CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP018078	Sulfitobacter sp. AM1-D1 plasmid unnamed2, complete sequence	0 crisprs	NA	0	0
NZ_CP018076	Sulfitobacter sp. AM1-D1 chromosome, complete genome	1 crisprs	csa3,WYL,cas3,DEDDh	1	6
NZ_CP018077	Sulfitobacter sp. AM1-D1 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0
NZ_CP018079	Sulfitobacter sp. AM1-D1 plasmid unnamed3, complete sequence	0 crisprs	NA	0	2
NZ_CP018080	Sulfitobacter sp. AM1-D1 plasmid unnamed4, complete sequence	0 crisprs	NA	0	0
NZ_CP018081	Sulfitobacter sp. AM1-D1 plasmid unnamed5, complete sequence	0 crisprs	RT	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 4206

Caldibacillus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071974167.1\|2395_3148_+	hypothetical protein	A0A290FZK7	Caldibacillus_phage	4.8e-29	52.8
WP_071974168.1\|3321_4206_-	DUF1738 domain-containing protein	A0A1V0EEV1	Caulobacter_phage	5.6e-53	41.1

DBSCAN-SWA_2

9694 : 12548

Rhodobacter_phage(33.33%)

integrase

attL 3892:3904|attR 12703:12715

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3892:3904	attL	NA	NA	NA	NA
WP_067267019.1\|9694_10729_+	replication initiator protein A	A0A0K1LLD0	Rhodobacter_phage	7.1e-84	47.2
WP_067267018.1\|10840_11509_+	ParA family protein	A0A0A8IL09	Aurantimonas_phage	2.1e-36	42.5
WP_071974170.1\|11492_11765_+	chromosome partitioning protein ParB	NA	NA	NA	NA
WP_083545778.1\|11918_12548_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4J6I5	uncultured_Caudovirales_phage	2.3e-08	30.5
12703:12715	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP018076

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP018076_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018076_1

566658-566740

Orphan

Consensus_repeat	Method
CCGTTGTCATCGCCCGGTGCATCGTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP018076_1

>merge|NZ_CP018076|1|566658-566740|CRISPRCasFinder
CCGTTGTCATCGCCCGGTGCATCGTCTGCGCCGCGACCCCTGCCGCCGTTGCGGCCACCGTTGTCATCGCCGGGTGCATCGTC

>NZ_CP018076|1|1|566658-566740|CRISPRCasFinder
CCGTTGTCATCGCCCGGTGCATCGTC	TGCGCCGCGACCCCTGCCGCCGTTGCGGCCA
CCGTTGTCATCGCCGGGTGCATCGTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018076.1\|WP_071970106.1\|562299_563310_+\|TRAP-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270383
NZ_CP018076.1\|WP_071970126.1\|575576_576782_+\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341470
NZ_CP018076.1\|WP_172839489.1\|574545_575580_+\|Ldh-family-oxidoreductase	unknown	unknown	gnl\|CDD\|376860
NZ_CP018076.1\|WP_071970101.1\|558553_559540_+\|NAD(P)H-quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|176180
NZ_CP018076.1\|WP_071970110.1\|565988_566444_+\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NZ_CP018076.1\|WP_071970118.1\|571205_572201_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224093
NZ_CP018076.1\|WP_071970108.1\|563490_565860_-\|transketolase	unknown	unknown	gnl\|CDD\|225329
NZ_CP018076.1\|WP_172839487.1\|559577_560204_+\|glutathione-S-transferase-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|182533
NZ_CP018076.1\|WP_071973603.1\|568638_569280_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP018076.1\|WP_071970116.1\|570199_571165_-\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|380534
NZ_CP018076.1\|WP_071970098.1\|555945_556791_+\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223257
NZ_CP018076.1\|WP_071970104.1\|560906_562205_+\|TRAP-transporter-large-permease	unknown	unknown	gnl\|CDD\|224509
NZ_CP018076.1\|WP_071970096.1\|554922_555903_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|132257
NZ_CP018076.1\|WP_071970120.1\|572197_573760_-\|sugar-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224053
NZ_CP018076.1\|WP_071970127.1\|576793_578257_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143421
NZ_CP018076.1\|WP_172839488.1\|567202_568642_+\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|226951
NZ_CP018076.1\|WP_083545622.1\|560388_560907_+\|TRAP-transporter-small-permease	unknown	unknown	gnl\|CDD\|377284
NZ_CP018076.1\|WP_071970114.1\|569542_570136_-\|DJ-1/PfpI-family-protein	unknown	unknown	gnl\|CDD\|153243
NZ_CP018076.1\|WP_071970122.1\|573756_574443_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP018076.1\|WP_071970099.1\|556822_558541_+\|FAD-dependent-monooxygenase	unknown	unknown	gnl\|CDD\|235704

Protein	Function_ID	Function_description	E-value
NZ_CP018076.1\|WP_071970106.1\|562299_563310_+\|TRAP-transporter-substrate-binding-protein	gnl\|CDD\|270383	cd13665, PBP2_TRAP_Dctp3_4, Periplasmic substrate-binding component of TRAP-type C4-dicarboxylate transport system DctP3 and DctP4; the type 2 periplasmic-binding protein fold. This group includes uncharacterized DctP3 and DctP 4 subfamilies of TRAP Transporters specific to C4-dicarboxylates such as succinate, malate and fumarate. TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. This CD also included some eukaryotic homologs that have not been functionally characterized. TRAP transporters are comprised of a periplasmic substrate-binding protein (SBP; often called the P subunit) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process (the M subunit) and a smaller membrane of unknown function (the Q subunit). The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	2.17222e-93
NZ_CP018076.1\|WP_071970126.1\|575576_576782_+\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341470	cd08191, Fe-ADH-like, Iron-containing alcohol dehydrogenases-like. This family contains iron-containing alcohol dehydrogenase (Fe-ADH) which catalyzes the reduction of acetaldehyde to alcohol with NADP as cofactor. Its activity requires iron ions. The protein structure represents a dehydroquinate synthase-like fold and is a member of the iron-activated alcohol dehydrogenase-like family. It is distinct from other alcohol dehydrogenases which contain different protein domain. Proteins of this family have not been characterized.	0
NZ_CP018076.1\|WP_172839489.1\|574545_575580_+\|Ldh-family-oxidoreductase	gnl\|CDD\|376860	pfam02615, Ldh_2, Malate/L-lactate dehydrogenase. This family consists of bacterial and archaeal Malate/L-lactate dehydrogenase. L-lactate dehydrogenase, EC:1.1.1.27, catalyzes the reaction (S)-lactate + NAD(+) <=> pyruvate + NADH. Malate dehydrogenase, EC:1.1.1.37 and EC:1.1.1.82, catalyzes the reactions: (S)-malate + NAD(+) <=> oxaloacetate + NADH, and (S)-malate + NADP(+) <=> oxaloacetate + NADPH respectively.	2.19418e-122
NZ_CP018076.1\|WP_071970101.1\|558553_559540_+\|NAD(P)H-quinone-oxidoreductase	gnl\|CDD\|176180	cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase. PIG3 p53-inducible quinone oxidoreductase, a medium chain dehydrogenase/reductase family member, acts in the apoptotic pathway. PIG3 reduces ortho-quinones, but its apoptotic activity has been attributed to oxidative stress generation, since overexpression of PIG3 accumulates reactive oxygen species. PIG3 resembles the MDR family member quinone reductases, which catalyze the reduction of quinone to hydroxyquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	1.14707e-122
NZ_CP018076.1\|WP_071970110.1\|565988_566444_+\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	4.19456e-39
NZ_CP018076.1\|WP_071970118.1\|571205_572201_-\|ABC-transporter-permease	gnl\|CDD\|224093	COG1172, AraH, Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components [Carbohydrate transport and metabolism].	8.06063e-76
NZ_CP018076.1\|WP_071970108.1\|563490_565860_-\|transketolase	gnl\|CDD\|225329	COG2609, AceE, Pyruvate dehydrogenase complex, dehydrogenase (E1) component [Energy production and conversion].	0
NZ_CP018076.1\|WP_172839487.1\|559577_560204_+\|glutathione-S-transferase-C-terminal-domain-containing-protein	gnl\|CDD\|182533	PRK10542, PRK10542, glutathionine S-transferase; Provisional.	1.80557e-42
NZ_CP018076.1\|WP_071973603.1\|568638_569280_+\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	1.08531e-64
NZ_CP018076.1\|WP_071970116.1\|570199_571165_-\|substrate-binding-domain-containing-protein	gnl\|CDD\|380534	cd06311, PBP1_ABC_sugar_binding-like, periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.	2.1614e-88
NZ_CP018076.1\|WP_071970098.1\|555945_556791_+\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|223257	COG0179, MhpD, 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism].	9.27104e-89
NZ_CP018076.1\|WP_071970104.1\|560906_562205_+\|TRAP-transporter-large-permease	gnl\|CDD\|224509	COG1593, DctQ, TRAP-type C4-dicarboxylate transport system, large permease component [Carbohydrate transport and metabolism].	2.62044e-74
NZ_CP018076.1\|WP_071970096.1\|554922_555903_+\|VOC-family-protein	gnl\|CDD\|132257	TIGR03213, Biphenyl-23-diol_12-dioxygenase_1, 2,3-dihydroxybiphenyl 1,2-dioxygenase. Members of this protein family all have activity as 2,3-dihydroxybiphenyl 1,2-dioxygenase, the third enzyme of a pathway for biphenyl degradation. Many of the extradiol ring-cleaving dioxygenases, to which these proteins belong, act on a range of related substrates. Note that some members of this family may be found operons for toluene or naphthalene degradation, where other activities of the same enzyme may be more significant; the trusted cutoff for this model is set relatively high to exclude most such instances. [Energy metabolism, Other].	4.06195e-94
NZ_CP018076.1\|WP_071970120.1\|572197_573760_-\|sugar-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	0
NZ_CP018076.1\|WP_071970127.1\|576793_578257_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143421	cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like. Succinate-semialdehyde dehydrogenase, mitochondrial (SSADH, GabD, EC=1.2.1.24) catalyzes the NAD+-dependent oxidation of succinate semialdehyde (SSA) to succinate. This group includes the human aldehyde dehydrogenase family 5 member A1 (ALDH5A1) which is a mitochondrial homotetramer that converts SSA to succinate in the last step of 4-aminobutyric acid (GABA) catabolism. This CD also includes the Arabidopsis SSADH gene product ALDH5F1. Mutations in this gene result in the accumulation of H2O2, suggesting a role in plant defense against the environmental stress of elevated reactive oxygen species.	0
NZ_CP018076.1\|WP_172839488.1\|567202_568642_+\|sensor-histidine-kinase	gnl\|CDD\|226951	COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms].	2.05515e-42
NZ_CP018076.1\|WP_083545622.1\|560388_560907_+\|TRAP-transporter-small-permease	gnl\|CDD\|377284	pfam04290, DctQ, Tripartite ATP-independent periplasmic transporters, DctQ component. The function of the members of this family is unknown, but DctQ homologs are invariably found in the tripartite ATP-independent periplasmic transporters.	1.48214e-13
NZ_CP018076.1\|WP_071970114.1\|569542_570136_-\|DJ-1/PfpI-family-protein	gnl\|CDD\|153243	cd03169, GATase1_PfpI_1, Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. PfpI is an ATP-independent intracellular proteases which may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.	6.58757e-85
NZ_CP018076.1\|WP_071970122.1\|573756_574443_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	3.2137e-40
NZ_CP018076.1\|WP_071970099.1\|556822_558541_+\|FAD-dependent-monooxygenase	gnl\|CDD\|235704	PRK06126, PRK06126, hypothetical protein; Provisional.	1.06074e-131

>NZ_CP018076.1|WP_071970110.1|565988_566444_+|Lrp/AsnC-family-transcriptional-regulator
MIDKIDGDIMKALIRNGRASINEISESVGLSQTPVARRIRRLEQDGIITGYTALVDEAELGFAVSVFVSVKLDRQVDEALETFEAAISDYPEVVDCWLMTGSRDYLLRIATESLKTFEVFLVGKLTKVHGVASIESSIPLRRVKSGLSRAI
>NZ_CP018076.1|WP_071970108.1|563490_565860_-|transketolase
MTSNLKLTEQRLLWLSHWMIHHANHIRPKVDGIKVGGHQASSASMVSIMTALYFSALRPEDRVAVKPHASPVFHAIQYLMGNTTREKLENFRGLGGAQSYPSRTKDIDDVDFSTGSVGLGVAITSFASLTQDYVTAKDWGRDVAPGRMIALVGDAELDEGNIYECLQEGWKNGLRNTWWIIDYNRQSLDGVIREGLWQRIEKIFDAFGWDVVRVKYGALQRAAFEEEGGEALRDWIEKCPNQLYSALTYQGGAVWRKRLLDELGDQGPVSRLIERRSDAELAALMENLGGNCVQTMADTFAAIDHDRPTCFLAYTIKGWGTPIAGHKDNHGGLMTTAQMAEWKAHMGVEDGTEWEPMATVPDPDAYRDWLSKVPFFARGTRRHDDARIAVPEIAVPKDAEIASQMAFGKLLDTIGRSDSALAERIITMSPDVTGTTSLGPWVNRRKLFARETQTDTFREEKIPSTAKWDFAPEGQHFELGIAEMNLMLMLGAAGLSHSLFGRRLIPIGTVYDPFVARGLDALNYACYQDARFLLVGTPSGVSLAPEGGAHQSIGSPLIGMSQDGIAAFEPAFADELAAILEWSFDYLQRDGEGDPDERTWLRDETGGSVYLRLSTNPIEQPGPRPDPDWRQGAIDGAYWLRKPGPNCEVVIAYQGVIAPEAIRAAGMLGEFRRDIGVLAVTSADRLNAGWTAAQRARARGQRAQSLAERLLSPLPRDCRIVTVIDGHPATLAWLGSVAGHVTVPLGVEHFGQTGTIGDLYKAHGIDADAIVERVRGLTAGKKVPTLLAG
>NZ_CP018076.1|WP_071970106.1|562299_563310_+|TRAP-transporter-substrate-binding-protein
MRISQIICAAALAAGLTGPAMAKETLRFASFEPAGAFLTGTIFALWAEDVAAASEGTLEIKIFPGGTLGRDPAAQIDLVENGVADIAWAIPGYAPGRFDESTVIELPFLVKNSEAASYAAWKVFEDGLLGGDYDKFKMLGTFSSPPNMIAATIPLVEPSDMKGVNFRAPGPTQLKAIEATGAVPVGGITGPSLAEALNRDLIKGLSTEFLAVETFRLEELLTNYTVVPMGATPMLVIMNKQRYESLPDAAKAAIDKYSGAAFSERFGKAFDERVATIRERVTARDDVTIVAPTEAQVELWRDATSVATEDWLAAKDGRQSLYDAFAAAMKEHPASQ
>NZ_CP018076.1|WP_071970104.1|560906_562205_+|TRAP-transporter-large-permease
MDPTILAFVGFAGMFLLIGLHVPIGVAMAVVGVSGFAAIAGWAPALSLLATEPASTMSNLDLAVIPLFMLMGSLATTAGLAGDIYATAEALIGHRRGGLVATTVVASAGFGAVCGSGVATTATFGRVALPEMLGRGYSEKISAGSVAAGGTLGIIVPPSSIMILYAVLTENSILDLFSAALVPALLTVSLYLAAIFIVARLRPESMPGSTRQPLATRLRVLTRAWGVILLAVVVLGGIYSGIFTVNEAASVGTVIAFLFALGRGKLNRESFLAVLSEASVATVMIYVVVFGATIFSYFISITGVAANIIAGIEWLDLPALGVILLLVLLYLFLGAFFDEVAAIVITLPFVLPLVLSLGYDPVWWGILNVALVGIGMLTPPIGLNVMLLSSMRPDIPLSSIYRGVVPFFLADCVRILILVLFPAVTLWLPSIL
>NZ_CP018076.1|WP_083545622.1|560388_560907_+|TRAP-transporter-small-permease
MALIGFAGLLVLAIMTTLDVLMRWLFDNPIHGVNDVSAVVMAVVIASCIPANLEGRRNISVDVLGAMTGRRATRLLDAFGGFVTLLFIGAVAWQFIGYADSMYHSGRRTWVLALPLWPWWAAATAFLWFAALIQLANVIRDLHRTLTGGSDGHASPHPIRPDAADSLGHTES
>NZ_CP018076.1|WP_172839487.1|559577_560204_+|glutathione-S-transferase-C-terminal-domain-containing-protein
MKLYYAPGACSIGTHFLMEEMGLTYDTGRLDLKQGDQLKPAYLDVNPKAKVPALVRDDGSLLTEFVAIAFWLGRTYPEKGMIPEGMEAEVRTLEMLDYAVATIHMQGFSRLFRPAKFARSEAEHDWVREQGRAVVDKAFGIVSERLGSSDFIMGDRLTLADAALFYVLFWGVDRVKLDVPENLAAYYARLRARPSAQKVFADEGIQFS
>NZ_CP018076.1|WP_071970101.1|558553_559540_+|NAD(P)H-quinone-oxidoreductase
MSIPTTQRVIVISKAGGPDVLVPAEVPVPSPGEGQVLIEVAAAGINRHDVHQRANGIHHDGSPTPGLEVCGRVVAVGAGVTAPAIGDRVMALVQGGGYGEYAVAAAALALPVPENVSDAEAACVPEALFTAWWNYFGLMDLQKDQFGLFHGGTSGVGHLALQALSALGYRVIATAGSERKVKAAKEFGAFEALNYNDAALAEKVLDATDGTGISCLIDVSAGAHLTQDVAMMAPDGTIAHLSAGGGAELSLPLRSIMAKRIRITGSFLRPLALELKTQVADRLRREVLPLIGNEVRPVIAQQFELMDAKGAHAGMEKASHIGKIVLVA
>NZ_CP018076.1|WP_071970099.1|556822_558541_+|FAD-dependent-monooxygenase
MTTPTVDIAIVGGGPVGLTAANLAGHLGLSTALFERNDATSFHPRGHVLNTRTMEIWRQVGMESAINDAALPIERHAGIGFVTSLAGEEIGHIQTRGDAVRDRLERSWSPALKRSCPQDVIEPILRRHADRRESVELAFGTEVTGLERDGEGYRLRWVDRDGQAGETFARYLIGADGPRSFVREWLGIEMHGRSMGQQMGVYFHADLWKFIETRPYLLWWVYNARTTGVLIAMDGRNRWTFNFAYGAEESRHDFSEERCLELIRAAIGEDVPVEIRSIMPWRMQARIAERMGKGRAFLAGDAAHPLPPTGGQGMNTGVADVHNLVWKIAMVIRGVAPEALLDSYDLERRPVATFNVEQSARNAEAMAKSGLAGMLANDSAVTQNIEGPESAAVRARLAEAIPKQRGHFDYPGQTFGYSYDGDLITPDGTAPPPLDIETYVPSARPGMRAPHFPILKDGAEASVLNLFEYGSFTLLAAPQAADIAADLVEGAEFLGVPCRAHVVGPGAGVEPVGSDWLDLYGIGPAGLVLIRPDGHVACRLPTTDAYSLKNLTMALTASTGAKSPAVSGQTVS
>NZ_CP018076.1|WP_071970098.1|555945_556791_+|fumarylacetoacetate-hydrolase-family-protein
MKIASYILPNGQRSYGKVDGDTVTDAGAALKADFPDLRALLAGGAIDRLEAAEGATVALDDLTLLPTIPNPDKIICIGLNYMGHIRETGKDKPAKPSIFTRYPSTLVGHGAAMIRPKVSDTFDFEGEFTVVIGKAGRNIPAARALEHVAGYTCLNDGSIREWQRHTTQFWAGKNFDRSGSMGPWLVTADEIPDPATQKMETRLNGEVVQSTPISDLAFSIPELIEYLSTVTELLPGDVIATGTPSGVGAFREPKLWMKPGDRIEIDISGIGILSNPIEDEA
>NZ_CP018076.1|WP_071970096.1|554922_555903_+|VOC-family-protein
MTLKSLGYIGVNSSRTADWSSFATDLLGMQQVDRGGSSRAFRMDDRKQRLIVTGEGEDNLAFMGWEVDTPDDLDRLASKLENAGVEVTWHGSALADQRHVARLISFHDPDGNCIEVFSGPEIASDPFVPGRPISGFKTGTLGMGHAVLHVENVEGLLEFYRDLLGFSVTDYGLTPYPLYFFHINGRHHSFAMVGSGRKGLHHFMVELQMLDDVGQAYDIAEAEKDRVAYTLGRHSNDHMMSFYANSPSGFFVEYGWGAQVIDPATWEPFETHEGPSTWGHERVHLPEDSEVRQRMRDMRMNNARTGFRAADPVPNCAWLDTVVHRE
>NZ_CP018076.1|WP_172839488.1|567202_568642_+|sensor-histidine-kinase
MATLEENLAASRGAGLAAPLARWLAAWPLHHRFAMVGSFVTLVGMAVIGSLVSTSIESSVVRNSAISSAVYMESFIAPMSQELASSQRLSDGTVARMEALLKQPPLSERVVSAKIWRPDGLLAFSSDADLIGRTFPPSDDLLEAWRGDLNASFDDLEGAESLRERESGVPLLEVYNPIHSILTGEIIAVAEFYLDATELEADLRAAHVRAWAVVALVTGITFLALFGIVRSGSRTIEDQTHRLTAQLAELARISAQNEALRTRVEVASQRVSETNERYMRRVSAELHDGPAQALALASLRLDALMRRAGVTPGDPEAQMLRDCLGEALRDVRDLCSGLTLPELEGLSVSETLDLAIRAHERRSGVTVDRAFLHEPAMMKPAPHPFLICIYRFVQEGLMNAFRHAPGARVRVKAHTEPGRTIIEVQDEGPGFNIATRTLGGLGLPGLRERVESIGGSFEIKSSPQSGTSLTMSLQTGALW
>NZ_CP018076.1|WP_071973603.1|568638_569280_+|response-regulator-transcription-factor
MTSKIQIIVADDHPLFRGGVVLTLQEHGGFTVVAQAGTAEEAVAAVEAHLPEVILLDISMPGSGLAAAAEIARRFPAVAIVMLTASEADDDLLTALKVGARGYALKGISENALTDILLSVAAGASYVPPALAGRVLAALQDRRNMRLPEVEELTDRETDILRHVALGQSNKEIARALGLQEKTIKHYMTNILQKLQVRNRVEAALKARELGLS
>NZ_CP018076.1|WP_071970114.1|569542_570136_-|DJ-1/PfpI-family-protein
MSGKKILMLCGEFTEEYEIYVYQQGMEAVGHTVHVVCPDKNAGDMIATSLHDFEGHQTYTEKPGHNAEINKTFSEAEAELDSYDAVYAAGGRGPEYIRTDPRVQAIVKHFHETGKPIFTICHGVQILMAVPGVLEGKTVAGLGACAPEVTAVGGIYYDADPKEAYVDGTMVSAKGWTALAAFMRECLKVLGTEIRHT
>NZ_CP018076.1|WP_071970116.1|570199_571165_-|substrate-binding-domain-containing-protein
MKTSNKGTTFLSAAVIAGGLVATTAHAQDTEFTIAVSIPAATHGWTGGVVYHAQEAERQIEEAYPNIDVIVSTASSATAQVSSLEDLSATNELDALVILPFTSEELTGPVEQVASNGTFITVVDRGLADPSIQDLYVAGDNIAVGANTAEWLVDKLGGEGEIVVLRGIPTVIDDERIQGFTEVIDKSDIKILDIQYANWNQDEAFTLMQDYLGKYPNIDAVWANDDDMLLGVLEAVDMAGRDDVKYALGGNGMKQVIEMVMAGDERTPISTPYAPSMIASAMFMTAAQFAGQAPMRGSFKLDAPLITPENADQFYFPDSPF
>NZ_CP018076.1|WP_071970118.1|571205_572201_-|ABC-transporter-permease
MSSAEIASLPESEGFRIRWADMAPFIALALIVLLGALINSNFMAANNLMNVITRSAFIAIIGVGATFVIATGGLDLSIGSMMAFVVGIMIMAMNSLAPQIGVWAIPVGALVALVVGSLCGLMNGLIITVGRIEPFIVTLGTMGIFRAFITYMTDGGSLSIDRSLRSAYRPLYFGDFLGVPYPVIITVVVALIGAFVLYRTKYGRRVTAVGSNSDVARFSGVHVGRVRTMAFVIQGFCVAVAAICYVPRLGAATPTTGQLWELQVITAVVIGGTLLRGGKAHIWGTVAGALILEVIANVMVLSDMVSEYLVAAVQGAIIIIAMLAHRFTSAR
>NZ_CP018076.1|WP_071970120.1|572197_573760_-|sugar-ABC-transporter-ATP-binding-protein
MNQPRPDTLQDAPAVSEPAVLRADGLSKAYGPITVLSGVTLDIRAGEVHAIIGENGAGKSTLMKMLSGHTPPTEGSLEMSGQTVAFADAVQAEDAGIVLVHQEILLAADLTVAQNLFLGRELSRGLRVDDRAMNRRTAEVLERVGCVARPTTRVGDMPLAQRQLVQIARALLDDRKVVILDEPTAMLANDEVDALLGIVRNLRDQGVAVLYISHRLEEVEALADRVTVLRDGEMIGTWRAREMDQRRMAELMVGRELSMLYPPKRGPATTDPILAVEDLSVDHGKFVGSFTARPGEVLGLGGMIGAGRTELIEGLMGLRPAQARAITVNGKSITKPDVQKMMSAGLVYLTEDRKGKGLLLNEGLGPNLTLQALGKVNPGVRLDRRKEVRSVKSTVQEYDIRVRSLSIEAGQLSGGNQQKLLLAKVMLADPSVVIIDEPTRGIDIGNKSQIYHFIDDLVRAGKACVVISSELPELVGLSDRVLVMRGGRFVVELTGEDITEQNVVYAAASSGNDTEGRKTA
>NZ_CP018076.1|WP_071970122.1|573756_574443_-|GntR-family-transcriptional-regulator
MAEAANISEKGALVRPPSIAESVHQRIYERIMALEIPPGARIPIDGLSRDLNVSQTPVREALTRLEREGLVRKAHLIGYSASPQLTHKEFDDLYKFRLMLEPESARQACLKLTPETLADIEAAAADMEKGEQPVDRNSRYSRFARADAHFHDEILKVADNATVRQALNDQHIHLHIFRLMFHTRVTQEALEEHEQLLAAFRAGDPDAAYKAMHDHISFSHDRLVAAFE
>NZ_CP018076.1|WP_172839489.1|574545_575580_+|Ldh-family-oxidoreductase
MRVLVSAEALHDISKNALMYQGVTDVHADIQSDVLIEAELRDLPSHGLQRLPRLIERLETGLANPTASGTGQWSRPSVMLVDGNRGLGPVVMMETLEKLAVAVDEQGIVVGAIRNANHIGMLAYYAEAAALRGLMAIVMTTSEALVHPFGGTEAMLGTNPIAIGIPTGAAPFILDLATSKVSMGKIHHHALTGDPIPDDWAVDTAGNRTTDPVAAKTGAIAPFGEAKGFGLGLGVELLVAALSGSAFAPEVRGTLDAQEVANKGDVFVLIDPKAGQGTAKHLAGYLDRLRASRPADADRPVLVPGDGMRSRRARALSTGIEIPEKLYQEICALRGRDDMQQETT
>NZ_CP018076.1|WP_071970126.1|575576_576782_+|iron-containing-alcohol-dehydrogenase
MTLFGTIRAPRELIFGAGQRDALGRVAARLGRRALVVTDERLAADADFLRLVGQLEAAGVEVKVDGSTLPDVPVETAVASAEAARGFAPDLVIGVGGGSCLDMAKCVAVLLTHGGKPQDYYGEFMVPGPVMPLIAVPTTAGTGSEVTPVAVLSDSERQLKVGISSPHLIPTASICDPELTVTCPASLTAIAGADALTHAIEAFTAIRREPVAGLAQERVFVGKNATSDHFALTAIGLLWEGLETACTDPGNADARAKVMLGATTAGLAFGVAGTAAAHAIQYPVGALTHTAHGAGVACLMPYVMAWNAPEIGPELDQIAETIGLAAGADVIPAFTSLFARIGIPSSLRELGLAEDRIDWVAEQSCGISRLIQNNPRPLPPQDMRRLVGAAYHGDIAGLETN
>NZ_CP018076.1|WP_071970127.1|576793_578257_+|NAD-dependent-succinate-semialdehyde-dehydrogenase
MTLDTVFTGYAAPSLHAEGLFIGGKWEAGTGITVSDPSTGDTLAEVPDATIDDAMRAVDAAEAAAADWRSTPPRQRSEILRRWFTLMTEHTEELAMLISVENGKALADARGEVAYAAEFFRWYAEEATRIGGEFRHAPSGAHNILVDHEPIGIAVLITPWNFPAAMATRKIGPALAAGCTVILKPASETPLTAYAMARLGAEAGVPAGVVNVLTTANPGPVTAAMLADPRVRKLSFTGSTGVGRILLGEAAKTVVNCSMELGGNAPFVVFDDADLDAALDGAMVAKMRNGGEACTAANRFYVQSGIYDAFVEGLTKRMAALKLGAGYAPDTQCGPMITPQAVDKINRLVEEAKSRGARVTTGGALQDGRGYYYPPTVLEAVPTDAALAHEEIFGPVAAVYRFEAEDEAVRLANDTEYGLAAYVYSQDIMRAMRVGRRIETGMVGINRGLMSDPAAPFGGAKQSGLGREGGVTGILEFMEPKYFAVEF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP018076_1	1.1\|566684\|31\|NZ_CP018076\|CRISPRCasFinder	566684-566714	31	NC_017957	Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence	637900-637930	5	0.839
NZ_CP018076_1	1.1\|566684\|31\|NZ_CP018076\|CRISPRCasFinder	566684-566714	31	NZ_CP033227	Sphingobium yanoikuyae strain SJTF8 plasmid pF1, complete sequence	160465-160495	5	0.839
NZ_CP018076_1	1.1\|566684\|31\|NZ_CP018076\|CRISPRCasFinder	566684-566714	31	NZ_CP017244	Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence	781585-781615	6	0.806
NZ_CP018076_1	1.1\|566684\|31\|NZ_CP018076\|CRISPRCasFinder	566684-566714	31	NZ_CP010421	Azotobacter chroococcum NCIMB 8003 plasmid pAcX50f, complete sequence	282112-282142	6	0.806
NZ_CP018076_1	1.1\|566684\|31\|NZ_CP018076\|CRISPRCasFinder	566684-566714	31	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1160892-1160922	7	0.774
NZ_CP018076_1	1.1\|566684\|31\|NZ_CP018076\|CRISPRCasFinder	566684-566714	31	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	652642-652672	7	0.774
NZ_CP018076_1	1.1\|566684\|31\|NZ_CP018076\|CRISPRCasFinder	566684-566714	31	NZ_CP006369	Aureimonas sp. AU20 plasmid pAU20b, complete sequence	359145-359175	7	0.774
NZ_CP018076_1	1.1\|566684\|31\|NZ_CP018076\|CRISPRCasFinder	566684-566714	31	NZ_CP019045	Halioglobus pacificus strain RR3-57 plasmid pRR3-57, complete sequence	117549-117579	8	0.742
NZ_CP018076_1	1.1\|566684\|31\|NZ_CP018076\|CRISPRCasFinder	566684-566714	31	NZ_CP009123	Sphingopyxis fribergensis strain Kp5.2 plasmid pSfKp5.2, complete sequence	198201-198231	8	0.742
NZ_CP018076_1	1.1\|566684\|31\|NZ_CP018076\|CRISPRCasFinder	566684-566714	31	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	325427-325457	9	0.71

1. spacer 1.1|566684|31|NZ_CP018076|CRISPRCasFinder matches to NC_017957 (Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence) position: , mismatch: 5, identity: 0.839

tgcgccgcgacccctgccgccgt--tgcggcca	CRISPR spacer
tgcgccgcgaagcctgccgccgtgccgcggc--	Protospacer
**********  ***********  .*****

2. spacer 1.1|566684|31|NZ_CP018076|CRISPRCasFinder matches to NZ_CP033227 (Sphingobium yanoikuyae strain SJTF8 plasmid pF1, complete sequence) position: , mismatch: 5, identity: 0.839

tgcgccgcgacccctgccgccgtt-gcggcca	CRISPR spacer
ggcgcagcgacccctgccgctgttcgccgcc-	Protospacer
 **** **************.*** ** ***

3. spacer 1.1|566684|31|NZ_CP018076|CRISPRCasFinder matches to NZ_CP017244 (Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence) position: , mismatch: 6, identity: 0.806

tgcgccgcgacccctgccgccgttgcggcca	CRISPR spacer
tacgccgcgacccccgccgcctttgcgacag	Protospacer
*.************.****** *****.* .

4. spacer 1.1|566684|31|NZ_CP018076|CRISPRCasFinder matches to NZ_CP010421 (Azotobacter chroococcum NCIMB 8003 plasmid pAcX50f, complete sequence) position: , mismatch: 6, identity: 0.806

tgcgccgcgacccctgccgccgttgcggcca	CRISPR spacer
tcaggctcgaccactgccgccgctgcggcca	Protospacer
*  * * ***** *********.********

5. spacer 1.1|566684|31|NZ_CP018076|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 7, identity: 0.774

tgcgccgcgacccctgccgccgttgcggcca	CRISPR spacer
agcgccgcgacccctgcccccgtacccgtcc	Protospacer
 ***************** ****  * *.*

6. spacer 1.1|566684|31|NZ_CP018076|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 7, identity: 0.774

tgcgccgcgacccctgccgccgttgcggcca	CRISPR spacer
agcgccgcgacccctgcccccgtacccgtcc	Protospacer
 ***************** ****  * *.*

7. spacer 1.1|566684|31|NZ_CP018076|CRISPRCasFinder matches to NZ_CP006369 (Aureimonas sp. AU20 plasmid pAU20b, complete sequence) position: , mismatch: 7, identity: 0.774

tgcgccgcgacccctgccgccgt--tgcggcca	CRISPR spacer
tgcgccgcgccgcctgccgccgtgaggtggt--	Protospacer
********* * ***********   *.**.

8. spacer 1.1|566684|31|NZ_CP018076|CRISPRCasFinder matches to NZ_CP019045 (Halioglobus pacificus strain RR3-57 plasmid pRR3-57, complete sequence) position: , mismatch: 8, identity: 0.742

tgcgccgcgacccctgccgccgttgcggcca	CRISPR spacer
aacccaccgacccctgcccccggtgcggcct	Protospacer
 .* *  *********** *** *******

9. spacer 1.1|566684|31|NZ_CP018076|CRISPRCasFinder matches to NZ_CP009123 (Sphingopyxis fribergensis strain Kp5.2 plasmid pSfKp5.2, complete sequence) position: , mismatch: 8, identity: 0.742

tgcgccgcgacccctgccgccgttgcggcca	CRISPR spacer
tcgacgtcgagccctgccgcctttgcggccg	Protospacer
*  .*  *** ********** ********.

10. spacer 1.1|566684|31|NZ_CP018076|CRISPRCasFinder matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 9, identity: 0.71

tgcgccgcgacccctgccgccgttgcggcca	CRISPR spacer
cctgccgcgactcctgccgccggtgcgcggc	Protospacer
. .********.********** ****

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

828920 : 837038

Tetraselmis_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071970557.1\|828920_829409_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	3.0e-16	40.0
WP_071970560.1\|829489_829714_-	DUF465 domain-containing protein	NA	NA	NA	NA
WP_071970562.1\|829874_830288_+	Hsp20 family protein	A0A0E3HCM0	Synechococcus_phage	8.7e-17	40.5
WP_071970564.1\|830291_830510_+	DUF1150 family protein	NA	NA	NA	NA
WP_071970566.1\|830604_831495_+	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
WP_071970568.1\|831491_832352_+	hypothetical protein	A0A1V0SAK9	Catovirus	5.1e-11	33.6
WP_071970570.1\|832408_834124_-	bifunctional sulfate adenylyltransferase/adenylylsulfate kinase	A0A2P1ELS9	Moumouvirus	1.5e-118	43.1
WP_071970572.1\|834265_835957_-	adenylate/guanylate cyclase domain-containing protein	M1HLN3	Pelagibacter_phage	5.3e-12	29.4
WP_071970574.1\|836027_837038_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	2.7e-67	45.6

DBSCAN-SWA_2

1669153 : 1710231

Emiliania_huxleyi_virus(15.38%)

capsid,terminase,tRNA,portal,head,protease,tail,integrase

attL 1687973:1687988|attR 1694125:1694140

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071971698.1\|1669153_1671817_+\|tRNA	alanine--tRNA ligase	A0A2K9L3D8	Tupanvirus	1.4e-78	41.9
WP_071971699.1\|1671821_1672109_+	DUF1330 domain-containing protein	NA	NA	NA	NA
WP_071971700.1\|1672105_1672453_+	DMT family protein	NA	NA	NA	NA
WP_071971701.1\|1672455_1672779_-	cupin domain-containing protein	NA	NA	NA	NA
WP_071971702.1\|1672775_1674593_-	translational GTPase TypA	A0A2K5B2A5	Erysipelothrix_phage	6.5e-24	46.3
WP_071973718.1\|1674718_1675048_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_172839567.1\|1675064_1675526_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_071971704.1\|1675636_1675843_+	hypothetical protein	NA	NA	NA	NA
WP_071971705.1\|1675845_1676640_+	class II glutamine amidotransferase	NA	NA	NA	NA
WP_172839514.1\|1676715_1678044_-	hypothetical protein	NA	NA	NA	NA
WP_071971707.1\|1678305_1679520_-	NADP-dependent isocitrate dehydrogenase	NA	NA	NA	NA
WP_071971708.1\|1679662_1680256_-	HD domain-containing protein	NA	NA	NA	NA
WP_071971709.1\|1680252_1680492_-	hypothetical protein	NA	NA	NA	NA
WP_071971710.1\|1680503_1681157_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_071971711.1\|1681905_1683003_+	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
WP_071971712.1\|1683018_1684554_+	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_071971713.1\|1684640_1685588_+	FkbM family methyltransferase	NA	NA	NA	NA
WP_071971714.1\|1685638_1686394_+	Fe-S cluster assembly ATPase SufC	G3M9Y6	Bacillus_virus	1.3e-10	29.1
WP_071971715.1\|1686393_1687674_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_071971716.1\|1687673_1688165_+	YIP1 family protein	NA	NA	NA	NA
1687973:1687988	attL	NA	NA	NA	NA
WP_071971717.1\|1688161_1688740_+	YIP1 family protein	NA	NA	NA	NA
WP_071971718.1\|1688739_1689960_+	cysteine desulfurase	Q2XUY6	environmental_halophage	8.7e-97	41.2
WP_071971719.1\|1689993_1691520_-	hypothetical protein	NA	NA	NA	NA
WP_172839515.1\|1691792_1692854_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_172839516.1\|1693173_1693329_-	hypothetical protein	NA	NA	NA	NA
WP_071971723.1\|1693806_1695672_-	ParB/RepB/Spo0J family partition protein	G8DH78	Emiliania_huxleyi_virus	4.1e-82	35.0
1694125:1694140	attR	NA	NA	NA	NA
WP_156874892.1\|1695709_1695997_-	hypothetical protein	NA	NA	NA	NA
WP_071971724.1\|1695993_1696215_-	hypothetical protein	NA	NA	NA	NA
WP_071971725.1\|1696205_1696517_-	hypothetical protein	NA	NA	NA	NA
WP_071971726.1\|1696516_1696732_-	hypothetical protein	NA	NA	NA	NA
WP_071971727.1\|1696728_1696929_-	hypothetical protein	NA	NA	NA	NA
WP_071971728.1\|1696925_1697351_-	hypothetical protein	NA	NA	NA	NA
WP_071971729.1\|1697578_1697884_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_071971730.1\|1698295_1698742_+	hypothetical protein	NA	NA	NA	NA
WP_071971731.1\|1699202_1699883_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_071971732.1\|1699903_1700521_+	hypothetical protein	NA	NA	NA	NA
WP_071971733.1\|1700517_1701177_+	hypothetical protein	G8DGC1	Emiliania_huxleyi_virus	3.8e-46	44.4
WP_071971734.1\|1701276_1701636_+	hypothetical protein	I3ULZ4	Rhodobacter_phage	1.6e-14	43.5
WP_071971735.1\|1701710_1702175_+	hypothetical protein	NA	NA	NA	NA
WP_071971736.1\|1702174_1703881_+\|terminase	terminase large subunit	I3ULZ6	Rhodobacter_phage	1.8e-137	48.3
WP_071971737.1\|1703880_1705137_+\|portal	phage portal protein	Q6JIM9	Burkholderia_virus	2.5e-62	37.6
WP_071971738.1\|1705114_1705966_+\|protease	Clp protease ClpP	A0A141GEW1	Brucella_phage	2.6e-63	46.6
WP_071971739.1\|1705976_1707269_+\|capsid	phage major capsid protein	A0A141GEW2	Brucella_phage	4.4e-83	39.6
WP_071971740.1\|1707353_1707740_+	hypothetical protein	NA	NA	NA	NA
WP_071973720.1\|1707800_1708382_+\|head,tail	phage head-tail connector protein	NA	NA	NA	NA
WP_071971741.1\|1708378_1708714_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_071971742.1\|1708713_1709127_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_071971743.1\|1709126_1709546_+	hypothetical protein	B4UTQ0	Rhizobium_phage	7.7e-21	41.1
WP_071971744.1\|1709595_1709784_+	hypothetical protein	NA	NA	NA	NA
WP_071971745.1\|1709787_1710231_+	hypothetical protein	B4UTQ3	Rhizobium_phage	5.7e-06	28.8

DBSCAN-SWA_3

1952390 : 1987988

Pelagibaca_phage(33.33%)

head,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_083545489.1\|1952390_1953056_-	helix-turn-helix transcriptional regulator	A0A1B0T6H5	Thiobacimonas_phage	1.5e-39	37.6
WP_071971953.1\|1953143_1953395_+	hypothetical protein	A0A1B0T6N5	Pelagibaca_phage	1.1e-09	50.0
WP_071971954.1\|1953391_1953646_+	hypothetical protein	NA	NA	NA	NA
WP_071971955.1\|1953642_1953954_+	hypothetical protein	NA	NA	NA	NA
WP_071971956.1\|1953953_1954193_+	hypothetical protein	NA	NA	NA	NA
WP_071971957.1\|1954230_1955106_+	ParB N-terminal domain-containing protein	NA	NA	NA	NA
WP_071971958.1\|1955105_1957229_+\|transposase	Mu transposase C-terminal domain-containing protein	A0A1B1P6Z4	Rhodovulum_phage	3.6e-191	50.3
WP_071971959.1\|1957296_1958040_+	ATP-binding protein	A0A1B0T6H3	Thiobacimonas_phage	1.1e-46	44.4
WP_156874903.1\|1958036_1958591_+	hypothetical protein	A0A1B0T6J7	Thiobacimonas_phage	1.5e-16	36.4
WP_071971961.1\|1958587_1958962_+	hypothetical protein	A0A1B0T6M5	Pelagibaca_phage	1.8e-21	44.3
WP_071971962.1\|1958958_1959294_+	hypothetical protein	NA	NA	NA	NA
WP_071971963.1\|1959286_1959502_+	hypothetical protein	M4SPT8	Rhodobacter_phage	2.5e-07	47.6
WP_071971964.1\|1959505_1960156_+	DUF3164 family protein	A0A1B0T6L8	Pelagibaca_phage	8.2e-78	64.7
WP_071971965.1\|1960159_1960399_+	hypothetical protein	A0A2H4JCC5	uncultured_Caudovirales_phage	2.3e-09	47.4
WP_071971966.1\|1960395_1961031_+	HNH endonuclease	NA	NA	NA	NA
WP_071971967.1\|1961027_1961207_+	hypothetical protein	NA	NA	NA	NA
WP_071971968.1\|1961206_1961620_+	hypothetical protein	NA	NA	NA	NA
WP_071971969.1\|1961616_1962060_+	regulatory protein GemA	A0A1B0T6H1	Thiobacimonas_phage	1.9e-46	61.9
WP_071971970.1\|1962059_1962311_+	hypothetical protein	NA	NA	NA	NA
WP_071971971.1\|1962307_1962733_+	hypothetical protein	A0A1B1P702	Rhodovulum_phage	9.9e-32	55.4
WP_071971972.1\|1962857_1963721_+	N-acetylmuramoyl-L-alanine amidase	A0A1B0T6G1	Thiobacimonas_phage	1.2e-97	61.9
WP_083545492.1\|1963748_1963958_+	hypothetical protein	NA	NA	NA	NA
WP_071971973.1\|1963961_1964378_+	hypothetical protein	NA	NA	NA	NA
WP_071971974.1\|1964353_1964731_+	DUF2730 family protein	NA	NA	NA	NA
WP_071971975.1\|1964727_1965045_+	hypothetical protein	NA	NA	NA	NA
WP_071971976.1\|1965049_1965610_+	DUF3486 family protein	A0A219VH75	Ochrobactrum_phage	5.3e-33	43.1
WP_071971978.1\|1967255_1967549_+	hypothetical protein	NA	NA	NA	NA
WP_156874904.1\|1967548_1967689_+	hypothetical protein	A0A1B0T6K1	Pelagibaca_phage	6.1e-15	71.7
WP_071971979.1\|1967685_1968027_+	hypothetical protein	M4T564	Rhodobacter_phage	6.5e-26	55.4
WP_071971980.1\|1968026_1968230_+	hypothetical protein	NA	NA	NA	NA
WP_071971981.1\|1968239_1969790_+	DUF935 domain-containing protein	A0A1B0T6K0	Pelagibaca_phage	5.8e-146	53.6
WP_071971982.1\|1969791_1971168_+	hypothetical protein	A0A1B1P712	Rhodovulum_phage	4.0e-82	43.5
WP_071971983.1\|1971486_1972554_+	hypothetical protein	A0A1B0T6J6	Pelagibaca_phage	1.0e-56	42.6
WP_071971984.1\|1972557_1972947_+	hypothetical protein	A0A1B1P739	Rhodovulum_phage	1.4e-29	59.2
WP_071971985.1\|1972962_1973856_+\|head	Mu-like prophage major head subunit gpT family protein	A0A1B0T6J4	Pelagibaca_phage	2.9e-118	72.1
WP_071971986.1\|1973928_1974210_+	hypothetical protein	A0A1B0T6K3	Pelagibaca_phage	1.3e-08	62.5
WP_071971987.1\|1974351_1974783_+	DUF1320 domain-containing protein	A0A1B1P724	Rhodovulum_phage	1.2e-32	52.4
WP_083545494.1\|1974782_1975280_+	phage virion morphogenesis protein	A0A1B0T6K4	Pelagibaca_phage	1.4e-40	53.6
WP_071971988.1\|1975276_1975735_+	hypothetical protein	NA	NA	NA	NA
WP_071971989.1\|1975746_1976679_+	hypothetical protein	A0A1B1P723	Rhodovulum_phage	3.9e-57	42.0
WP_071971990.1\|1976690_1977056_+	hypothetical protein	NA	NA	NA	NA
WP_071971991.1\|1977103_1977418_+	hypothetical protein	NA	NA	NA	NA
WP_071971992.1\|1977414_1980021_+	hypothetical protein	A0A1B0T6I6	Pelagibaca_phage	1.7e-09	26.4
WP_071971993.1\|1980017_1980437_+	hypothetical protein	A0A1B0T6E0	Thiobacimonas_phage	5.5e-27	57.9
WP_071971994.1\|1980433_1980958_+	hypothetical protein	A0A1B0T6D7	Thiobacimonas_phage	8.4e-57	61.5
WP_071971995.1\|1981021_1981441_-	hypothetical protein	NA	NA	NA	NA
WP_071971996.1\|1981518_1981935_+	C40 family peptidase	A0A1B0T6D9	Thiobacimonas_phage	1.9e-27	47.6
WP_083545496.1\|1981931_1985243_+	hypothetical protein	A0A1B0T6D1	Thiobacimonas_phage	1.3e-288	47.8
WP_071971997.1\|1985252_1987988_+	exo-alpha-sialidase	A0A166YA50	Gordonia_phage	2.8e-10	43.9

DBSCAN-SWA_4

2139608 : 2168421

uncultured_Mediterranean_phage(22.22%)

tail,capsid,head,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071972131.1\|2139608_2140673_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_071972132.1\|2140682_2144051_-	DUF3971 domain-containing protein	NA	NA	NA	NA
WP_071972133.1\|2144146_2144608_+	peroxiredoxin	NA	NA	NA	NA
WP_071972134.1\|2144604_2145414_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_071972135.1\|2145608_2146937_+	peptidoglycan DD-metalloendopeptidase family protein	A0A1P8BKT8	Lactococcus_phage	7.9e-19	47.3
WP_071972136.1\|2146926_2147436_+	polymer-forming cytoskeletal protein	NA	NA	NA	NA
WP_156874907.1\|2147808_2148693_+	hypothetical protein	NA	NA	NA	NA
WP_071972137.1\|2148905_2149457_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	4.9e-39	56.2
WP_071972138.1\|2149449_2149956_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	8.4e-38	52.5
WP_071972139.1\|2150085_2151273_+	phosphoglycerate kinase	NA	NA	NA	NA
WP_071972140.1\|2151332_2152115_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_071972141.1\|2152202_2152502_+	septum formation initiator family protein	NA	NA	NA	NA
WP_071973764.1\|2152654_2153674_+	pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha	NA	NA	NA	NA
WP_071972142.1\|2153851_2155252_+	pyruvate dehydrogenase complex E1 component subunit beta	NA	NA	NA	NA
WP_071972143.1\|2155261_2155519_+	hypothetical protein	NA	NA	NA	NA
WP_071972144.1\|2155518_2156901_+	pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase	NA	NA	NA	NA
WP_071972145.1\|2157002_2157815_-	serine O-acetyltransferase	NA	NA	NA	NA
WP_071972147.1\|2158210_2162140_-\|tail	glycoside hydrolase/phage tail family protein	A0A0B5A7K5	Paracoccus_phage	6.0e-224	37.0
WP_071972148.1\|2162139_2162574_-	C40 family peptidase	A0A1V0DYB6	Dinoroseobacter_phage	3.5e-32	52.6
WP_071972149.1\|2162570_2163458_-	DUF2163 domain-containing protein	A0A0K0PVK1	Roseobacter_phage	2.9e-57	39.0
WP_071972150.1\|2163457_2164090_-	DUF2460 domain-containing protein	A0A0B5A2K3	Paracoccus_phage	2.9e-56	49.8
WP_071972151.1\|2164105_2164762_-\|tail	phage tail tape measure protein	C0LP53	Escherichia_virus	1.4e-08	36.1
WP_071973765.1\|2164754_2164931_-\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_071972152.1\|2164963_2165278_-	gene transfer agent family protein	NA	NA	NA	NA
WP_071972153.1\|2165280_2165715_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_071972154.1\|2165750_2166161_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_071972155.1\|2166157_2166496_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_071972156.1\|2166492_2167086_-\|head,tail	phage head-tail connector protein	NA	NA	NA	NA
WP_071972157.1\|2167257_2168421_-\|capsid	phage major capsid protein	A0A2D1GNH4	Pseudomonas_phage	2.2e-73	40.3

DBSCAN-SWA_5

2534283 : 2588366

Tupanvirus(25.0%)

capsid,tRNA,portal,head,protease,tail,integrase

attL 2581507:2581553|attR 2591692:2591738

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071972456.1\|2534283_2535996_+\|tRNA	methionine--tRNA ligase	A0A2K9KZR3	Tupanvirus	1.4e-84	34.3
WP_071972457.1\|2536042_2538631_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.7e-09	62.3
WP_071972458.1\|2538781_2539696_-	hydrogen peroxide-inducible genes activator	NA	NA	NA	NA
WP_071972459.1\|2539791_2542020_+	catalase/peroxidase HPI	NA	NA	NA	NA
WP_071972460.1\|2542116_2543121_+	phosphotransferase	NA	NA	NA	NA
WP_071972461.1\|2543133_2544534_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_071972462.1\|2544530_2545742_-	amidohydrolase family protein	NA	NA	NA	NA
WP_071972463.1\|2545738_2546545_-	creatininase family protein	NA	NA	NA	NA
WP_071972464.1\|2546714_2547107_+	RidA family protein	NA	NA	NA	NA
WP_071972465.1\|2547137_2547734_-	Isoquinoline 1-oxidoreductase subunit	NA	NA	NA	NA
WP_071972466.1\|2547737_2549897_-	xanthine dehydrogenase family protein molybdopterin-binding subunit	NA	NA	NA	NA
WP_071972467.1\|2549901_2550360_-	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_071973805.1\|2550660_2551215_-	hypothetical protein	NA	NA	NA	NA
WP_071972468.1\|2551245_2551722_-	Lrp/AsnC ligand binding domain-containing protein	NA	NA	NA	NA
WP_071973806.1\|2551830_2555253_+	bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase PutA	NA	NA	NA	NA
WP_071972469.1\|2555257_2555905_-	hypothetical protein	NA	NA	NA	NA
WP_071972470.1\|2555974_2556718_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_156874922.1\|2556714_2557113_+	GFA family protein	NA	NA	NA	NA
WP_071972471.1\|2557109_2557895_-	inositol monophosphatase	NA	NA	NA	NA
WP_071972472.1\|2558048_2559089_+	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_071972473.1\|2559144_2560050_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_071972474.1\|2560147_2561014_+	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
WP_071972475.1\|2561076_2561559_+	PaaI family thioesterase	NA	NA	NA	NA
WP_083545517.1\|2561576_2562617_-	DUF2235 domain-containing protein	NA	NA	NA	NA
WP_071972476.1\|2562594_2564892_-	xanthine dehydrogenase family protein molybdopterin-binding subunit	NA	NA	NA	NA
WP_071972477.1\|2565352_2568286_+\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	1.7e-130	34.9
WP_071972478.1\|2568374_2569163_-	crotonase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_071972479.1\|2569271_2570375_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_071972480.1\|2570426_2570609_+	hypothetical protein	NA	NA	NA	NA
WP_071972481.1\|2570636_2571845_-	alanine--glyoxylate aminotransferase family protein	NA	NA	NA	NA
WP_071972482.1\|2571986_2573843_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.3e-40	27.3
WP_071972483.1\|2574595_2575360_+	folate-binding protein YgfZ	NA	NA	NA	NA
WP_071972484.1\|2575432_2575996_-	elongation factor P	NA	NA	NA	NA
WP_071972485.1\|2576215_2576536_+	elongation factor P	NA	NA	NA	NA
WP_071972486.1\|2576678_2578136_+	cobyric acid synthase	NA	NA	NA	NA
WP_071972487.1\|2578144_2578738_-	hypothetical protein	NA	NA	NA	NA
WP_071972488.1\|2578734_2579127_-	hypothetical protein	NA	NA	NA	NA
WP_071972489.1\|2579200_2580628_-	TolC family outer membrane protein	NA	NA	NA	NA
WP_071972490.1\|2580683_2581337_-	protein-L-isoaspartate O-methyltransferase	NA	NA	NA	NA
2581507:2581553	attL	NA	NA	NA	NA
WP_071973809.1\|2581627_2582446_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_071972491.1\|2582666_2582873_-	hypothetical protein	NA	NA	NA	NA
WP_071972492.1\|2582875_2583526_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_071972493.1\|2583625_2584057_-	hypothetical protein	NA	NA	NA	NA
WP_156874923.1\|2584383_2584632_+	hypothetical protein	NA	NA	NA	NA
WP_071973810.1\|2584767_2585832_-\|portal	phage portal protein	NA	NA	NA	NA
WP_071972495.1\|2585834_2586413_-\|head,protease	HK97 family phage prohead protease	NA	NA	NA	NA
WP_071972496.1\|2586412_2587687_-\|capsid	phage major capsid protein	NA	NA	NA	NA
WP_071972497.1\|2587671_2588028_-	HNH endonuclease	NA	NA	NA	NA
WP_071972498.1\|2588024_2588366_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
2591692:2591738	attR	NA	NA	NA	NA

DBSCAN-SWA_6

3622275 : 3631625

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071973376.1\|3622275_3623394_+	GDP-mannose 4,6-dehydratase	M4QRT5	Synechococcus_phage	2.4e-133	65.3
WP_071973378.1\|3623397_3624327_+	GDP-L-fucose synthase	M4R1H4	Synechococcus_phage	2.4e-54	38.6
WP_071973379.1\|3624323_3625490_+	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A0E3I7L6	Synechococcus_phage	7.4e-45	33.0
WP_071973380.1\|3625666_3627106_+	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	3.1e-53	30.2
WP_071973381.1\|3627132_3628005_-	glucose-1-phosphate thymidylyltransferase RfbA	A0A291LA53	Escherichia_phage	6.6e-91	57.6
WP_071973382.1\|3628001_3628853_-	dTDP-4-dehydrorhamnose reductase	A0A140G5S3	Enterobacteria_phage	3.6e-33	39.4
WP_071973383.1\|3628876_3629917_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.9e-92	52.0
WP_172839557.1\|3629913_3630483_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	3.8e-39	47.0
WP_071973384.1\|3630593_3631625_-	DUF2793 domain-containing protein	F4YXU6	Roseobacter_phage	8.5e-29	35.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP018079

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP018076

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection