 plasmid unnamed1, complete sequence	21416-21446	8	0.742
NZ_CP018030_1	1.5\|131219\|31\|NZ_CP018030\|CRISPRCasFinder	131219-131249	31	NC_012530	Lactobacillus phage Lb338-1, complete genome	124557-124587	8	0.742
NZ_CP018030_1	1.6\|131279\|31\|NZ_CP018030\|CRISPRCasFinder	131279-131309	31	NZ_CP015608	Bacillus safensis strain U14-5 plasmid unnamed1, complete sequence	21416-21446	8	0.742
NZ_CP018030_1	1.6\|131279\|31\|NZ_CP018030\|CRISPRCasFinder	131279-131309	31	NC_012530	Lactobacillus phage Lb338-1, complete genome	124557-124587	8	0.742
NZ_CP018030_1	1.1\|130979\|31\|NZ_CP018030\|CRISPRCasFinder	130979-131009	31	NC_010625	Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence	1549746-1549776	10	0.677

1. spacer 1.1|130979|31|NZ_CP018030|CRISPRCasFinder matches to NZ_CP018030 (Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence) position: , mismatch: 0, identity: 1.0

atgagatcatcgagcgtttttaactgaataa	CRISPR spacer
atgagatcatcgagcgtttttaactgaataa	Protospacer
*******************************

2. spacer 1.2|131039|31|NZ_CP018030|CRISPRCasFinder matches to NZ_CP018030 (Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence) position: , mismatch: 0, identity: 1.0

ttgtagagaagctagataagccggttgcgtt	CRISPR spacer
ttgtagagaagctagataagccggttgcgtt	Protospacer
*******************************

3. spacer 1.3|131099|31|NZ_CP018030|CRISPRCasFinder matches to NZ_CP018030 (Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence) position: , mismatch: 0, identity: 1.0

atctgttagatggacaagtgaacggtatttt	CRISPR spacer
atctgttagatggacaagtgaacggtatttt	Protospacer
*******************************

4. spacer 1.4|131159|31|NZ_CP018030|CRISPRCasFinder matches to NZ_CP018030 (Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence) position: , mismatch: 0, identity: 1.0

attgcgtgaataaattcaaggggtgtaggct	CRISPR spacer
attgcgtgaataaattcaaggggtgtaggct	Protospacer
*******************************

5. spacer 1.5|131219|31|NZ_CP018030|CRISPRCasFinder matches to NZ_CP018030 (Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence) position: , mismatch: 0, identity: 1.0

agcttcaaaatcggaagaaaacgttatttca	CRISPR spacer
agcttcaaaatcggaagaaaacgttatttca	Protospacer
*******************************

6. spacer 1.5|131219|31|NZ_CP018030|CRISPRCasFinder matches to NZ_CP018030 (Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence) position: , mismatch: 0, identity: 1.0

agcttcaaaatcggaagaaaacgttatttca	CRISPR spacer
agcttcaaaatcggaagaaaacgttatttca	Protospacer
*******************************

7. spacer 1.6|131279|31|NZ_CP018030|CRISPRCasFinder matches to NZ_CP018030 (Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence) position: , mismatch: 0, identity: 1.0

agcttcaaaatcggaagaaaacgttatttca	CRISPR spacer
agcttcaaaatcggaagaaaacgttatttca	Protospacer
*******************************

8. spacer 1.6|131279|31|NZ_CP018030|CRISPRCasFinder matches to NZ_CP018030 (Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence) position: , mismatch: 0, identity: 1.0

agcttcaaaatcggaagaaaacgttatttca	CRISPR spacer
agcttcaaaatcggaagaaaacgttatttca	Protospacer
*******************************

9. spacer 1.7|131339|30|NZ_CP018030|CRISPRCasFinder matches to NZ_CP018030 (Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence) position: , mismatch: 0, identity: 1.0

caatgtacacgaaattccaaacgaaaaaat	CRISPR spacer
caatgtacacgaaattccaaacgaaaaaat	Protospacer
******************************

10. spacer 1.8|130977|33|NZ_CP018030|CRT matches to NZ_CP018030 (Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence) position: , mismatch: 0, identity: 1.0

ggatgagatcatcgagcgtttttaactgaataa	CRISPR spacer
ggatgagatcatcgagcgtttttaactgaataa	Protospacer
*********************************

11. spacer 1.9|131037|33|NZ_CP018030|CRT matches to NZ_CP018030 (Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence) position: , mismatch: 0, identity: 1.0

gattgtagagaagctagataagccggttgcgtt	CRISPR spacer
gattgtagagaagctagataagccggttgcgtt	Protospacer
*********************************

12. spacer 1.10|131097|33|NZ_CP018030|CRT matches to NZ_CP018030 (Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence) position: , mismatch: 0, identity: 1.0

gaatctgttagatggacaagtgaacggtatttt	CRISPR spacer
gaatctgttagatggacaagtgaacggtatttt	Protospacer
*********************************

13. spacer 1.11|131157|33|NZ_CP018030|CRT matches to NZ_CP018030 (Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence) position: , mismatch: 0, identity: 1.0

agattgcgtgaataaattcaaggggtgtaggct	CRISPR spacer
agattgcgtgaataaattcaaggggtgtaggct	Protospacer
*********************************

14. spacer 1.12|131217|33|NZ_CP018030|CRT matches to NZ_CP018030 (Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence) position: , mismatch: 0, identity: 1.0

ggagcttcaaaatcggaagaaaacgttatttca	CRISPR spacer
ggagcttcaaaatcggaagaaaacgttatttca	Protospacer
*********************************

15. spacer 1.13|131277|33|NZ_CP018030|CRT matches to NZ_CP018030 (Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence) position: , mismatch: 0, identity: 1.0

gaagcttcaaaatcggaagaaaacgttatttca	CRISPR spacer
gaagcttcaaaatcggaagaaaacgttatttca	Protospacer
*********************************

16. spacer 1.14|131337|32|NZ_CP018030|CRT matches to NZ_CP018030 (Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence) position: , mismatch: 0, identity: 1.0

gtcaatgtacacgaaattccaaacgaaaaaat	CRISPR spacer
gtcaatgtacacgaaattccaaacgaaaaaat	Protospacer
********************************

17. spacer 1.15|131396|33|NZ_CP018030|CRT matches to NZ_CP018030 (Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence) position: , mismatch: 0, identity: 1.0

tgatagtggtgcgtagcacggatatcgataaaa	CRISPR spacer
tgatagtggtgcgtagcacggatatcgataaaa	Protospacer
*********************************

18. spacer 1.12|131217|33|NZ_CP018030|CRT matches to NZ_CP018030 (Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence) position: , mismatch: 1, identity: 0.97

ggagcttcaaaatcggaagaaaacgttatttca	CRISPR spacer
gaagcttcaaaatcggaagaaaacgttatttca	Protospacer
*.*******************************

19. spacer 1.13|131277|33|NZ_CP018030|CRT matches to NZ_CP018030 (Alteromonas mediterranea strain RG65 plasmid MRG65-300, complete sequence) position: , mismatch: 1, identity: 0.97

gaagcttcaaaatcggaagaaaacgttatttca	CRISPR spacer
ggagcttcaaaatcggaagaaaacgttatttca	Protospacer
*.*******************************

20. spacer 1.5|131219|31|NZ_CP018030|CRISPRCasFinder matches to NZ_CP015608 (Bacillus safensis strain U14-5 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

agcttcaaaatcggaagaaaacgttatttca	CRISPR spacer
ataaagaaaatcggaagaacaccttatttta	Protospacer
*     ************* ** ******.*

21. spacer 1.5|131219|31|NZ_CP018030|CRISPRCasFinder matches to NC_012530 (Lactobacillus phage Lb338-1, complete genome) position: , mismatch: 8, identity: 0.742

agcttcaaaatcggaagaaaacgttatttca	CRISPR spacer
aatactaaaataggtagaaaacgttatttaa	Protospacer
*.. ..***** ** ************** *

22. spacer 1.6|131279|31|NZ_CP018030|CRISPRCasFinder matches to NZ_CP015608 (Bacillus safensis strain U14-5 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

agcttcaaaatcggaagaaaacgttatttca	CRISPR spacer
ataaagaaaatcggaagaacaccttatttta	Protospacer
*     ************* ** ******.*

23. spacer 1.6|131279|31|NZ_CP018030|CRISPRCasFinder matches to NC_012530 (Lactobacillus phage Lb338-1, complete genome) position: , mismatch: 8, identity: 0.742

agcttcaaaatcggaagaaaacgttatttca	CRISPR spacer
aatactaaaataggtagaaaacgttatttaa	Protospacer
*.. ..***** ** ************** *

24. spacer 1.1|130979|31|NZ_CP018030|CRISPRCasFinder matches to NC_010625 (Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence) position: , mismatch: 10, identity: 0.677

atgagatcatcgagcgtttttaactgaataa	CRISPR spacer
gaccgatcatcgaccgtttttaagtgacgcc	Protospacer
.   ********* ********* ***

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr_ID: NZ_CP018030.1|WP_071971444.1|291454_291886_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP018030.1|WP_071971444.1|291454_291886_+|hypothetical-protein

291454_291886_+

143 aa aa

hit_Aca_id	identity	query_coverage	hit_coverage
gnl\|BL_ORD_ID\|33	0.40131578947368424	1	1.0

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP018029

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP018030

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information