CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP016912	Burkholderia pseudomallei strain Burk178-Type2 chromosome 2, complete sequence	4 crisprs	cas3,DinG,csa3	1	1	7	0
NZ_CP016911	Burkholderia pseudomallei strain Burk178-Type2 chromosome 1, complete sequence	1 crisprs	cas3,DEDDh,csa3,DinG,RT	0	0	9	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP016912_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016912_1

779353-779495

Orphan

Consensus_repeat	Method
GCTAACCGCTAACCGCTAACCGCTAACCGCT	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP016912_1

>merge|NZ_CP016912|1|779353-779495|CRISPRCasFinder
GTTGACCGTTGACCGTTGACCGTTGACCGTTGACCGTTGACCGTTGATTGCCGATTGCTAACCGCTAACCGCTAACCGCTAACCGCTAACCGCTAACCGCTAACCGCTAACCGCTAACCGCTAACCGCTAACCGCTAACCGCT

>NZ_CP016912|1|1|779353-779495|CRISPRCasFinder
GTTGACCGTTGACCGTTGACCGTTGACCGTT	GACCGTTGACCGTTGATTGCCGATT
GCTAACCGCTAACCGCTAACCGCTAACCGCT	AACCGCTAACCGCTAACCGCTAACC
GCTAACCGCTAACCGCTAACCGCTAACCGCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016912.1\|WP_004530801.1\|782592_783867_+\|serine-hydroxymethyltransferase	unknown	unknown	gnl\|CDD\|237280
NZ_CP016912.1\|WP_075019056.1\|776497_778063_-\|glycoside-hydrolase-68-family-protein	unknown	unknown	gnl\|CDD\|367086
NZ_CP016912.1\|WP_004186901.1\|787721_789647_+\|(Fe-S)-binding-protein	unknown	unknown	gnl\|CDD\|371832
NZ_CP016912.1\|WP_024430154.1\|775099_776365_-\|glycoside-hydrolase-family-32-protein	unknown	unknown	gnl\|CDD\|350134
NZ_CP016912.1\|WP_004528656.1\|771010_772594_+\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|273830
NZ_CP016912.1\|WP_004530055.1\|790820_791606_+\|drug:proton-antiporter	unknown	unknown	gnl\|CDD\|224997
NZ_CP016912.1\|WP_004523135.1\|779757_780957_+\|formaldehyde-dehydrogenase,-glutathione-independent	unknown	unknown	gnl\|CDD\|274314
NZ_CP016912.1\|WP_020850331.1\|766486_767806_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|224732
NZ_CP016912.1\|WP_024430146.1\|770822_771014_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016912.1\|WP_004524286.1\|767802_769389_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP016912.1\|WP_004538946.1\|778251_779268_+\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380665
NZ_CP016912.1\|WP_004186989.1\|783939_784911_+\|membrane-dipeptidase	unknown	unknown	gnl\|CDD\|366534
NZ_CP016912.1\|WP_144399211.1\|791630_792899_+\|Rieske-2Fe-2S-domain-containing-protein	unknown	unknown	gnl\|CDD\|176893
NZ_CP016912.1\|WP_004186960.1\|785655_787719_+\|NADH:flavin-oxidoreductase	unknown	unknown	gnl\|CDD\|240085
NZ_CP016912.1\|WP_004198247.1\|781134_782160_-\|GlxA-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|227311
NZ_CP016912.1\|WP_004199051.1\|766350_766479_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016912.1\|WP_004202150.1\|789651_790824_+\|electron-transfer-flavoprotein-subunit-alpha/FixB-family-protein	unknown	unknown	gnl\|CDD\|224936
NZ_CP016912.1\|WP_011205425.1\|769701_770697_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133017
NZ_CP016912.1\|WP_004186987.1\|785061_785595_+\|4-vinyl-reductase	unknown	unknown	gnl\|CDD\|198057
NZ_CP016912.1\|WP_004186853.1\|773332_774586_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|185090

Protein	Function_ID	Function_description	E-value
NZ_CP016912.1\|WP_004530055.1\|790820_791606_+\|drug:proton-antiporter	gnl\|CDD\|224997	COG2086, FixA, Electron transfer flavoprotein, beta subunit [Energy production and conversion].	7.56433e-35
NZ_CP016912.1\|WP_075019056.1\|776497_778063_-\|glycoside-hydrolase-68-family-protein	gnl\|CDD\|367086	pfam02435, Glyco_hydro_68, Levansucrase/Invertase. This Pfam family consists of the glycosyl hydrolase 68 family, including several bacterial levansucrase enzymes, and invertase from zymomonas.	9.93538e-162
NZ_CP016912.1\|WP_004186901.1\|787721_789647_+\|(Fe-S)-binding-protein	gnl\|CDD\|371832	pfam11982, DUF3483, Domain of unknown function (DUF3483). This presumed domain is functionally uncharacterized. This domain is found in bacteria. This domain is about 230 amino acids in length. This domain is found associated with pfam02754.	5.67357e-94
NZ_CP016912.1\|WP_024430154.1\|775099_776365_-\|glycoside-hydrolase-family-32-protein	gnl\|CDD\|350134	cd18622, GH32_Inu-like, glycoside hydrolase family 32 protein such as Aspergillus ficuum endo-inulinase (Inu2). This subfamily of glycosyl hydrolase family GH32 includes endo-inulinase (inu2, EC 3.2.1.7), exo-inulinase (Inu1, EC 3.2.1.80), invertase (EC 3.2.1.26), and levan fructotransferase (LftA, EC 4.2.2.16), among others. These enzymes cleave sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.	2.97153e-140
NZ_CP016912.1\|WP_004528656.1\|771010_772594_+\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	1.20835e-76
NZ_CP016912.1\|WP_004198247.1\|781134_782160_-\|GlxA-family-transcriptional-regulator	gnl\|CDD\|227311	COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].	2.02496e-138
NZ_CP016912.1\|WP_020850331.1\|766486_767806_+\|glycosyltransferase	gnl\|CDD\|224732	COG1819, COG1819, Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms].	1.76535e-46
NZ_CP016912.1\|WP_004530801.1\|782592_783867_+\|serine-hydroxymethyltransferase	gnl\|CDD\|237280	PRK13034, PRK13034, serine hydroxymethyltransferase; Reviewed.	0
NZ_CP016912.1\|WP_004524286.1\|767802_769389_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.35251e-137
NZ_CP016912.1\|WP_004538946.1\|778251_779268_+\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|380665	cd20010, PBP1_AglR-like, Ligand-binding domain of DNA transcription repressor specific for alpha-glucosides (AglR) and similar proteins. Ligand-binding domain of DNA transcription repressor specific for alpha-glucosides (AglR) which is a member of the LacI-GalR family of bacterial transcription regulators. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.	4.42631e-95
NZ_CP016912.1\|WP_004186989.1\|783939_784911_+\|membrane-dipeptidase	gnl\|CDD\|366534	pfam01244, Peptidase_M19, Membrane dipeptidase (Peptidase family M19).	3.99422e-125
NZ_CP016912.1\|WP_004186960.1\|785655_787719_+\|NADH:flavin-oxidoreductase	gnl\|CDD\|240085	cd04734, OYE_like_3_FMN, Old yellow enzyme (OYE)-related FMN binding domain, group 3. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction. Other members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase. One member of this subgroup, the Sinorhizobium meliloti stachydrine utilization protein stcD, has been idenified as a putative N-methylproline demethylase.	0
NZ_CP016912.1\|WP_144399211.1\|791630_792899_+\|Rieske-2Fe-2S-domain-containing-protein	gnl\|CDD\|176893	cd08884, RHO_alpha_C_GbcA-like, C-terminal catalytic domain of GbcA (glycine betaine catabolism A) from Pseudomonas aeruginosa PAO1 and related aromatic ring hydroxylating dioxygenases. C-terminal catalytic domain of GbcA (glycine betaine catabolism A) from Pseudomonas aeruginosa PAO1 and related Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs, also known as aromatic ring hydroxylating dioxygenases). RHOs utilize non-heme Fe(II) to catalyze the addition of hydroxyl groups to the aromatic ring, an initial step in the oxidative degradation of aromatic compounds. RHOs are composed of either two or three protein components, and are comprised of an electron transport chain (ETC) and an oxygenase. The ETC transfers reducing equivalents from the electron donor to the oxygenase component, which in turn transfers electrons to the oxygen molecules. The oxygenase components are oligomers, either (alpha)n or (alpha)n(beta)n. The alpha subunits are the catalytic components and have an N-terminal domain, which binds a Rieske-like 2Fe-2S cluster, and a C-terminal domain which binds the non-heme Fe(II). The Fe(II) is co-ordinated by conserved His and Asp residues. GbcA is involved in glycine betaine (GB) catabolism in Pseudomonas aeruginosa; it may remove a methyl group from GB via a dioxygenase mechanism, producing dimethylglycine and formaldehyde. This subfamily belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket.	5.29684e-98
NZ_CP016912.1\|WP_004523135.1\|779757_780957_+\|formaldehyde-dehydrogenase,-glutathione-independent	gnl\|CDD\|274314	TIGR02819, formaldehyde_dehydrogenase_glutathione-independent, formaldehyde dehydrogenase, glutathione-independent. Members of this family represent a distinct clade within the larger family of zinc-dependent dehydrogenases of medium chain alcohols, a family that also includes the so-called glutathione-dependent formaldehyde dehydrogenase. Members of this protein family have a tightly bound NAD that can act as a true cofactor, rather than a cosubstrate in dehydrogenase reactions, in dismutase reactions for some aldehydes. The name given to this family, however, is formaldehyde dehydrogenase, glutathione-independent. [Central intermediary metabolism, One-carbon metabolism].	0
NZ_CP016912.1\|WP_004202150.1\|789651_790824_+\|electron-transfer-flavoprotein-subunit-alpha/FixB-family-protein	gnl\|CDD\|224936	COG2025, FixB, Electron transfer flavoprotein, alpha subunit [Energy production and conversion].	2.05615e-63
NZ_CP016912.1\|WP_011205425.1\|769701_770697_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133017	cd02526, GT2_RfbF_like, RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.	1.28579e-85
NZ_CP016912.1\|WP_004186987.1\|785061_785595_+\|4-vinyl-reductase	gnl\|CDD\|198057	smart00989, V4R, The V4R (vinyl 4 reductase) domain is a predicted small molecular binding domain, that may bind to hydrocarbons.	3.87376e-12
NZ_CP016912.1\|WP_004186853.1\|773332_774586_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|185090	PRK15136, PRK15136, multidrug efflux MFS transporter periplasmic adaptor subunit EmrA.	3.51483e-115

>NZ_CP016912.1|WP_004538946.1|778251_779268_+|LacI-family-DNA-binding-transcriptional-regulator
MKVNLKALSGALGLSRTTVSRALNGYDDVSEATRERVMQAAREFGYVADPTARRLATGRADAVGIVYPFGAGDLGDPRFAEVVAGVTERLGESGLDFFIVSARPNAELDTYRRLVDGRLVDGLIVARTLVDDPRLRFLQEREFPFVAYGRTASAKPYTWFDFDNEAGMHAAAQRLIAFGHRRIALVCAPRTLNFAAQRRAGFERALREAGIEPDAALIVECAFTRDGGYGAAQTLLALERAPSAIVVDNNIAGAGVFRAIVERGRRFVRDVSLIVYDGVSPDVSFPHHASAVLQPTGHASGRAIAELMLGAIAHPGDAAHRLVSPVIEPGDTDGPFSG
>NZ_CP016912.1|WP_075019056.1|776497_778063_-|glycoside-hydrolase-68-family-protein
MTYSKQAVSRRRKRLALSAAALAAAACMSAHAQSDGAGPAPTPHTQQAYDPESHFTMRWTRADMRQIVKQSHTAGADKNSLPPALTMPDIAQNFPLVDSNVWVWDTWPLADMRANQLSYKGWEVIFSLSADPHAGYTFDDRHVHARIGFFYRRAGIPASQRPANGGWTWGGHLFPDGASAKVFGTAPMTNNAEWSGSARLTHGENVSLYYTALSFNRSAPGGADITPPIAIITRADGHIHADDKHVWFSGFDDHKALLQPEGKMYQTGQQNTYYSFRDPFVFTDPAHPGNTYMVFEGNTGGPRGARTCTEADLGYAPNDPYREDLNAVMNLGAVYQKANVGLAIATNPQLTEWKFLPPLLSANCVDDQTERPQIYLKDGKYYLFTISHRTTMAAGIDGPDGVYGFVGNGIRSDFLPLNGGSGLVLGNPTDFSAPAGAPYAQDPNQNPRAFQSYSHYVMPGGRVESFIDAIGARRGGTLAPTVKIDIHGDSTTVDRAYGAGGLGGYGDIPANLPAVGAGHHD
>NZ_CP016912.1|WP_024430154.1|775099_776365_-|glycoside-hydrolase-family-32-protein
MHSMSNPRLRFSSVVYGLIALAACASFAAHASGARCAASPAKSADGTPQWRPALHYTPRRNWMNDPNGLVYENGVYHLFYQYNPHGNFWGDMSWGHATSRDLVHWDEQPVAMPANAREDIFSGSIVADARNTSGLGTPNAPPLVALYTSVYKAGSGHEPGTQAQSLAYSIDHGKTWRPYAHNPVLTLAPESRHFRDPNVTWYAPGGYWMMTAVVADAPVVKLYRSSDLIRWDFLSDFTLPDVPHRGALWEMPELLPMPLDGDAARMKWVMIVNVNPWSIAGGSGAMYFIGEFDGRTFTPDRAAPANADPAQYSWLDHGADYYAAGTFANAPGEGPVAIAWMSNWDYAERIPTTPWKGAMALPRELALKTIDGRTVITDLVFPSPADNRLAVFAEGGDATFGDVVVTNLDETAGERRGCPTS
>NZ_CP016912.1|WP_004186853.1|773332_774586_+|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit
MNDTATDTARAKAPTDPAVSDGAPASGHGLPASPETAATLAARRATRRRRFAWFFGVLAIVALGAALYWFIVGRFSEETDDAYVAGNVVQIAAQIQGTVTDVLVADTQQVKAGQALVRLDDAEAAAAFAQAQAQLAQAVRQVANTRLSMQTYEQTVKAREADLKLAQQAYRARAGASVEVVAPEELARAKSSLANAQAALAGAQAQREAARALGSERPVGQNPAVQQAAAQFKLAYRNLKRTTIVSPVDGTVGQRSVQIGQQVGPGVPLMSVVQLRQVWVEANFKEGQLRHMRVGQPVRLESDLYGARVTYHGRVEGFSAGTGSAFSMLPSQNAAGNWIKVVQRLPVVISLEPSELAAHPLRVGLSMRATVQTKARGGHLLDGDAPLPAQRTRVHEMHAGEAEAAAEAVIRANDGGQ
>NZ_CP016912.1|WP_004528656.1|771010_772594_+|efflux-transporter-outer-membrane-subunit
MTQTATHAATRTTTLPVRRPARRLAALALAWALAGCVPSGLKPTLAPRTPGDDALAHTTGGATHGAWPSPDWVRQLGDPQLDALVDEALRQNPTLQAAQARIGVAQSQLQQFESLTGLTATAGASLSKAHVPRSGGTLNTTLNGLPVSVPLVGESVVSSSSLFVGLNYQLDLWGKNAAATRGLLSMRDAARVEAEQARLTLSVAIVTLYGELDRAYALRELLQQKRRASEQVEAVLRERAARGIDNGYDADDAALKRGKLLEQIALTDEQIQLQKLQLGVLSGRGPERGLSLARPKLAPLADAPLPARLPAGLLGRRPDIVAARLRVEAAYAAIDGTRASFYPDVNLAALGGLFALTPASLFRHDALGGSIGPALSLPIFDRSRLKAKLGGDVANADMALALYNQTVDAALGEVARQLTSLATLDTLLKAQQQALRAAQRMVALAQDRHRRGMGMRKDIDVAQLTLLDERAHVVELQARRRTLRVGLIGALGGGFDARPASGAPPAQAGQPFAAASRPVAAHDAQPD
>NZ_CP016912.1|WP_024430146.1|770822_771014_+|hypothetical-protein
MMTVKRKTTQTTQTTPMAQRLAPVSAASRGGRAIPLAVTGEAVRHRRRRPQRNRARTKDASHA
>NZ_CP016912.1|WP_011205425.1|769701_770697_+|glycosyltransferase-family-2-protein
MTTLGALVILYYPTDEQLSGLEALARDSDALAVIDNTPHEHAAARERVRALAARAHGEARVVWRHHGNRGGVAGAYNAGLSALFAQGMEAVALFDQDSTVPAAYFARMRDACAQLGTQPGVHAGAFIAGPRIYDANEQRFLPELMTSGVAVRRVRVEGERAPQRCAFLISSGSVISRGAYARLGRFDEALFIDHVDTEYCLRALAHNVPLYVVPSLVLTHRIGARRRHKVGPFELTAMHHGWLRRYYGARNAMQLGLQYGLRFPVALVPNLLTIWQVVQVVLCEREKGAKLRGIALGVLDGVFGRLGSFEAARAGHRTAREEAMREARQQS
>NZ_CP016912.1|WP_004524286.1|767802_769389_+|DHA2-family-efflux-MFS-transporter-permease-subunit
MSAPARPAAAAANGAGAHEPAAARPLRGAKLALLTFALSLATFIEVLDSTVANVAVPAISGSLGVSNSQGTWVISSYSVAAAIAVPLTGWLARRVGEQRLFVASVILFTLTSLLCGLARDLEVLVACRALQGLFSGPMVPLSQTILMRAFPPAKRTLALALWGMTVLLAPIFGPVVGGWLIDNFSWPWIFLINLPIGLFSFAVCTLMLRPRASRGEASPIDVPGIVLLVIGVGSLQAMLDLGHDRGWFDSSLITALAIAAGVSLVSLLIWELGEAHPVVELSLFRERTFTFCVVIISLGMMSFSVVGVVFPLWLQAVMGYTAYQAGLATASMGLLALVFSILVGVYASRVDARVLVTFGFGVFAAVMGWSTHFTLSMTFAQVVTPRLIQGMGLPCFFIPLTAATLSRVADDKLAAASSLSNFLRTLSAAFGTALSVTWWDNRATYHYAVVSQAVTRASENTQRYVDALHAMGLHGARELSSLHQVVRQQAYMMATNDMFYMASVTCVLLAGLMWLTRPKRGAAATMGH
>NZ_CP016912.1|WP_020850331.1|766486_767806_+|glycosyltransferase
MAKVIVTAIGSAGDVHPLLGVSRALAARGHDVVFCTHAPFEAAVRASGFAFVPVGTAEAYAQAMADPALWDPRTSFRTLWRVIAPVLRPHFDTLRALSDADTVLVGTLWAFSARLMQERFGARYVSVQVSPSTLLSAHAPPTHKRLTIPKGLPLAVKAGLMTLIERQVLDRVCGPELNAARRALGLAPARRILGRWLHSTDGVLCLFPSWFAPAQPDWPANHLQSGFALFNDVGPVPADAELDAFVASGEAPVVFTAGSTLVDGRAYERAVTQVLRATGVRGILLAPDAPAASDGTTGPMERAAETTARANGAALLKRRYVPLAALLPRCRALVHHGGIGTASLAYAAGVPQVVTPFAHDQFDNAQRVAASGCGVRLDAPVRGEPLARALARVLGDAAMAARCAEVRARMAAQPDGCDEAARFIERFAPGVAARQAQPA
>NZ_CP016912.1|WP_004199051.1|766350_766479_+|hypothetical-protein
MTPGARDEAVCIPAGRIPAGGGRSGSNRDCGERRRRLPRGRE
>NZ_CP016912.1|WP_004523135.1|779757_780957_+|formaldehyde-dehydrogenase,-glutathione-independent
MSSNRGVVYQGPGKVEVRKIDYPKMVDPSGRAIGHGVILKVVSTNICGSDQHMVRGRTTAPVGLVLGHEITGEVIEVGRDVETLKIGDLVSVPFNVACGRCAMCKEQHTGVCLNVNPARAGGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDRAMAKIRDLTCLSDILPTGYHGAVTAGVKPGSTVYVAGAGPVGMAAAASARLLGAACTIVGDMNAERLAHAKAMGFEVVDLSKDATLGEQIEQILGKPEIDCAVDCVGFEAHGHGSSGHAQEAPATVLNSLMEITRPAGAIGIPGLYVTDDPGAVDVAAKHGSLSIRFGLGWAKSHSFHTGQTPVLKYSRNLMQAILFDRLPIAEIVNVAVISLDDAPEGYKKFDGGAPRKFVIDPHGMLKAA
>NZ_CP016912.1|WP_004198247.1|781134_782160_-|GlxA-family-transcriptional-regulator
MSPDRTASLSHFAFMPLPNFTMIAFTNAIEVLRMANYLSGQPLYRWSIISPQGGMVTASNGLAVDTGPAECAGQPDIVFVCGGVDVQRATQPEHLAALRRFARAGVALGSLCTGTYALAKAGLLAGYACAIHWENLSALKEEFPDTRFLKELFVIDRDRVTCTGGVAPLDMMLNLIASRIGTARVTQIAEQFIVEHVRDTSAQQRMPLVARLGSANKSLFEVIALMENNIEEPLSREELARLANMSQRQLQRLFREHLGMTPTHYYLTLRLRRARELLLQTDMSIMHITMACGFQSACHFSKSYRDAFGTAPTRERRKQVAPLAQPSMPGGAPAPSMMLHA
>NZ_CP016912.1|WP_004530801.1|782592_783867_+|serine-hydroxymethyltransferase
MSNANPFFSQSLAERDASVRGAILKELERQQSQVELIASENIVSRAVLDAQGSVLTNKYAEGYPGKRYYGGCEFADEVEALAIERVKRLFNAGHANVQPHSGAQANGAVMLALAKPGDTVLGMSLDAGGHLTHGAKPALSGKWFNALQYGVSRDTMLLDYDQVEALAQQHKPSLIIAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVIAAGRHANPVEHAHVVTSTTHKTLRGPRGGFVLTNDEEIAKKINSAVFPGLQGGPLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTGGTDNHLLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEFREVGRLILEVFEALRTNPEGDHATEQRVRREIFALCERFPIY
>NZ_CP016912.1|WP_004186989.1|783939_784911_+|membrane-dipeptidase
MSTLHQDSIIIDGLNISKFERSVFEDMQKGGVTAANCTVSVWENFTKTVDNIALMKKQIRENGELLTLVRTTDDILRAKREGRTGVILGFQNAHAFEDNLGYVEAFADMGVRVVQLCYNTQNLVGTGCYERDGGLSDFGREVITEMNRVGIMVDLSHVGGNTSSEAIAFSKKPVCYSHCLPSGLKEHPRNKSDAQLKEIADAGGFVGVTMFAPFLKRGIDATIDDYIEAIGYVVNLIGEDAVGIGTDFTQGYSVDFFDWLTHDKGRYRRLTNFGKVVNPEGIRTIGEFPNLTAAMERAGWKASRIRKIMGENWVRVFKEVWGA
>NZ_CP016912.1|WP_004186987.1|785061_785595_+|4-vinyl-reductase
MQPQLPIDVDPNTGVWTTDALPMLYVPRHFFTNNHTAVEEALGRDAYADILYRAGYKSAYHWCDKEAKQHGIAGMAVFEHYLKRLSQRGWGLFSIVEAEPAAARAKIELRHSSFVLAQPGKEGKLCYMFAGWFAGALDWVNDTTPEGRGAPRARSAEAQCAAEGHDHCVFEVSPIAR
>NZ_CP016912.1|WP_004186960.1|785655_787719_+|NADH:flavin-oxidoreductase
MRYPHLFKPLQLNQLTLRNRIVSTAHAEVYAEPGGLPGERYIRYYEEKAKGGVGLAVCGGSSPVSIDSPQGWWKSVNLSTDKIVDPLARLAEAMHRHGAKIMIQATHMGRRSAFHGEHWPHLMSPSGVREPVHRGNAKIIEVEEIRRIIGDFAAAAKRVKDAGMDGIEISAAHQHLIDQFWSPRTNVRTDEWGGSLENRLRFGVEVLTAVREAVGRDFCVGLRMCGDEFHEDGLDHEQLKEIAQAMSETGLIDYLGVIGSGADTHNTLANCMPPMALPPEPFVHLAAGIKSVVRIPVMHAQSIRDAGQAERLLANGMIDLVGMTRAQIADPHMVIKIRDGREDEIKQCVGANYCIDRQYNGLDVLCVQNAATSREATMPHVIEKSRGPKRKVVVVGAGPAGLEAARVARSRGHDVVLFEKNAEVGGQIMLAAKAPQREQMAGIVRWFDMETKRLGVDRRLGVEADEKAIMAEKPDIIVLATGGRSFTDQVSGWGVAEGHAVGSWDILSGRVEPGKNVLVYDGVSTHAGAGVADFIASRGSNVEIVTPDVKVADDCGGTTFPIFYRRLYAQGVIHTPNYWLDRVYEEDGKKIAVLRNEYTEEQEERAVDQVVIENGITPNDALYWKLKPESVNRGQIDVHKLFAAEPQPCLAETLGNGRFLLFRVGDCISMHNIHGAIYDALRLVKDF
>NZ_CP016912.1|WP_004186901.1|787721_789647_+|(Fe-S)-binding-protein
MNPAILITALLWLSVAGLAFAVAKRSAYWRLGRATTPGAFGLANLLAIPKRYFVDLHHVVARDPYIAKTHVATAGGALAALALVFVNYGLAIYSPWLDRLILLAALAMLVGVVFVWRRRHAKAVPARLSRGPWNTLPWLLGAFALGLVLFMLVPAAAMSGAFALLCAALIGAGAFAMTVGAAKGGPMKHAIAGLLHLAFHPRQERFAATRDAYTGDGGATPPTALKPSDVERDEYGVAKPAEFRWNQLLSFDACVQCGKCEAACPAFASGQPLNPKKLIQDLVVGMAGGTDAAYAGSPTPGIPVGAHGGDPQRPIVSSLIEADTLWSCTTCRACVQECPMLIEHVDAIVDMRRNQALVHGAVPGKGAQVLANLRETGTMGGYDTAARYDWSVDLGAPVAQPGRPVDVLIVAGEGAFDMRYQRTLRALVKVLNHAGVDYAVLGRAETDTGDVARRLGDEATFQQMARRLIDTLGALSFKQIVTADPHVMHSLRNEYRALGGRYAVKHHTTFVAELAAAGKIKPQAADALREKRMTYHDPCYLGRYNGETEAPRKLLKTIGIQIVEMERHGMRGRCCGGGGGAPLTDIPGRQRIPDIRIADARAVGADVVAVGCPNCTAMLEGVVGPRPDVLDVAELVAASLE
>NZ_CP016912.1|WP_004202150.1|789651_790824_+|electron-transfer-flavoprotein-subunit-alpha/FixB-family-protein
MTTLKRIDPRRPFVVTAAGLKRITLGETGGAPGDAASWRPHAHGAAAARPVRVVRDARRVFLVAAHSERGALDDHARQTLAAAALLADAQTEVALVVFGELNDDAGAFGADTLVVLRDFDRRAFAPERELDALRACAAALSPQHVFIPDNATGDGDLGRRYAAAANASVATQVVEIAADHVGVYVDAKRGFATRTLPDVVLLAPNAVDPTLPFVGAARTLAAPDARAAGDGGDARYRDFGLEEIDAAQVALEEADFIVSAGNGVTDIAAFETLAATFGAAIGASRVAVDNGHFTRDKQVGATGKTVDASIYIAFGISGAVQHLQGIKDCRHVIAVNLDGSAPIAKRANLTIVGDAQATIAALIEAVNAARAAQPRAGAVSNEREYMGAAA
>NZ_CP016912.1|WP_004530055.1|790820_791606_+|drug:proton-antiporter
MNANRKLASIAVLVSVGRHPVSGVPRYSRNDAAALEIGRALAAEHRARLDVIHAGDARNPALADYLALGAASVEVLACADGDDAAAALAERVRGHDLVLTGTRAEGAYDTGMLPYRVAAALGWPFVGAAVDVSVDAARATLRQFLPKGVRRRVDAALPAVVAVHPLANAQPRYAYARLRAGEVRVTRAATRAAADAGQWTTRAVERKPVRLAAADKRSGHARMLSATTTESRGGNVVIEGSSVEKAQVILAYLREHQLIDY
>NZ_CP016912.1|WP_144399211.1|791630_792899_+|Rieske-2Fe-2S-domain-containing-protein
MDARNPEQTMKVSADVRALVARRKAGYSLEAPFYLSDEIFALDMDAIFRRHWIQVGVEPDVPEPGDYVTVQLGGDSILIVRDDDMQVRAFHNVCRHRGARLCNEEKGSVGNIVCPYHSWTYNLTGQLIFAEHMGEKFDRCKHSLKPVHLENLAGLLFVCLADEPPVDFATMRAAMEPYLLPHDLPNTKIAAQIDIVEKGNWKLTMENNRECYHCVANHPELTISLYEYGFGYQPSPANAEGMAAFERTCVERAAQWEALNLPSVEVERLTDVTGFRTQRLPLDRSGESQTLDAKVASKKLLGEFRQADLGGLSFWTQPNSWHHFMSDHIVTFSVIPLSAGETLVRTKWLVHRDAKEGIDYDVKNLTAVWNATNDQDRALVEFSQRGAASSAYEPGPYSPYTEGLVEKFCEWYVGRLAAHIGA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP016912_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016912_2

1440481-1440645

Orphan

Consensus_repeat	Method
GCGAGCGCGGCGAGCGCGGCCGCG	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP016912_2

>merge|NZ_CP016912|2|1440481-1440645|PILER-CR
GCGAGCGCGGCGAGCGCGGCGGACAGGCCGCTCGCGACATAGCTCGACGCGACGTAGCGGCGCGCGTCGACGCCCGCGGCGAGCGCGGCCGCGCGATGGGCGCCGAGCGCGTGCAGCGCGAGCCCGTAACGGGTGCGATGGGCGAGCGCGGCGAGCACGGCCGCG

>NZ_CP016912|2|1|1440481-1440645|PILER-CR
GCGAGCGCGGCGAGCGCGGCGGAC	AGGCCGCTCGCGACATAGCTCGACGCGACGTAGCGGCGCGCGTCGACGCCCGCG
GCGAGCGCGGCCGCGCGATGGGCG	CCGAGCGCGTGCAGCGCGAGCCCGTAACGGGTGCGATGGGCGAGCGCG
GCGAGCACGGCCGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016912.1\|WP_004536762.1\|1432859_1433846_+\|YceI-family-protein	unknown	unknown	gnl\|CDD\|377274
NZ_CP016912.1\|WP_004551656.1\|1443102_1444152_-\|sugar-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380528
NZ_CP016912.1\|WP_024429158.1\|1441279_1443106_-\|sugar-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224053
NZ_CP016912.1\|WP_004202590.1\|1446271_1447531_-\|monooxygenase	unknown	unknown	gnl\|CDD\|173852
NZ_CP016912.1\|WP_004524130.1\|1450519_1450792_+\|DUF4148-domain-containing-protein	unknown	unknown	gnl\|CDD\|379321
NZ_CP016912.1\|WP_004548936.1\|1439224_1440205_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119321
NZ_CP016912.1\|WP_043276786.1\|1434459_1434690_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016912.1\|WP_011205512.1\|1444783_1445524_+\|isoprenylcysteine-carboxylmethyltransferase-family-protein	unknown	unknown	gnl\|CDD\|224931
NZ_CP016912.1\|WP_071898081.1\|1450326_1450527_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016912.1\|WP_075019228.1\|1436540_1439006_+\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|273805
NZ_CP016912.1\|WP_004528277.1\|1433885_1434245_+\|lipoprotein	unknown	unknown	gnl\|CDD\|226765
NZ_CP016912.1\|WP_004524116.1\|1434711_1435221_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|171561
NZ_CP016912.1\|WP_154219343.1\|1444240_1444669_-\|sugar-ABC-transporter-substrate-binding-protein	unknown	unknown	unknown
NZ_CP016912.1\|WP_004198472.1\|1449631_1449880_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016912.1\|WP_004524126.1\|1447750_1449214_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929
NZ_CP016912.1\|WP_041188241.1\|1445857_1446109_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016912.1\|WP_004542736.1\|1431977_1432802_+\|anti-sigma-factor	unknown	unknown	gnl\|CDD\|227949
NZ_CP016912.1\|WP_004199294.1\|1431459_1431981_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|237123
NZ_CP016912.1\|WP_004524117.1\|1435217_1436222_+\|FecR-family-protein	unknown	unknown	gnl\|CDD\|236622
NZ_CP016912.1\|WP_004199295.1\|1431285_1431444_+\|lipoprotein	unknown	unknown	gnl\|CDD\|380215

Protein	Function_ID	Function_description	E-value
NZ_CP016912.1\|WP_004536762.1\|1432859_1433846_+\|YceI-family-protein	gnl\|CDD\|377274	pfam04264, YceI, YceI-like domain. E. coli YceI is a base-induced periplasmic protein. The recent structure of a member of this family shows that it binds to poly-isoprenoid. The structure consists of an extended, eight-stranded, antiparallel beta-barrel that resembles the lipocalin fold.	2.29933e-28
NZ_CP016912.1\|WP_004551656.1\|1443102_1444152_-\|sugar-ABC-transporter-substrate-binding-protein	gnl\|CDD\|380528	cd06305, PBP1_methylthioribose_binding-like, similar to methylthioribose-binding protein of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein (PBP1) superfamily. Proteins similar to methylthioribose-binding protein of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein (PBP1) superfamily, which consists of two alpha/beta globular domains connected by a three-stranded hinge. This Venus flytrap-like domain undergoes transition from an open to a closed conformational state upon ligand binding. The sugar-binding domain of the periplasmic proteins in this group is also homologous to the ligand-binding domain of eukaryotic receptors such as metabotropic glutamate receptor (mGluR), DNA-binding transcriptional repressors such as LacI and GalR.	4.23501e-122
NZ_CP016912.1\|WP_024429158.1\|1441279_1443106_-\|sugar-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	1.95135e-176
NZ_CP016912.1\|WP_004202590.1\|1446271_1447531_-\|monooxygenase	gnl\|CDD\|173852	cd01163, DszC, Dibenzothiophene (DBT) desulfurization enzyme C. DszC is a flavin reductase dependent enzyme, which catalyzes the first two steps of DBT desulfurization in mesophilic bacteria. DszC converts DBT to DBT-sulfoxide, which is then converted to DBT-sulfone. Bacteria with this enzyme are candidates for the removal of organic sulfur compounds from fossil fuels, which pollute the environment. An equivalent enzyme tdsC, is found in thermophilic bacteria. This alignment also contains a closely related uncharacterized subgroup.	4.02374e-137
NZ_CP016912.1\|WP_004524130.1\|1450519_1450792_+\|DUF4148-domain-containing-protein	gnl\|CDD\|379321	pfam13663, DUF4148, Domain of unknown function (DUF4148).	9.38719e-09
NZ_CP016912.1\|WP_004548936.1\|1439224_1440205_-\|ABC-transporter-permease	gnl\|CDD\|119321	cd06579, TM_PBP1_transp_AraH_like, Transmembrane subunit (TM) of Escherichia coli AraH and related proteins. E. coli AraH is the TM of a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of the monosaccharide arabinose. This group also contains E. coli RbsC, AlsC, and MglC, which are TMs of other monosaccharide transporters, the ribose transporter, the D-allose transporter and the galactose transporter, respectively. The D-allose transporter may also be involved in low affinity ribose transport. These transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. Proteins in this subgroup have a single TM which homodimerizes to generate the transmembrane pore.	4.49135e-52
NZ_CP016912.1\|WP_011205512.1\|1444783_1445524_+\|isoprenylcysteine-carboxylmethyltransferase-family-protein	gnl\|CDD\|224931	COG2020, STE14, Putative protein-S-isoprenylcysteine methyltransferase [Posttranslational modification, protein turnover, chaperones].	3.08543e-14
NZ_CP016912.1\|WP_075019228.1\|1436540_1439006_+\|TonB-dependent-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	6.33045e-86
NZ_CP016912.1\|WP_004528277.1\|1433885_1434245_+\|lipoprotein	gnl\|CDD\|226765	COG4315, COG4315, Uncharacterized protein conserved in bacteria [Function unknown].	2.7211e-31
NZ_CP016912.1\|WP_004524116.1\|1434711_1435221_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|171561	PRK12528, PRK12528, RNA polymerase sigma factor; Provisional.	7.12237e-71
NZ_CP016912.1\|WP_004524126.1\|1447750_1449214_-\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.24401e-36
NZ_CP016912.1\|WP_004542736.1\|1431977_1432802_+\|anti-sigma-factor	gnl\|CDD\|227949	COG5662, COG5662, Predicted transmembrane transcriptional regulator (anti-sigma factor) [Transcription].	1.15709e-18
NZ_CP016912.1\|WP_004199294.1\|1431459_1431981_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|237123	PRK12511, PRK12511, RNA polymerase sigma factor; Provisional.	2.21088e-40
NZ_CP016912.1\|WP_004524117.1\|1435217_1436222_+\|FecR-family-protein	gnl\|CDD\|236622	PRK09774, PRK09774, fec operon regulator FecR; Reviewed.	2.1512e-74
NZ_CP016912.1\|WP_004199295.1\|1431285_1431444_+\|lipoprotein	gnl\|CDD\|380215	NF033216, lipo_YgdI_YgdR, YgdI/YgdR family lipoprotein. Members of this family are exclusively lipoproteins of small size, including YgdI and YgdR from E. coli K-12.	0.00455838

>NZ_CP016912.1|WP_004548936.1|1439224_1440205_-|ABC-transporter-permease
MRDATDRLSRLAALGALAAVLAFFAVAAPGFATLANVERVLVNNFALLAIAALGMTLALSIGAIDLSLGTAIDVASLAFVCALAHRAGCASAALAGLGAALALGAANALLVTRLGIAPFLATLGTLFIGQTIQQLATDGGQPIYLLSTAPPPAFDALAHGVWLGVAAPLWIVAALAGALHVALERSTLGRQARALGAQPGVARHSGLRVGALAAGVFVASALVYGVAGLVLSSTVRSYAPQAGNAYLLNAIGATFIGATLSEARRPNVAGTLLGVLLVSFVANGLLLIGWNFYWQQVASGALVFAVLALGSGVGRERRARDAGQSG
>NZ_CP016912.1|WP_075019228.1|1436540_1439006_+|TonB-dependent-receptor
MHAPCMPQFAPQFAPRRVVARVAAAALFSACAAPGVSGAAEPAAATRGYDIPAGPLDAALTRFGREAGILLSFPGELTTGLRSPGLHGRADPAAALDRLLTGTGLVALRQPSGGYTLARLPGPAAAGADAALAADTTLPTVAVRASGPHADSYRPPREAAGLRSDAPLAEVPQAVAIVAQQVLRDQRPRNLDDALANVSGITQGNTLGSTQDTVMKRGFGDNRDGSVMRNGMPIVQGRSLNATTDSVEVLKGPASLLYGIMDPGGVINVVTKQPQLAGRHAISALGSTYGGGRNGGELTFDSTGAIGESRVAYRLIVDQTNEQYWRNYGEHRETLVAPSLAWYGRDTQVVLSYEYRRFLMPFDRGTALDPRTNAPLAIPARRRLDEPFNDMRGESNLAQLAIDHQLAPDWKVHVGYSYNRETYDANQIRITAVDPLKGTLTRSNDATHGSRSTDSYGIAYVDGRVTLAGMRHDVQFGVDGEYRQVYRADMLRQPIKTPFSYLNPTYGLVPPSTSVSASDSDQSDTLHTASLFFQDSIHLSERWMLVGGARWVRYSQLAGRGRPFQVNTNLSGTKWLPRAGIVYKWNDALSLYGSYTQSLKPTSKIAPMAGGYVIDGSTAPEEGASWELGAKLDMPGGLAGTLAFFDIDKKHVLVSQYDDATNQTAWRTSGRARSRGIELDVSGRIGARWNVIASYAYIDAKTTEDPLYAGNRLWNVARHTASLAAVYDVGTVLGGDDLRIGAAGRYVGARPGDSANSFTLPAYATADAFATYDTRLGKQKLQFQLNVKNLFNRTYYPSSVNRFFVSVGDARQVSLLTTLQF
>NZ_CP016912.1|WP_004524117.1|1435217_1436222_+|FecR-family-protein
MSGAKPAGGPPAVPERVARRAVQWWVELGAAPASDATRARLARWRAEHPAHDAAWRHIEAVNGRLGHVASALSARAARAALLPPRSRGRRAALKALAVLLFAGGGAWTGQAYLPWRAWGADVRTALGERRTITLADGTTVVLNTDTAIDIRFDDATRGVRLLRGEIMVTSGRDAARAVPRALVIATAHGDVRPVGTRFSVRERGDATRVDVFDGAVRIAPRRAVGRAPLITAGHGADFTRDALAGPPRVLGASAGAWVDGILVASNLRLADLLAEIDRYRPGRVRCDAAVANLRVSGTYPLDDTDRILDTLRETLPVDVEYLSRYWVTVVAARD
>NZ_CP016912.1|WP_004524116.1|1434711_1435221_+|sigma-70-family-RNA-polymerase-sigma-factor
MPANTLRLQREIAALYTGHRGWLHGWLSKKLGCGERAADLVHDTFIRLLARDEPIDAAEPRAFLTTVAQRVLYNHWRRERLERAYLDALAQWPEAVAPSPETRAVLFETLVEVDRMLDGLPAVVRRAFLLAQLDGMTHAQIAAELRVSLATVKRYLVKAGAQCYFAIAA
>NZ_CP016912.1|WP_043276786.1|1434459_1434690_+|hypothetical-protein
MHAADAAAVATFRLSAGSASRVRRVPAVPARRFGEAAGPRAPPKRRGAPPIVRTHSPSGYKYVYNNHSHLQNGIPA
>NZ_CP016912.1|WP_004528277.1|1433885_1434245_+|lipoprotein
MIRNVLIALVCAAPVAALAEPPKAAGGMIVDDDGMTLYTFDRDTMPGKSACTGGCTANWPAALADAYDKPGGDLGFIAAAGGKHQWTYKGRPLYRFSGDAKPGQHTGDGFGGMWHVARP
>NZ_CP016912.1|WP_004536762.1|1432859_1433846_+|YceI-family-protein
MDAAGSFASFAATLACALSAWLAPSAGIAQTAWPPDAPRVAGASGPPRTPGLARTPAAVTDAPGAATAGALAASPPAATRYRLDPRHSGVTFRVDNFWHAHLTMRFARMRAELSDVGDDRLASRVDVTVDAASLGANVPFVAALVKGSAMLDVARYPEIRFVGTRFERTGATTGVLTGELTIRAMTRPITLTVRFDAGRQLEPDTGARAEREGDESDESGESNPAERRAGQGRRAAELRDGRPRDAGPGVADSRDAMRRETDSGSAHRGAEPPERIARAAPDAARPLAFVADGHFSRTAFGLSRWLPAVGDDVRLRIRAEFVRARADP
>NZ_CP016912.1|WP_004542736.1|1431977_1432802_+|anti-sigma-factor
MSDDPDLCVAPESDEPGLLALSAFVDGELPDAQSRAMARRLASDPRAAGIAAHYRAQRAALRALFADPVATRHGPCVAWPVRTPWWRRAAFAGGALAAGVALGWLGGALAPRFAPSAALQWVAPAAAQRAFARDADLAYALYAPDARHPVEIAVGRDGAPLAWLSARVGRRIAAPSLREYGFALLGARLLPGAGGPAAQFMYENAAGERLALYVSASAQREAAVRPWRDGGRHTFYWVSERTAYALSGQLDEGRLRTIAADVCGELGGHPQRWR
>NZ_CP016912.1|WP_004199294.1|1431459_1431981_+|sigma-70-family-RNA-polymerase-sigma-factor
MSFESDVVGWLPQLRRYARALTGDPAWADDLVQDTVERAFSRMRAFRPDSNLRAWLLTILRHLYIDQLRARREFAVDDDEGPWRTLEAPAGQIDALVLRDVQRMLYRLPLEQREVLLLVCVEELSYQDASAVLGVPVGTVMSRLSRARERMRALLTDAPLRPPLSLTAARHHR
>NZ_CP016912.1|WP_004199295.1|1431285_1431444_+|lipoprotein
MESIRMLSAACALLALMLAAGCASPGDMSPSDHAAPMGGYGRGGGSGGGGGY
>NZ_CP016912.1|WP_024429158.1|1441279_1443106_-|sugar-ABC-transporter-ATP-binding-protein
MKAALTTAAASAAAAPDAAGAPLALDVRRVVKRFGGVAALRGASLAVTRGTVHGLIGQNGAGKSTLVKLLAGLHAPDEGEITVGGVPFASGGSGSRASAGAARRHSTGIGFIHQERLLPATFTVAEALFFPHPPTLGGRASRLARLLPLDVKRMRRDCRAVLHTQFGLDLAPDRLIGELSVAEQQIVQITRALLGRHEILVFDEPSAALVSSEVDRLLRTIERLRANGHTILYVSHYLDEIARVCDRVSVLRDGADVAHFEARAVSRDTLVAAMIGAPQPAAAPSAAAARAAARADARADARVSARADAWGDDPHRAPAGADPARRGARAAPGAIALEARDLALPGRFGPLSLAVRRGEIVGLTGGLGSGGKDVIRALFGLARGVRGSIAVDGRPARVRRPHDAVAHGIALVPENRAAHGVALTLPVRENVVLADLSSVSRFGLVHGRREADVARALIRRLDIRPARPDLPARFLSGGNQQKVALAKWLGRASTVYLLDEPTVGVDVGAKAQIYRLIDALARAGAAVLLFSSDLTELLDVTDRVYVMARGEIVAQCASAETTTQDVLAWATLARDARPGGGAGAHDAAARTGTPGAAGAASSAAKVAT
>NZ_CP016912.1|WP_004551656.1|1443102_1444152_-|sugar-ABC-transporter-substrate-binding-protein
MPRPLPSLARLLSMLFAVALAIGAAPACASPAAGAAPPGPRAGHAPLSLAGKRIGITAAGTDHYWDLQAYQGAVDEVKRLGGTPIALDAGRNDSRQIAQIQTLIAQQPDAIIEQLGTASVLEPWLRKIRQAGIPLFTIDTASPSSLNVVTSDNFAIGSQLALKLVNDIRGEGNVLVFNGFYGVPVCAIRYDQLKAVLKWYPKVKIIEPELRDVIPNTAQNAYAQISQLLQKYPKGAISAIWAAWDIPQVGATQAVDAAGRREIRTYAVDGSPEAVALVRNPTSSAAAVVAQQPALIGRTAVRNVARYLAGDRSLPAYTFVPSVLVTKDDAGVARPALGQTPAAAGLARR
>NZ_CP016912.1|WP_154219343.1|1444240_1444669_-|sugar-ABC-transporter-substrate-binding-protein
MQPFAKSPSKRAAPPPRRIMRRGGPSYGFSSMPARNFALAERFREDFVSFDAARAAAFSDWPAISRFRFNGASSGLFSIALKFICDCPIPIETTRRRSRVPADIGIGIDAREAAGPASARAGCVRFPPRIFACAARAFAAIP
>NZ_CP016912.1|WP_011205512.1|1444783_1445524_+|isoprenylcysteine-carboxylmethyltransferase-family-protein
MRRTGVFAMEHEVRPSMATTRRHATATALAAAARPCAAPHADSFLGILIEVFARVVAALALGVFAYAAYLQWRLDPSRITLILLAVSTTLTVGLSLFAEPPKKRDWSPLALFFSVGGTFYYLVFQLTASRQLLPEAAGAAIQLIGLFWQLFAKVSLRKSFGILPANRGIVSRGAYRFVRHPMYLGYLIIDAGFLLTNFSARNLIAVALQIGLQLGRIRREERLLSEDAAYRAYRRSVRYRVIPGLF
>NZ_CP016912.1|WP_041188241.1|1445857_1446109_-|hypothetical-protein
MFSTLSHVLPRVVLLGEPLANAPFVDGEITRPFRDGFWLLPYSTLCLPLVASDTVIVEPDRPGSAGALAGRQLDAGRQSPSPL
>NZ_CP016912.1|WP_004202590.1|1446271_1447531_-|monooxygenase
MSHAPADPTRSTGADYASLAARFRPIFARIAEGAIERDRTRALPHEPIRWLKEAGFGALRVPVHAGGAGASVPQLVQLLIELAAADSNLPQALRGHFAFVEDWLNAPPDAARRAWFDRFASGQLVGNAWTEVGDVALGEVRTKVAKRDGGWVVNGEKYYSTGAIFADWIDVYAQRTDDGGPVIAAVAARQDGVILGDDWDGFGQATTGSGTTRFVDAHVDEANVIDFARRFKYQTAFYQLFHLATLAGIGRAVERDASALVRGRRRVYSHGNAPRVSDDAQILQVVGEISAWAYAAEAIALRAAQPSQRAYEARVGGDAAAEHDANVAAEIESAQGQLVVSELVLRAATHLFDALGASATRATNALDRHWRNARTVASHNPLVYKARIVGDRAVNGTEPPYVWQIGAGPGGPREPEQAA
>NZ_CP016912.1|WP_004524126.1|1447750_1449214_-|MFS-transporter
MSTLDLDAPISTPIRTASDVSRLINASGARANHARVIVLLALGGVFLDAYDLTTLSYGIEDVTREFGLTPALSGLVSASIMIGTILGSLLGGWFTDKVGRYRVFMADMLCFVVAAIVAGLAPNVEVLIAARFVMGLGVGIDLPVAMAFLAEFSKFGGRGNKASRLAAWCPMWYAASSVCFLIVFGLYFALPAEHARWLWRASLIFGAVPALAIIAVRGRYMNESPLWAANQGKLRDAARILRESYGIRAHAADDTPRAAPSQPPVSFRVLFRQPYLPRTLVASAMNLCIPFEYTAIAFFLPTILTQFLGAGVFETIAATLALNVLFALTGGLLGMRLAYRLPSRRVAIAGFALQAAALVTLALLGHPQTALGIGAAVLMLGLWLFAEGFGPGAQMMIYPALSYPASIRGTGLGFGRALTGIGSAFALFVLPILNARLGAGMFWIVAIAAFVPIVFLAAIRFEPTARDVDIDAGSRAQGDRARVRAAA
>NZ_CP016912.1|WP_004198472.1|1449631_1449880_-|hypothetical-protein
MKAPIIAIAFGIALAACAPLRQDSRPGEAGPPIAAPNRGGGNTPPSGARRAANEVVDYAGRPCVNQTLYVKTHPCIFPRLQR
>NZ_CP016912.1|WP_071898081.1|1450326_1450527_-|hypothetical-protein
MFIASSPSSGSLSNDSCLYFERRAVRNHERAMTNPSSARGAASAARADASMTRISCSRQRGAAAMP
>NZ_CP016912.1|WP_004524130.1|1450519_1450792_+|DUF4148-domain-containing-protein
MNTKTTIVWATAAALTALALSPAAFAQGKTRDEVRQELIRAQHEGVVPAGKNDYPPSAALVARNKELHAISVHGGKTDLALDQHDQTVAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP016912_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016912_3

2726984-2727076

Orphan

Consensus_repeat	Method
GCGCGTCGGCGCGCGCGGCGGCGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP016912_3

>merge|NZ_CP016912|3|2726984-2727076|CRISPRCasFinder
GCGCGTCGGCGCGCGCGGCGGCGATCAGCCGCTCGCGCTCGGCGGCGGCCTGCGCGAGCGCGTCCTTCAGCGCGTCGTCGCGCGCGGCGGCGA

>NZ_CP016912|3|2|2726984-2727076|CRISPRCasFinder
GCGCGTCGGCGCGCGCGGCGGCGA	TCAGCCGCTCGCGCTCGGCGGCGGCCTGCGCGAGCGCGTCCTTCA
GCGCGTCGTCGCGCGCGGCGGCGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016912.1\|WP_004524989.1\|2721299_2721809_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016912.1\|WP_024430562.1\|2724535_2726548_-\|F0F1-ATP-synthase-subunit-alpha	unknown	unknown	gnl\|CDD\|183987
NZ_CP016912.1\|WP_004187193.1\|2727294_2727543_-\|F0F1-ATP-synthase-subunit-C	unknown	unknown	gnl\|CDD\|184067
NZ_CP016912.1\|WP_004549747.1\|2728237_2728546_-\|membrane-protein	unknown	unknown	gnl\|CDD\|274462
NZ_CP016912.1\|WP_024430558.1\|2734793_2735972_+\|acetate/propionate-family-kinase	unknown	unknown	gnl\|CDD\|235922
NZ_CP016912.1\|WP_075019164.1\|2718943_2719102_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016912.1\|WP_024430561.1\|2728538_2729039_-\|AtpZ/AtpI-family-protein	unknown	unknown	gnl\|CDD\|378198
NZ_CP016912.1\|WP_004529180.1\|2723690_2724539_-\|F0F1-ATP-synthase-subunit-gamma	unknown	unknown	gnl\|CDD\|376304
NZ_CP016912.1\|WP_024430559.1\|2731589_2733383_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|213656
NZ_CP016912.1\|WP_050020039.1\|2733366_2734797_+\|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase	unknown	unknown	gnl\|CDD\|236180
NZ_CP016912.1\|WP_011204277.1\|2736081_2736252_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016912.1\|WP_004188221.1\|2729035_2729491_-\|F0F1-ATP-synthase-subunit-epsilon	unknown	unknown	gnl\|CDD\|184057
NZ_CP016912.1\|WP_004187346.1\|2727539_2728241_-\|F0F1-ATP-synthase-subunit-A	unknown	unknown	gnl\|CDD\|237383
NZ_CP016912.1\|WP_038766143.1\|2722446_2723472_-\|alcohol-dehydrogenase-AdhP	unknown	unknown	gnl\|CDD\|176257
NZ_CP016912.1\|WP_024430587.1\|2712476_2715725_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP016912.1\|WP_004529174.1\|2717001_2718837_+\|response-regulator	unknown	unknown	gnl\|CDD\|237425
NZ_CP016912.1\|WP_004546783.1\|2715727_2716852_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223912
NZ_CP016912.1\|WP_004524990.1\|2719193_2720759_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|185008
NZ_CP016912.1\|WP_004524981.1\|2731200_2731458_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016912.1\|WP_044365989.1\|2721866_2722370_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP016912.1\|WP_024430562.1\|2724535_2726548_-\|F0F1-ATP-synthase-subunit-alpha	gnl\|CDD\|183987	PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional.	0
NZ_CP016912.1\|WP_004187193.1\|2727294_2727543_-\|F0F1-ATP-synthase-subunit-C	gnl\|CDD\|184067	PRK13468, PRK13468, F0F1 ATP synthase subunit C; Provisional.	4.45015e-37
NZ_CP016912.1\|WP_004549747.1\|2728237_2728546_-\|membrane-protein	gnl\|CDD\|274462	TIGR03165, F1F0_chp_2, F1/F0 ATPase, Methanosarcina type, subunit 2. Members of this protein family are uncharacterized, highly hydrophobic proteins encoded in the middle of apparent F1/F0 ATPase operons. We note, however, that this protein is both broadly and sparsely distributed. It is found in about only about two percent of microbial genomes sequenced, with the first ten examples found coming from the Euryarchaeota, Chlorobia, Betaproteobacteria, Deltaproteobacteria, and Planctomycetes. In most of these species, surrounding operon appears to represent a second F1/F0 ATPase system, and the member proteins belong to subfamilies with the same phylogenetic distribution as the current protein family.	3.91378e-10
NZ_CP016912.1\|WP_038766143.1\|2722446_2723472_-\|alcohol-dehydrogenase-AdhP	gnl\|CDD\|176257	cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD). These alcohol dehydrogenases are related to the cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Cinnamyl alcohol dehydrogenases (CAD) reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	5.03185e-180
NZ_CP016912.1\|WP_004529180.1\|2723690_2724539_-\|F0F1-ATP-synthase-subunit-gamma	gnl\|CDD\|376304	pfam00231, ATP-synt, ATP synthase.	1.01746e-33
NZ_CP016912.1\|WP_024430559.1\|2731589_2733383_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|213656	TIGR01838, Poly-beta-hydroxybutyrate_polymerase, poly(R)-hydroxyalkanoic acid synthase, class I. This model represents the class I subfamily of poly(R)-hydroxyalkanoate synthases, which polymerizes hydroxyacyl-CoAs with three to five carbons in the hydroxyacyl backbone into aliphatic esters termed poly(R)-hydroxyalkanoic acids. These polymers accumulate as carbon and energy storage inclusions in many species and can amount to 90 percent of the dry weight of cell. [Fatty acid and phospholipid metabolism, Biosynthesis].	2.5312e-177
NZ_CP016912.1\|WP_050020039.1\|2733366_2734797_+\|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase	gnl\|CDD\|236180	PRK08190, PRK08190, bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated.	0
NZ_CP016912.1\|WP_004188221.1\|2729035_2729491_-\|F0F1-ATP-synthase-subunit-epsilon	gnl\|CDD\|184057	PRK13447, PRK13447, F0F1 ATP synthase subunit epsilon; Provisional.	4.44077e-63
NZ_CP016912.1\|WP_004187346.1\|2727539_2728241_-\|F0F1-ATP-synthase-subunit-A	gnl\|CDD\|237383	PRK13421, PRK13421, F0F1 ATP synthase subunit A; Provisional.	1.54059e-122
NZ_CP016912.1\|WP_024430558.1\|2734793_2735972_+\|acetate/propionate-family-kinase	gnl\|CDD\|235922	PRK07058, PRK07058, acetate/propionate family kinase.	0
NZ_CP016912.1\|WP_024430587.1\|2712476_2715725_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	3.10179e-92
NZ_CP016912.1\|WP_004529174.1\|2717001_2718837_+\|response-regulator	gnl\|CDD\|237425	PRK13557, PRK13557, histidine kinase; Provisional.	4.08999e-132
NZ_CP016912.1\|WP_004546783.1\|2715727_2716852_+\|ABC-transporter-permease	gnl\|CDD\|223912	COG0842, COG0842, ABC-type multidrug transport system, permease component [Defense mechanisms].	1.30959e-25
NZ_CP016912.1\|WP_024430561.1\|2728538_2729039_-\|AtpZ/AtpI-family-protein	gnl\|CDD\|378198	pfam09527, ATPase_gene1, Putative F0F1-ATPase subunit Ca2+/Mg2+ transporter. This model represents a protein found encoded in F1F0-ATPase operons in several genomes, including Methanosarcina barkeri (archaeal) and Chlorobium tepidum (bacterial). It is a small protein (about 100 amino acids) with long hydrophobic stretches and is presumed to be a subunit of the enzyme. It carries two transmembrane helices and is a magnesium or calcium uniporter. The atp operon of alkaliphilic Bacillus pseudofirmus OF4, as in most prokaryotes, contains the eight structural genes for the F-ATPase (ATP synthase), which are preceded by an atpI gene that encodes a membrane protein with 2 TMSs. A tenth gene, atpZ, has been found in this operon, which is upstream of and overlapping with atpI.	4.83558e-17
NZ_CP016912.1\|WP_004524990.1\|2719193_2720759_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|185008	PRK15048, PRK15048, methyl-accepting chemotaxis protein II; Provisional.	2.47951e-79

>NZ_CP016912.1|WP_024430562.1|2724535_2726548_-|F0F1-ATP-synthase-subunit-alpha
MTPTPDAPAAADAATGAGWLARRRGALARVALAPVAQAIGRVERVADGIAFVSGLEDTMLNEVLRFEGGVTGFAHTLDEDLISVVLLDPDAGVRAQTAVARTGAVLEVPAGPQLLGRVVDPLGRPLDGGAPLDAAHTLPIERAAPAIIERDLVSEPLDTGVLIVDALFTIGRGQRELIIGDRATGKTSLAIDAIVNQRHSDVICVYVAIGQRASAVRRVIDAVRRYGAPERCVFVVAPAACAPGLQWIAPFAGFSIAEYFRDRGQHALVVVDDLTKHAATHRELALLTREPPGREAYPGDIFYVHARLLERAAKLSAALGGGSLSALPIAETDAGNLAAYIPTNLISITDGQIVLDSALFAANQRPAVDVGLSVSRVGGKAQHPALRAASGRLRLDYAQFLELEAFTRFGGLTDARLRAQITRGERIRALITQPRFRALRTLDEVVLLKALAAGALDAMSPDLVAPLRERLPAWLDARIAALTPALAPPRDWLADDAALDALAESVGELIERIAADAARRATAGMPAEDAAGDIGGAFGGEQARGDADRDADHGANREVSREVSPEASREVSREVSREVSHEADRDAAADAARVAGRAPGRAEPDRAAPRAMPDGPPRAQADGDRASASRPPPDARGDAARTAPSPQDGADANVNADANVDAEAEARHKR
>NZ_CP016912.1|WP_004529180.1|2723690_2724539_-|F0F1-ATP-synthase-subunit-gamma
MSDKLAAIEARTDTARQLQTVIGAMQGVAAARAHEAQQRLPGIRASAATVGAAIGDALSAGARSGDTAAGARAAPRARLVVVLCSEQGFVGAYNAQLIEHATRPEPSVSREYMMVGSRGAMLADAGGVPLVWRTPMAARADDVVHLANRITDALYAHLAKRGAQPVSIVHAMPGGAARLEATERRLLPFDYARFDTAPRAQPPLVHLPPATLLAELAQAYVFVELCEAAMLAFAAENEARTRAMIAARESVERALGDLLQAYRIARQDEITADIVELAASGL
>NZ_CP016912.1|WP_038766143.1|2722446_2723472_-|alcohol-dehydrogenase-AdhP
MAQYMKAAVVHAFGEPLRIEEVSVPTPGAGQILVNVKASGVCHTDLHAADGDWPVKPTLPFIPGHEGVGFVAAVGEGVRHVKEGDRVGVPWLYTACGHCEYCQTGWETLCHEQQNTGYSVNGSYAEYVLADPNYVGHLPSNVAFDEIAPILCAGVTVYKGIRVTDTRPGQWIAISGIGGLGHVAVQYAKAMGLHVVAVDVAPQKLELARKLGAAFVVDASKDDPAAVIQKEIGGVHGVLVTAVSRGAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESLDFAAEGLVRAHIHRDKLEHINGVFSALREGKVDGRIVLTGQ
>NZ_CP016912.1|WP_044365989.1|2721866_2722370_-|hypothetical-protein
MRGAGRASPSRARRYENVSKEPNTHREAGAPVHRYRLQVRNMNGECRTYELRLSSLDDGYTLEIDEWLNFPDMHPGDVTPVHVSRPVQFAVPADEFYRRRRAFRTELIESVAAALRAGEVVRMRDSPDEYPGGHAGNPWVNWIRADLRANPGGRPPPVGDDMQDLIH
>NZ_CP016912.1|WP_004524989.1|2721299_2721809_+|hypothetical-protein
MRRIYFLLPDADTARAIVDELLLKRIEWRHIHVVANDRVPLENLPEASIAQSSDLLPALARGTAAGGVTGALAGLAAIAFPPAGLTIAGGAVVAFAIAGAGFGAWVGTMIGVSVPNTRLKHFEDAVDNGELLMMIDVHRDRVEEIEALVKQHHPNAHLEGTDPTIPAFP
>NZ_CP016912.1|WP_004524990.1|2719193_2720759_-|methyl-accepting-chemotaxis-protein
MPTLSFRQKLWLPLVISLIALLLVSISSAWLSYQTRMEERRNDLTNVAHVGLSIVREYAALAQRGVLTDAQARKEALERLRSVRYGSDGYFIVIDSSPRMIMHPIKPDTVGKDLRHVADADGRHHYLTFASVAQSPQGGFVDYVFAHPNAHPAKAVDKLGYVIRYAPWDWIISTGAYIDDIQAAFAKSLCLSAGVFALLAALLALSVVYTNRGIERMIGGDPRIAAHMAGVIASGDLATPFATRREDRSSLMFAISQMRDALANAVAQIRASAGYVATTAGEIADSNMDLSSHTECQATALQQAASSMQRLTERVRDTADRARAASELAGSAARITDRGGDMVVRVVAAMNDIRAESRKMVDIIGVIEGIAFQTNILALNAAVEAARAGNEGRGFAVVASEVRVLAQRSASAAKDIRALIGRAAERVGNGAELVEATGATIGEAQHAICRVTGIVQDIAAAATDQSQGLEQINAAVSQMDSVTRRNATLVEHAAIAAQSLNEQSRCLQDAVAAFRTEALGC
>NZ_CP016912.1|WP_075019164.1|2718943_2719102_+|hypothetical-protein
MRARRSHGAGIRLGFDKPSGTHSSPHEGWVQTDIATRLPQISLMPDQALANE
>NZ_CP016912.1|WP_004529174.1|2717001_2718837_+|response-regulator
MHVEVFAQHPSCPGWHGEMARRIRAFDWSATELGPLERWPASLVAAVRTVLASPVPLVMLWGASGYMLYNDAYAAFAGGRHPYLLGQPVELGWPEVADFNRNVMRTCLAGGALSYRDKALVLLRNGRPEEVWMDLYYSPLAGDDGAPAGVLAVVVETTERVLAARHRDRAKAALHETNAELRRLTETLEQRVADAITERASIEEQLRQAQKMEAIGSLTGGIAHDFNNVLQVVSSNLQMLSAELGEDARAQRRIASAANAVARGAQLASHLLAFARRQPLAPAVLEPRGLIDGMREMLHRALGESVHVDADLRDDVWNVLADRHQFENALLNLAINARDAMRGEGTLKITACNIVLEAGRHARRNGLPPGEYVAFDIADNGVGMTPDILERVFEPFFTTKPDGQGTGLGLSMVFGFVKQSGGHTSIESAPGRGTTVRLLLPRCREAPAGEPAAQRRLPAEGGRETILVVEDDADVRLAVVDMLAQLGYKVITASDGEAGLLALESGAPIDLLFTDVIMPGRIKGGELARRAAQRVPPVPVLFTSGYTRDEIFHAGRLDPGVMLLGKPYRRDELAHKVRSVLDAHASARRAHGARHAQADPRAKTAAARVQR
>NZ_CP016912.1|WP_004546783.1|2715727_2716852_+|ABC-transporter-permease
MRRLAIVYRLGVKELWSLVRDPILLVLIAYTFTASIYSAATARPDTLHMAPIAIIDEDASPLSARIASAFFPPQFALPRMVTLAEADRGMNAGDFTFVLDIPPNFQRDVLAGRPAQIQLNVDATRMSQAFTGNGYVQQIVSGEIDDFARRYRANTAPPVDIAMHMRFNPNLDQTWFGSLMEVINNVTLLSMVLTGAALIREREHGTIEHLLVMPVTPGEIMLAKVWSMGLVVACAAAFSLAFVVRGALHVPIEGSVALFVIGMAIHLFATTSMGIFLATLVRSMPQFGMLLVLVLLPLQLLSGSLTPRESMPFAVQNIMLAAPTTHFVEIGQAILYRGAGIETVWRQFLILAVIGTALFLLSLKRFRKTIGQMA
>NZ_CP016912.1|WP_024430587.1|2712476_2715725_+|ATP-binding-cassette-domain-containing-protein
MSAPSVVRFSDVSLRYGKTVALERITLEIPAGLTIGLIGPDGVGKSSLLALAAGARALQTGAVDALGGDMRSRRHRERVCRRIAYMPQGLGKNLYPTLSVEENLQFFARLFGHDADERRRRIDALTRSTGLFAFLSRPAGKLSGGMKQKLGLCCALIHDPDLLILDEPTTGVDPLARAQFWDLIARIRSERPAMSVIVATAYMDEAQRFDWLIAMDAGRVLATGAPAELLARTGCDSLEAAFIALLPEDERRGHKPVTLEPLRADAQTGTAIEARGLTMRFGDFTAVDHVSFRIRRGEIFGFLGSNGCGKSTTMKMLTGLLPATEGTAQLFGKTVDPKDINTRRRVGYMSQAFSLYSELTVRQNLVLHARLFGVPAAEIDARVDEMARRFGLADIYDMLPDSLPLGMRQRLSLAVAMVHKPELLILDEPTSGVDPVARDSFWQLMIDLARRDRVTIFISTHFMNEAQRCDRISLMHAGRVLASDAPAALVRARGAATLEEAFIGYLVDASAQEAQDAQEAQGGAGERAAGESLAGRGAATDGDADGAHARPAAYANGAAQHRAPDADAAGTDVAAETGARDDARTAHAAGHSAVNDVRATVGSEVGSDVGSEVGSEVASEAGLAASAESGSERGVAHGAERAREPAADAGAAIDVEPGASAESATAAVAPARHAESAATSPRAGNAPAGTPFAAAPPSHAAPAEPPHRAFSAQRALSYMWREMLELRRDPVRATLALIGSLVLMCVIGIGISLDVEDLTYAVLDRDQTELSHDYALNLSGSRYFVERPPIADYAALDRRMRDGELSLAIEIPPNFARDVERGAPAQIGMWIDGAMPQRAETIRGYAIGMHTMWLADKARHRLGVTLAPRAEVVTRYRYNPDVKSLPAMIPAVMPLLLLMLPAMLTALAVVRERELGSILNLYVTPVTRTEFLIGKQVPYVVLAMLNFLLMTMLARIAFDVPVKGSFMTLLLAVLIFNVVATGIGLLASTFTRSQVAAIVMTIIGTMIPTVQFAGLLTPLSSLEGTGRLIGLVYPATYMLSISRGVFNKALSLHDLYSQFWPLAACVPVILGATILLLKKQER
>NZ_CP016912.1|WP_004187193.1|2727294_2727543_-|F0F1-ATP-synthase-subunit-C
MNNLIEVVSIAAAALAVSFGAIGPALAEGRAVGAAMDAIARQPDASGTVSRTLFVGLAMIETMAIYCLVVALLLLFANPFVK
>NZ_CP016912.1|WP_004187346.1|2727539_2728241_-|F0F1-ATP-synthase-subunit-A
MNASPLSTVPLFSVGPVGISAPVLATWAIMAVLVALALVARRRLSVDAPSRLQSVLELFVATVDAQIADTMQTPPARYRALIGTIFVLVFCANGASLVPGVEPPTAHLETDAALALVVLAATLYYGVRARGVRGYLATFAEPTWVMIPLNVVEQLTRTFSLIVRLFGNVMSGVFVIGIVLSLAGLFVPIPLMALDLLTGTVQAYIFMVLSMVFIGAAVSGDETSAPRRGQENT
>NZ_CP016912.1|WP_004549747.1|2728237_2728546_-|membrane-protein
MIEMWETARASFDGIAAAIGLALGFAAGACHFVSLGWNSRLFVAGRAGVALALQLARVALAVAVLVVLARAGFGMLVAGSAGFFAARAIAVRRAAALTGARR
>NZ_CP016912.1|WP_024430561.1|2728538_2729039_-|AtpZ/AtpI-family-protein
MMKRRPPEVKREAREARDDAARGDARHAGAGAAPDDPRGAARRDPSPGSRAARGGATHPAARAAEPAAPKPAADRVERAAHTAAARAARGARDPEPSLGRRLAQIGVLGWTIVAPTLAALALGRWLDRMFATRVFFSAPLLMLGAALGLWLAWRWMKAQQHGDRDD
>NZ_CP016912.1|WP_004188221.1|2729035_2729491_-|F0F1-ATP-synthase-subunit-epsilon
MGAELRVTIATPARVCVDDLPIVSLRAEDASGAFGIRAGHVDFVTLLRASVVRWRTADGATHYAALDGGVLRVTRGARIEIACRDAVLGESLAELEAVVRGVRATQLDEKRRARVDETRLHAQAVRRLLTYLRPEHAKDGVHAPLKPETLE
>NZ_CP016912.1|WP_004524981.1|2731200_2731458_+|hypothetical-protein
MPFVACGSATVAPVWLVRRWLHHNGARRPPADLGQETGNRQTKRGIAQSETIDASASGADTVRAASIVDSNQIPQTYAWLQWPCQ
>NZ_CP016912.1|WP_024430559.1|2731589_2733383_+|alpha/beta-fold-hydrolase
MDTRHAPESGAPDAPLPAHPPASYAPESPYRIFDLAKEASVAKLTSGLSPASLQLALADWLIHLAAAPGKRAELATLALRHAALLGQYLLEAATGRTPAAPAQPSPGDRRFRAGAWQLEPYRFWHQSFLLAEQWWRAATRDVPGVSPHHEDVVAFSARQMLDTFAPANYVATNPEIAQRTALTGGANLAQGVWNYLDDVRRLITKQPPAGAEQFELGWNLATTPGRVVFRNHLIELLQYSPTTPDVYAQPVLIVPAWIMKYYILDLSAHNSLIRYLVGEGHTVFCISWRNVDASDRDLSLDDYRKLGVMDALDTIGAIVPGEKIHATGYCLGGTLLSIAAAAMANTGDDRLASITLLAAQTDFAEPGELQLFIDDSEIHFLESMMWERGYLGAHQMAGSFQLLMSNDLIWSRVIHDYLLGERTPMIDLMAWNADSTRMPYRMHSEYLRHLFLDNDLATNRYVIDGQTVSVHNIRAPFFVVGTEHDHIAPWRSVYKIHYLSGSDVTFVLTAGGHNAGIVSEPGHAKRHYRMKMTAAAAPSISPDEWLAGATDFEGSWWPAWHAWLARHSSPQRVAPPPLGKPGAHTLGDAPGTYVFQK
>NZ_CP016912.1|WP_050020039.1|2733366_2734797_+|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase
MCSRNKECRVDREILQNRPFDSLAIGDSASLVRTASRDDIDLFAAMSGDVNPAHLDAAFAAHDLFGHVVVHGMWTGALVSAVLGTKLPGPGTIYLDQTLEFRHPVAPGDTITATVTVAEKRPEKRIVLLDTRCTNQDGHVVLRGTATVIAPDTPITWERVPGPEVAVRRHDRYETFVRDAREQPPLRTAIVHPCSPDALRAAIDARDANLIEPILIGPQAKIRAIADAAGVDLAGVPIEAVEHSHAAAARAVEMGGAGEVAALMKGSLHTDELLAAVIGPASRLRTERRISHVYAMDVPAYPKPLLITDAAINIAPTLEQKRDICQNAVDLLHVLGVERPRVAVLAAVETVNPKMPSTLDAAALTVMAARGQIAGAIVDGPLAFDNAVSAVAAMSKGIASPVAGDADVLLVPDLEAGNMLAKQLMYFAGADAAGLVLGARLPIILTSRADSLRVRIASAALAKLVAERTRAGALAS
>NZ_CP016912.1|WP_024430558.1|2734793_2735972_+|acetate/propionate-family-kinase
MSEPLLLTFNAGSSTLKIGLYSVANGEPAPLGRGKIDFNRAPLQFEYANGGEAHAVPLAAPVTDDLHAVLDEALGWIDAHLSVHELVSVGHRVVHGGDTFDGPVRIDECTLDAIAALVPLAPLHQPQSVRLIRALRHLRPHLPQVASFDTAFHRTQSDLVRRFALPRALFDAGIKRYGFHGLSYRYVAGRLRERHPSIARGKVVAAHLGSGASLCALDAGVSRDTSMGFSTLDGIPMATRCGALDAGVVLHLQKTLGRTLDDVEQMLYHRSGLLGVSGVSGDARALLADPSAGARDALELFAFRIAGETARLAATLGGLDALVFTAGIGEHQPQTRAAVCERLRWLGVELDAHANARNAETVSRDGSRVAVLVVPTDEEQVIARDAASVLHA
>NZ_CP016912.1|WP_011204277.1|2736081_2736252_-|hypothetical-protein
MLVSRAHGPKLRRRRARARRQSPAAILPRDLLQLRPLRARPLSAPADAARVATDDR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP016912_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016912_4

3134155-3134300

Orphan

Consensus_repeat	Method
GCAGAGGCGCCGCCGCCGGAATACCCGATCATCGGGATGCTCGATCGCCGAAG	PILER-CR
CGGAATGCCCGATCATCGGGATGC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP016912_4

>merge|NZ_CP016912|4|3134155-3134300|PILER-CR,CRISPRCasFinder
TCGTCGGGATGCTCGATTGCCGCAGTCACCCTCCGCCGGGGCTCCGTCGTCGGAATGCCCGATCATCGGGATGCCTGCTCGCCGAAGCACTCCACCGCAGAGGCGCCGCCGCCGGAATACCCGATCATCGGGATGCTCGATCGCCG

>NZ_CP016912|4|2|3134155-3134300|PILER-CR
TCGTCGGGATGCTCGATTGCCGCAGTCACCCTCCGCCGGGGCTCCGTCGTCGGAA	TGCCCGAT
CATCGGGATGCCTGCTCGCCGAAGCACTCCACCGCAGAGGCGCCGCCGCCGGAAT	ACCCGATCA
TCGGGATGCTCGATCGCCG

>NZ_CP016912|4|3|3134205-3134290|CRISPRCasFinder
CGGAATGCCCGATCATCGGGATGC	CTGCTCGCCGAAGCACTCCACCGCAGAGGCGCCGCCGC
CGGAATACCCGATCATCGGGATGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016912.1\|WP_051227135.1\|3146476_3147604_-\|porin	unknown	unknown	gnl\|CDD\|238208
NZ_CP016912.1\|WP_075019181.1\|3140144_3140600_+\|quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|237171
NZ_CP016912.1\|WP_024430319.1\|3134876_3136142_+\|polyhydroxyalkanoate-depolymerase	unknown	unknown	gnl\|CDD\|130908
NZ_CP016912.1\|WP_009927403.1\|3126651_3126762_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016912.1\|WP_004523291.1\|3126888_3127824_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176109
NZ_CP016912.1\|WP_024430320.1\|3138316_3140128_+\|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein	unknown	unknown	gnl\|CDD\|225098
NZ_CP016912.1\|WP_024430317.1\|3130672_3132946_-\|pyridine-nucleotide-disulfide-oxidoreductase	unknown	unknown	gnl\|CDD\|369639
NZ_CP016912.1\|WP_024430321.1\|3140697_3141729_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236122
NZ_CP016912.1\|WP_075019180.1\|3127999_3128431_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016912.1\|WP_004187137.1\|3144014_3144464_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341411
NZ_CP016912.1\|WP_004200700.1\|3125475_3126591_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378454
NZ_CP016912.1\|WP_011204694.1\|3123447_3123672_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016912.1\|WP_004187469.1\|3133078_3133474_-\|conjugal-transfer-protein-TraR	unknown	unknown	gnl\|CDD\|224648
NZ_CP016912.1\|WP_004523287.1\|3128730_3130389_+\|GMC-family-oxidoreductase	unknown	unknown	gnl\|CDD\|225186
NZ_CP016912.1\|WP_004529498.1\|3145625_3146060_-\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|223149
NZ_CP016912.1\|WP_004196898.1\|3124700_3125141_+\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176863
NZ_CP016912.1\|WP_024430322.1\|3141725_3143558_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|223732
NZ_CP016912.1\|WP_024430323.1\|3144904_3145558_+\|SagB/ThcOx-family-dehydrogenase	unknown	unknown	gnl\|CDD\|380318
NZ_CP016912.1\|WP_075019179.1\|3123650_3123941_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016912.1\|WP_004545483.1\|3136457_3138242_+\|ribonucleotide-reductase	unknown	unknown	gnl\|CDD\|180772

Protein	Function_ID	Function_description	E-value
NZ_CP016912.1\|WP_075019181.1\|3140144_3140600_+\|quinone-oxidoreductase	gnl\|CDD\|237171	PRK12678, PRK12678, transcription termination factor Rho; Provisional.	0.00884327
NZ_CP016912.1\|WP_024430319.1\|3134876_3136142_+\|polyhydroxyalkanoate-depolymerase	gnl\|CDD\|130908	TIGR01849, unnamed_protein_product, polyhydroxyalkanoate depolymerase, intracellular. This model represents an intracellular depolymerase for polyhydroxyalkanoate (PHA), a carbon and energy storing polyester that accumulates in granules in many bacterial species when carbon sources are abundant but other nutrients are limiting. This family is named for PHAs generally, rather than polyhydroxybutyrate (PHB) specificially as in Ralstonia eutropha H16, to avoid overcalling chemical specificity in other species. Note that this family lacks the classic GXSXG lipase motif and instead shows weak similarity to some [Fatty acid and phospholipid metabolism, Degradation].	5.39891e-114
NZ_CP016912.1\|WP_004187469.1\|3133078_3133474_-\|conjugal-transfer-protein-TraR	gnl\|CDD\|224648	COG1734, DksA, DnaK suppressor protein [Signal transduction mechanisms].	1.7869e-14
NZ_CP016912.1\|WP_004523291.1\|3126888_3127824_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176109	cd08417, PBP2_Nitroaromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of dinitrotoluene and similar compounds, such as DntR, NahR, and LinR. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. Also included are related LysR-type regulators clustered together in phylogenetic trees, including NodD, ToxR, LeuO, SyrM, TdcA, and PnbR. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.07132e-61
NZ_CP016912.1\|WP_024430317.1\|3130672_3132946_-\|pyridine-nucleotide-disulfide-oxidoreductase	gnl\|CDD\|369639	pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase. This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain.	7.39238e-57
NZ_CP016912.1\|WP_024430321.1\|3140697_3141729_+\|hypothetical-protein	gnl\|CDD\|236122	PRK07877, PRK07877, Rv1355c family protein.	8.27096e-31
NZ_CP016912.1\|WP_024430323.1\|3144904_3145558_+\|SagB/ThcOx-family-dehydrogenase	gnl\|CDD\|380318	cd02142, McbC_SagB-like_oxidoreductase, oxidase similar to the microcin B17 processing protein McbC. This family is the oxidase domain of NRPS (non-ribosomal peptide synthetase) and other systems that modify polypeptides by cyclizing a thioester to form a ring. These include EpoB, part of the epothilone biosynthesis pathway; TubD, part of the tubulysin biosynthesis pathway, MtsD, part of the myxothiozol biosynthesis pathway; IndC, part of the indigoidine biosynthesis pathway and TfxB, part of the trifitoxin processing pathway. All are FMN-dependent and oxidize the product of the cyclization of thioesters in short polypeptides.	4.52965e-20
NZ_CP016912.1\|WP_004187137.1\|3144014_3144464_-\|CBS-domain-containing-protein	gnl\|CDD\|341411	cd17775, CBS_pair_bact_arch, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains present in bacteria and archaea. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	1.39507e-50
NZ_CP016912.1\|WP_004200700.1\|3125475_3126591_-\|hypothetical-protein	gnl\|CDD\|378454	pfam10604, Polyketide_cyc2, Polyketide cyclase / dehydrase and lipid transport. This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis. It also includes other proteins of the START superfamily.	2.16274e-11
NZ_CP016912.1\|WP_051227135.1\|3146476_3147604_-\|porin	gnl\|CDD\|238208	cd00342, gram_neg_porins, Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane. Individual 16-strand anti-parallel beta-barrels form a central pore, and trimerizes thru mainly hydrophobic interactions at the interface. Trimers are stabilized by hytrophillic clamping of Loop L2. Loop 3 bends into the pore, creating an elliptical constriction of about 7 x 11A, large enough to allow passage of a glucose molecule without steric hindrance. Removal of the C-terminal residue (usuallly F) destabilizes the trimer and removal of the 16th beta-sheet abolishes trimerization. Unlike typical membrane proteins, porins lack long hydrophobic stretches. Short turns are found at the smooth, periplasmic end, longer irregular loops are found at the rough, extracellular end. C-terminal residue forms salt bridge with N-terminus.	4.79069e-55
NZ_CP016912.1\|WP_024430320.1\|3138316_3140128_+\|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein	gnl\|CDD\|225098	COG2187, COG2187, Uncharacterized protein conserved in bacteria [Function unknown].	4.66952e-75
NZ_CP016912.1\|WP_004523287.1\|3128730_3130389_+\|GMC-family-oxidoreductase	gnl\|CDD\|225186	COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism].	2.19137e-37
NZ_CP016912.1\|WP_004529498.1\|3145625_3146060_-\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|223149	COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones].	9.00264e-33
NZ_CP016912.1\|WP_004196898.1\|3124700_3125141_+\|SRPBCC-family-protein	gnl\|CDD\|176863	cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins. The PYR/PYL/RCAR-like family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. PYR/PYL/RCAR plant proteins are receptors involved in signal transduction. They bind abscisic acid (ABA) and mediate its signaling. ABA is a vital plant hormone, which regulates plant growth, development, and response to environmental stresses. Upon binding ABA, these plant proteins interact with a type 2C protein phosphatase (PP2C), such as ABI1 and ABI2, and inhibit their activity. When ABA is bound, a loop (designated the gate/CL2 loop) closes over the ligand binding pocket, resulting in the weakening of the inactive PYL dimer and facilitating type 2C protein phosphatase binding. In the ABA:PYL1:ABI1 complex, the gate blocks substrate access to the phosphatase active site. A conserved Trp from PP2C inserts into PYL to lock the receptor in a closed formation. This group also contains Methylobacterium extorquens AM1 MxaD. The mxaD gene is located within the mxaFJGIR(S)ACKLDEHB cluster which encodes proteins involved in methanol oxidation. MxaD may participate in the periplasmic electron transport chain for oxidation of methanol. Mutants lacking MxaD exhibit a reduced growth on methanol, and a lower rate of respiration with methanol.	3.1145e-25
NZ_CP016912.1\|WP_024430322.1\|3141725_3143558_+\|STAS-domain-containing-protein	gnl\|CDD\|223732	COG0659, SUL1, Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism].	3.67232e-107
NZ_CP016912.1\|WP_004545483.1\|3136457_3138242_+\|ribonucleotide-reductase	gnl\|CDD\|180772	PRK06948, PRK06948, ribonucleotide reductase-like protein; Provisional.	0

>NZ_CP016912.1|WP_004187469.1|3133078_3133474_-|conjugal-transfer-protein-TraR
MAAFDEHQLQVLGALLRACRQALQADVRAGERQRADEPYANLAGPAPDEGDEANADLFVDVDHALLGMKLAELRDVDAALQRIARRDYGCCADCGQPIAYERLLARPTALRCAPCQRAHERRFATQPRPSL
>NZ_CP016912.1|WP_024430317.1|3130672_3132946_-|pyridine-nucleotide-disulfide-oxidoreductase
MREFDYLLVGGGIASVTAARTLRGEDASASIAILCGEPVLPYQRPPLSQEWLMGAVQPASITLHDAAFYAAQRIDIALGVRAEQLDRAKRIVRTSSGATFRYGKLLIATGASAKAPALPGFGLDGVHVLHTFAQAQALKDAAAHARRATVLGGGFLGVEIAATLQALGLQVTLVERAPGVMPSLRAPALGGHFEALCRARGIDVLTRCEVRRVLGAQCVEAVETSDGGTRPCDLFVAAVGVTPNCGWLDGSGLALGDGVEVDAFLQTADPDVFAAGDVAHFDDPIFGVRRRIEHWDNAVRQGRIAARNMLGHRLPYRDVSIFYGSVFGLSYNLLGYPVGATETIERGAFDEASYMQLYLADDVLRAAFTIDRPAVEIAALNDAIRLHVNVAARKTKLSDPNYPLDKLPVQTILILQGGGALGAFECGAVKALEQHGVRPDVISAVSIGAFNGAIVASHPKGATKALEAFWRELSIALPLPYESQWREAWLSSYVLSFGVPNFLKPQWSQLGFDADRLRAKWTSFFDATAIEQLIARYVDFDSLGMSPTRLLIGAVDVETGEPRIFDSYVDRLSPAHVLASGSLPPGMPWTVVDGRPYWDGGVVSNSPLDLVIARCGQIGGRVFIVDLFSGSKALPTNLVEVMLRREEIAYMDRVRNDLRFEEYASDFRDLVDGILAHVDAPSANEIRQQPLYIRLMGNRAAIDIARITLNREGRLSFIEDYDFSSDAIAQLQQQGYDAALVALANGRSRRQRGRRRA
>NZ_CP016912.1|WP_004523287.1|3128730_3130389_+|GMC-family-oxidoreductase
MKQQSYDYDYVVVGSGFGGSVSALRLSEKGYRVLVIEQGRRWTPENLPESTWNLSRWQWRPALGLRGFFSMRFFRHVVVLHGNAVGGGSITYANTLLVPPDKVWREGTWAGLEDWERVMPAHYATAKRMLGVVTNRRMDAADFRLKDMAKLIGVEKSFYPTEVGVFFGDDADAPGTRYADPYFGGAGPERTSCIGCGGCMVGCRHGAKNTLDRNYLYLAERLGAQVREQTKVVDVRPLDARADGAAGYAVEAVSLAAGARGAKSRLTCRGVVFAASSLGTQDLLMRLKEKGSLPRLSDALGKRVRTNAESLIGVRFPKSRVDLSKGVAIGSGIYIDEHTHIEATRYPSGSDTMGLLTTVLTRGAPGGLRVLVWLGALAKLVLTRPLSAWRMIDPRGFARETMIFLCMQTLEGHLTMRLKRRWFWPFSKQLATSGAKIPAYIPAANDFAQKAARALGGVPMTSLTEILLNVPMTAHCMGGAAMARDARDGVCDGRSRVFGYRNMYVCDGSVLGANLGVNPSLTITALAEHAMSHVPAAREQRWDSTAETPVAA
>NZ_CP016912.1|WP_075019180.1|3127999_3128431_+|hypothetical-protein
MHQERRKRNADRHGTHPYDADSRAAPREAPRFEHEPKKQRDAAQHEVDRDRAARGIRERIEHKARPDVRRAERPISQDVAQTPIGAAGAISPSTARSIFLEIGLALAGRPIQVRRNRAPFTHGTPRRRPARGPTARTASPAPV
>NZ_CP016912.1|WP_004523291.1|3126888_3127824_+|LysR-family-transcriptional-regulator
MIQNLRQLDLNLLLVFDALMQEQNLSRAAIRLHMSQPAVSNALTRLRQQLGEPLFTRTARGMTPTAQARTLYEPVRQALYLLQIGLGPQADFEPDTHHLFKLSMNDYGQTVLLPDLLAHIKSRAPNVMLSVQSDDAGSIPAQLTTGTLDLAIDYLHFDNPELCYEPLHEEHLVVIGRAGHPAFAGGLALRGYEESGHVSIQPRDRRGSPLEIVLGSARVRRVVHLQVPHYLTIPALVAKSDLLGTIPRRLAERFADVYALQIAPLPIDIAPIQVSLIWHRQQDAQPGLRWLREQVVLTHRAIIGCDEHAPA
>NZ_CP016912.1|WP_009927403.1|3126651_3126762_-|hypothetical-protein
MQSTGSFDISARRMIEFRSVNKSNHDCPLEKSSGLL
>NZ_CP016912.1|WP_004200700.1|3125475_3126591_-|hypothetical-protein
MTQDVTVFRARYRASVHPRYNAWLHGGFVLAYGCAAIAFFLKDVARVSAVQWASVPAAFLLFNWLEFTVHRHVGHVKRRFGAMFYRRHTGDHHSFFANEQIAYREARDWRVILFPAWLIVVFSLGLFALHAVLGRFDANVAGLFASTMLGGYLLYECVHACEHLPDAHPLAKWPWIRQMRVLHRVHHRDALMRSCNFDVIWPLMDWLHGTLRWSEAPGADMSTRMRHEIDIACAGADVLAYASDASRWPEWHPSSLRVDGPAGSLAAGSRFDEDVRAAGRVDRLHWDVVRNEPGVMWQARAANTAGSLRILLTYECSGGPRGARFVRTLHYHSPNPLLRLANALVMRGRVERESAYSLTLLKRRLEAARDA
>NZ_CP016912.1|WP_004196898.1|3124700_3125141_+|SRPBCC-family-protein
MKQQRIEIAEEFDAPVHQVFRFFSEHENLKSIFSPAKIRRISDGEPARNGVGSAREMRVPGAPPFVETVTAYQENELIEYRITRGSPLRDHLGVMRFVPIDERRTYFHYVITFEGKVPFVAPVVRHVLEGSIRRGLGKVATRRLWG
>NZ_CP016912.1|WP_075019179.1|3123650_3123941_+|hypothetical-protein
MRHACRACGPRVRRTRFCAMRKRGKTHGRSLSLSLAHRATDARCARCPHSRHELCTRARAPARERRRCIASRISLITTINFRAVAFRPRLPKHYID
>NZ_CP016912.1|WP_011204694.1|3123447_3123672_-|hypothetical-protein
MHGMRAARYRIRSIGRYPARAADVARTSVLNGVITFRRPFENRGDSESEEAFTMRDNFVTLCDEACDKIKRGDN
>NZ_CP016912.1|WP_024430319.1|3134876_3136142_+|polyhydroxyalkanoate-depolymerase
MLYAWLEAQREFFRACQPWAGAAQRAGAGARPAGWPTWGPMARAADAVPAPPSFAIASIEIDGAAVPVDECVVDDTPFCALRKFSRRLRGDAAARPAVFLCTPLAGHHAVMLRETVETILATRDVYVTDWRNARDVPLEAGAFGLDDYVCTLERFVAGAAGDGLHMMAVCQATVPALAAVALLAARDVHVTSVALLGGPVDTRSHPTLIDRFALEHDLDWFRRTAIDIVPPPYAGAGRRVYPGFIQHAAIIVAHPQRRASLESRYWAAWMTGDFAAAARCLREMNEYGAVLDMTERYFLDTIRVIFHERLLAQGRWSIGRRLVAPRRLTRTALCTIEGGRDDIAGAGQTHAAHALCDAVPDAVRERITEPDCDHYDLFLGPRWRRTIHPALDAFWTRAEAARAAAGEPRPTAERAERRIAH
>NZ_CP016912.1|WP_004545483.1|3136457_3138242_+|ribonucleotide-reductase
MIGDMDDQPICDAVFADRYALPGEHSRAQACARVARALALAEPMATRSGAARRFYRNLLNGAFGAGRIMARAGAAPDQTMASCFVHPIRAPAALTRFHPNLDEALDEARLALAMGADIGYDFSAIPPAGARPDADHPDSPGVCAALDRFDRIGTQAGERDGRRRAQLAVLRCDHPDLLAFAAAKHRHAGRHARWTTLELAVAATDAFMQAVEQDLPWTLRHMAPPRDAPGGALPGADGAWTYASVPARHVWREIVSAARDGAGPGLVFVDAIDAADPLRGRERIDATSPCGAQPLPPYGSAMLGAIDLSRFVRNPFGAGGEPRFDFAAFDTAVRIEVRLLDNALDVTRWPLAAHARESYQKRRIGVGVTGLADMLAMMRLRYDSPAAREMARYIASDLRHHAYAASAELAAERGAYPLCDRHAHLDALRAGPPLPHAVCHAIERDGLRHSHLTSFAPVIGVSLAFGDHCSPGIEPARAWIEHRPVRAGAAGAPGMRAENHAHRLFRSLRGERAALPDYFATDADVAPGERLAMRVALQPYVDAGIDNTLTLANHYSLEEVNALLFAAWRAKLKSVAIRRADLARDAQPSDDDGV
>NZ_CP016912.1|WP_024430320.1|3138316_3140128_+|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein
MTTGAVAARRLPRRGTARGRRAPSRAFTIHGGDEMRRSRQPKPAKPAAVRRRPHGAARAHAIRGNGPQRRAGRERAARRLSRDIDAALRRASTYPHPAGPIVRIETHLSVVYLVGRFAYKRLKPFDFGFANFSELAARRRACEAELALNRPLAAPIYLAAGPLVRRARGLRLFGAGAAVDHVVRMRRFDERMLFSRLLARGALDAADIDAAATRLAAYHLHAPRDIPRRAYGSARELRRQLDDMLAPLERALGAALPASLRAWCVRRCDELAAHLDARRADGYVRACHGDLHLNNVVKRGRDALMFDCIDFDDALRWIDVINDLSFLLMDLHAHDRAALAHRLLNRWLDETGDFAGLAALPLYVAYRALVRALVATMRAGGDAAARAARIERARRYVDVAAHAARARRPCLLLCHGYSGSGKSVASRALADVSGAIRLSSDSERKRARPFAAVDARPLPASAYTPQQIDAQYERLRALARDVLRAGYTALVDATFLSHARRARFFALARELGVPVYVLDFHASRACLERRVDARAAARDDRSDAGAAVLATQRASADPLDADERARTIGFDTDVPLATLRSAGYWRPVLDALDAARVDAQATR
>NZ_CP016912.1|WP_075019181.1|3140144_3140600_+|quinone-oxidoreductase
MRNRCRDTSRQRGPRRPRRRPFARGHLAAPLRSLAHSLSATPRHAMPCRTAPHRTAPQRNATQRNGNGDGDGSDDRTPPPAGSARAARRADSRANRTRSRAHARRAGEIRRSRGPRRHGRRPRERRPNARSTHRPSAVDLGQSAPAGRSID
>NZ_CP016912.1|WP_024430321.1|3140697_3141729_+|hypothetical-protein
METSPLKTTTPEAIPPFDPSASVEDKLRLAIHYAILAPSSHNTQPWRFMVGDGSVMLCADRLRALSVVDPYDRELLISCGAALLNLRVALSRFGFAYVIDMFPSPSDPDVIALVRLDPHGYHDESLVPLFDAILERVTTRTPYANEAVPCDVQRALVDAGAAEGAEIACVDAPHALDEIAELIADADRLQFADPRFRRELANWVHPRRHDDGMPAFAAGVPALLDSATPVVASAIRTFDLGGGLAAMHHKLVDGSPLIVGISTASDDRDAWVAAGQALERVLLVAAAAGLTASYLNQPIEIDALRERLRPLLHVDAHPQLLLRIGRGPVVAHAPRRPLMDVVS
>NZ_CP016912.1|WP_024430322.1|3141725_3143558_+|STAS-domain-containing-protein
MTERERAARGRNDARRGGGDSGGDDEAWRRWLPGIATLRTYRRAWLARDLYAGVALTAVLVPVGMSYAQAAGLPVIAGLNASIAALVGYAIFGPSRILVLGPESALAALIAGAIAPLAHGEPAHAVALAAALALMSGGFCVLAGLLKLGFVTDLLSKPIQYGYLNGLALTLIASQLPSLLGTVPLGGTFVDQVASLAATVAQGRIDFASLALGGGCLAGIALLRRVAPAWPGMLIAVAGASIVAAWLGAAPDAGGAHAHVAYAHVANAHVALVGSLAGTLPPLGLPSISLADASRLIAGALAIAMVSVADISVLSHVFAQHDGSETDRNQELCALGAANLLAGMLRGCAVSSSASRTPVALAAGARTQLTSLVAAACIALLLVAPTLLARVPLAALAAVVVYSANALVDVRAIVRLYRVRRGECAVSVLCFAGVVLLGVVPGILLAVGLSLLSFVWRAWHPYDAVLGRVEGMHGYHDVSRHPGAALTRGLVAFRWDAPLFHANATIFRDHVRDAIAEAGAPVRCVVIAAEPITDVDVTAADMLATLRDELAARRIALVFAEMKGPVKDRLRTYGLFEKIGADHFFPTVTDAIEHFTRMRKDVATARRARR
>NZ_CP016912.1|WP_004187137.1|3144014_3144464_-|CBS-domain-containing-protein
MNAAEICTREVVACRRTDTVLDAAHLMRDRHVGDLIVVDDAGHAHAPVGMLTDRDIVLSLIAKEVDPAALFVGEIMSAPAAVVHEHDSLWTIAQRMRLTGVRRMPVVNADGALVGMVSVDDLLASVAALFDEIASISRRQIHFEEKARD
>NZ_CP016912.1|WP_024430323.1|3144904_3145558_+|SagB/ThcOx-family-dehydrogenase
MSDPELLTYQPIAVALPGPAEAGAPAVIDLPPPDLGAGLPLMSALSLRASTREFSSAALAPTTLGELLWAADGVNRPTTGGRTAPSAHAFNEIDIYAALPDGVYRYDAALHRLLLKHAVDARNLTGYQDFVGAAPLDLIYVVRMSRLLSMPKPLRETFSAVAAGAIAQNVALYCASTGLGCVVRGWINHRLLAEALSLNEDELPILAQTVGKPATHP
>NZ_CP016912.1|WP_004529498.1|3145625_3146060_-|Hsp20/alpha-crystallin-family-protein
MSNVTRYDPFSLEPVSDLFQGLFRPLRGIADADDEKLASMKIDVTENDQAYAVKAELPGVDKNDINVQIDGNTVSISAKVERNKELKEGERVIRRERYSGEFARTFSLANELDRDAASAQYQDGVLSLTLPKKASSEKKKLTIG
>NZ_CP016912.1|WP_051227135.1|3146476_3147604_-|porin
MNAKSIAAAALAVAQAGLAHAQSSVTLYGALDAGVLWQNTSAASFSPTAPNTGAVGRFKDGGVYSSLWGIKGTEDLGGGYRVNFRLQGAFDGGTGKFGLSDAPGAVAAFNQIATLGVSGPFGTFNAGRQIVPMIYAMADTDVRAARFFGSVLTAWLGLNTAAGWPGNSTNAPIGALYDSDALVYQSPAFGGASLALEYAPGGVPGGVQRGARASIVLKYASNALNLAAVYYNGHDTNPAPGASATGLDNNRFVYVGAQYKLKDVAVSASYGNGRNPARGDRVNLDMFAFGLGYRVSPFFRVSSGVYYLKDRNRSANRSTSIVLGADYELSKHTTLYAQGGRVDNRGTMAQMLAYGQPVAPGLATTAAMLGMRHSF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP016912_1	1.2\|779440\|25\|NZ_CP016912\|CRISPRCasFinder	779440-779464	25	NZ_CP016911.1	1281738-1281762	0	1.0
NZ_CP016912_1	1.2\|779440\|25\|NZ_CP016912\|CRISPRCasFinder	779440-779464	25	NZ_CP016911.1	1281745-1281769	0	1.0
NZ_CP016912_1	1.2\|779440\|25\|NZ_CP016912\|CRISPRCasFinder	779440-779464	25	NZ_CP016911.1	1281752-1281776	0	1.0
NZ_CP016912_1	1.2\|779440\|25\|NZ_CP016912\|CRISPRCasFinder	779440-779464	25	NZ_CP016911.1	1281759-1281783	0	1.0
NZ_CP016912_1	1.2\|779440\|25\|NZ_CP016912\|CRISPRCasFinder	779440-779464	25	NZ_CP016911.1	1281766-1281790	0	1.0
NZ_CP016912_1	1.2\|779440\|25\|NZ_CP016912\|CRISPRCasFinder	779440-779464	25	NZ_CP016911.1	1281773-1281797	0	1.0
NZ_CP016912_1	1.2\|779440\|25\|NZ_CP016912\|CRISPRCasFinder	779440-779464	25	NZ_CP016911.1	1281780-1281804	0	1.0
NZ_CP016912_1	1.2\|779440\|25\|NZ_CP016912\|CRISPRCasFinder	779440-779464	25	NZ_CP016911.1	1281787-1281811	0	1.0
NZ_CP016912_1	1.2\|779440\|25\|NZ_CP016912\|CRISPRCasFinder	779440-779464	25	NZ_CP016911.1	1281794-1281818	0	1.0
NZ_CP016912_1	1.2\|779440\|25\|NZ_CP016912\|CRISPRCasFinder	779440-779464	25	NZ_CP016911.1	1281801-1281825	0	1.0
NZ_CP016912_1	1.2\|779440\|25\|NZ_CP016912\|CRISPRCasFinder	779440-779464	25	NZ_CP016911.1	1281808-1281832	0	1.0
NZ_CP016912_1	1.2\|779440\|25\|NZ_CP016912\|CRISPRCasFinder	779440-779464	25	NZ_CP016911.1	1281815-1281839	0	1.0
NZ_CP016912_1	1.2\|779440\|25\|NZ_CP016912\|CRISPRCasFinder	779440-779464	25	NZ_CP016911.1	1281822-1281846	0	1.0
NZ_CP016912_1	1.2\|779440\|25\|NZ_CP016912\|CRISPRCasFinder	779440-779464	25	NZ_CP016911.1	1281829-1281853	0	1.0
NZ_CP016912_1	1.2\|779440\|25\|NZ_CP016912\|CRISPRCasFinder	779440-779464	25	NZ_CP016911.1	1281836-1281860	1	0.96
NZ_CP016912_1	1.2\|779440\|25\|NZ_CP016912\|CRISPRCasFinder	779440-779464	25	NZ_CP016911.1	1281843-1281867	1	0.96
NZ_CP016912_1	1.2\|779440\|25\|NZ_CP016912\|CRISPRCasFinder	779440-779464	25	NZ_CP016911.1	1281850-1281874	1	0.96
NZ_CP016912_1	1.2\|779440\|25\|NZ_CP016912\|CRISPRCasFinder	779440-779464	25	NZ_CP016911.1	1281857-1281881	1	0.96
NZ_CP016912_1	1.2\|779440\|25\|NZ_CP016912\|CRISPRCasFinder	779440-779464	25	NZ_CP016911.1	1281864-1281888	1	0.96
NZ_CP016912_1	1.2\|779440\|25\|NZ_CP016912\|CRISPRCasFinder	779440-779464	25	NZ_CP016911.1	1281878-1281902	1	0.96
NZ_CP016912_1	1.2\|779440\|25\|NZ_CP016912\|CRISPRCasFinder	779440-779464	25	NZ_CP016911.1	1281871-1281895	2	0.92
NZ_CP016912_1	1.2\|779440\|25\|NZ_CP016912\|CRISPRCasFinder	779440-779464	25	NZ_CP016911.1	1281885-1281909	2	0.92

1. spacer 1.2|779440|25|NZ_CP016912|CRISPRCasFinder matches to position: 1281738-1281762, mismatch: 0, identity: 1.0

aaccgctaaccgctaaccgctaacc	CRISPR spacer
aaccgctaaccgctaaccgctaacc	Protospacer
*************************

2. spacer 1.2|779440|25|NZ_CP016912|CRISPRCasFinder matches to position: 1281745-1281769, mismatch: 0, identity: 1.0

aaccgctaaccgctaaccgctaacc	CRISPR spacer
aaccgctaaccgctaaccgctaacc	Protospacer
*************************

3. spacer 1.2|779440|25|NZ_CP016912|CRISPRCasFinder matches to position: 1281752-1281776, mismatch: 0, identity: 1.0

aaccgctaaccgctaaccgctaacc	CRISPR spacer
aaccgctaaccgctaaccgctaacc	Protospacer
*************************

4. spacer 1.2|779440|25|NZ_CP016912|CRISPRCasFinder matches to position: 1281759-1281783, mismatch: 0, identity: 1.0

aaccgctaaccgctaaccgctaacc	CRISPR spacer
aaccgctaaccgctaaccgctaacc	Protospacer
*************************

5. spacer 1.2|779440|25|NZ_CP016912|CRISPRCasFinder matches to position: 1281766-1281790, mismatch: 0, identity: 1.0

aaccgctaaccgctaaccgctaacc	CRISPR spacer
aaccgctaaccgctaaccgctaacc	Protospacer
*************************

6. spacer 1.2|779440|25|NZ_CP016912|CRISPRCasFinder matches to position: 1281773-1281797, mismatch: 0, identity: 1.0

aaccgctaaccgctaaccgctaacc	CRISPR spacer
aaccgctaaccgctaaccgctaacc	Protospacer
*************************

7. spacer 1.2|779440|25|NZ_CP016912|CRISPRCasFinder matches to position: 1281780-1281804, mismatch: 0, identity: 1.0

aaccgctaaccgctaaccgctaacc	CRISPR spacer
aaccgctaaccgctaaccgctaacc	Protospacer
*************************

8. spacer 1.2|779440|25|NZ_CP016912|CRISPRCasFinder matches to position: 1281787-1281811, mismatch: 0, identity: 1.0

aaccgctaaccgctaaccgctaacc	CRISPR spacer
aaccgctaaccgctaaccgctaacc	Protospacer
*************************

9. spacer 1.2|779440|25|NZ_CP016912|CRISPRCasFinder matches to position: 1281794-1281818, mismatch: 0, identity: 1.0

aaccgctaaccgctaaccgctaacc	CRISPR spacer
aaccgctaaccgctaaccgctaacc	Protospacer
*************************

10. spacer 1.2|779440|25|NZ_CP016912|CRISPRCasFinder matches to position: 1281801-1281825, mismatch: 0, identity: 1.0

aaccgctaaccgctaaccgctaacc	CRISPR spacer
aaccgctaaccgctaaccgctaacc	Protospacer
*************************

11. spacer 1.2|779440|25|NZ_CP016912|CRISPRCasFinder matches to position: 1281808-1281832, mismatch: 0, identity: 1.0

aaccgctaaccgctaaccgctaacc	CRISPR spacer
aaccgctaaccgctaaccgctaacc	Protospacer
*************************

12. spacer 1.2|779440|25|NZ_CP016912|CRISPRCasFinder matches to position: 1281815-1281839, mismatch: 0, identity: 1.0

aaccgctaaccgctaaccgctaacc	CRISPR spacer
aaccgctaaccgctaaccgctaacc	Protospacer
*************************

13. spacer 1.2|779440|25|NZ_CP016912|CRISPRCasFinder matches to position: 1281822-1281846, mismatch: 0, identity: 1.0

aaccgctaaccgctaaccgctaacc	CRISPR spacer
aaccgctaaccgctaaccgctaacc	Protospacer
*************************

14. spacer 1.2|779440|25|NZ_CP016912|CRISPRCasFinder matches to position: 1281829-1281853, mismatch: 0, identity: 1.0

aaccgctaaccgctaaccgctaacc	CRISPR spacer
aaccgctaaccgctaaccgctaacc	Protospacer
*************************

15. spacer 1.2|779440|25|NZ_CP016912|CRISPRCasFinder matches to position: 1281836-1281860, mismatch: 1, identity: 0.96

aaccgctaaccgctaaccgctaacc	CRISPR spacer
aaccgctaaccgctaaccactaacc	Protospacer
******************.******

16. spacer 1.2|779440|25|NZ_CP016912|CRISPRCasFinder matches to position: 1281843-1281867, mismatch: 1, identity: 0.96

aaccgctaaccgctaaccgctaacc	CRISPR spacer
aaccgctaaccactaaccgctaacc	Protospacer
***********.*************

17. spacer 1.2|779440|25|NZ_CP016912|CRISPRCasFinder matches to position: 1281850-1281874, mismatch: 1, identity: 0.96

aaccgctaaccgctaaccgctaacc	CRISPR spacer
aaccactaaccgctaaccgctaacc	Protospacer
****.********************

18. spacer 1.2|779440|25|NZ_CP016912|CRISPRCasFinder matches to position: 1281857-1281881, mismatch: 1, identity: 0.96

aaccgctaaccgctaaccgctaacc	CRISPR spacer
aaccgctaaccgctaaccactaacc	Protospacer
******************.******

19. spacer 1.2|779440|25|NZ_CP016912|CRISPRCasFinder matches to position: 1281864-1281888, mismatch: 1, identity: 0.96

aaccgctaaccgctaaccgctaacc	CRISPR spacer
aaccgctaaccactaaccgctaacc	Protospacer
***********.*************

20. spacer 1.2|779440|25|NZ_CP016912|CRISPRCasFinder matches to position: 1281878-1281902, mismatch: 1, identity: 0.96

aaccgctaaccgctaaccgctaacc	CRISPR spacer
aaccgctaaccactaaccgctaacc	Protospacer
***********.*************

21. spacer 1.2|779440|25|NZ_CP016912|CRISPRCasFinder matches to position: 1281871-1281895, mismatch: 2, identity: 0.92

aaccgctaaccgctaaccgctaacc	CRISPR spacer
aaccactaaccgctaaccactaacc	Protospacer
****.*************.******

22. spacer 1.2|779440|25|NZ_CP016912|CRISPRCasFinder matches to position: 1281885-1281909, mismatch: 2, identity: 0.92

aaccgctaaccgctaaccgctaacc	CRISPR spacer
aaccactaaccgctaaccactaacc	Protospacer
****.*************.******

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP016912_1	1.2\|779440\|25\|NZ_CP016912\|CRISPRCasFinder	779440-779464	25	NZ_AP017962	Synechococcus sp. NIES-970 plasmid plasmid3 DNA, complete sequence	35917-35941	5	0.8

1. spacer 1.2|779440|25|NZ_CP016912|CRISPRCasFinder matches to NZ_AP017962 (Synechococcus sp. NIES-970 plasmid plasmid3 DNA, complete sequence) position: , mismatch: 5, identity: 0.8

aaccgctaaccgctaaccgctaacc	CRISPR spacer
taccgctaaccgcttaccgctacta	Protospacer
 ************* ******* .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

87352 : 151902

Ralstonia_phage(28.57%)

holin,transposase,plate

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024430630.1\|87352_89548_+\|holin	phospholipase C, phosphocholine-specific	NA	NA	NA	NA
WP_075019027.1\|89739_89895_+	hypothetical protein	NA	NA	NA	NA
WP_004529608.1\|91444_92461_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_004558008.1\|92479_92932_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_004523728.1\|93393_94311_+	ABC transporter permease	NA	NA	NA	NA
WP_004544882.1\|94297_95152_+	ABC transporter permease	NA	NA	NA	NA
WP_024430632.1\|95148_96180_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_144399218.1\|96822_97942_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5
WP_004528499.1\|98062_98368_+	H-NS histone family protein	NA	NA	NA	NA
WP_075019191.1\|98697_101475_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	2.6e-88	34.3
WP_043289808.1\|101488_103729_+	DUF3274 domain-containing protein	A0A077K801	Ralstonia_phage	4.0e-23	27.7
WP_004523723.1\|103867_105406_+	DUF2875 domain-containing protein	NA	NA	NA	NA
WP_024429211.1\|105415_105679_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_004523721.1\|106093_106513_-	YjbQ family protein	NA	NA	NA	NA
WP_004523720.1\|106532_106859_-	thioredoxin family protein	NA	NA	NA	NA
WP_004531587.1\|107330_108023_+	hypothetical protein	NA	NA	NA	NA
WP_075019193.1\|108608_109232_-	DUF2244 domain-containing protein	NA	NA	NA	NA
WP_004523716.1\|109324_110920_-	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	1.9e-06	33.3
WP_024429213.1\|112068_113526_-	hypothetical protein	NA	NA	NA	NA
WP_153260193.1\|113869_114229_-	hypothetical protein	NA	NA	NA	NA
WP_043276816.1\|115077_117267_+	hypothetical protein	A0A2C9CZG8	Yersinia_phage	5.1e-07	46.1
WP_075019028.1\|117333_118821_-	PhoPQ-regulated protein	NA	NA	NA	NA
WP_004523708.1\|118856_119072_+	hypothetical protein	NA	NA	NA	NA
WP_071897942.1\|119082_119637_-	hypothetical protein	NA	NA	NA	NA
WP_004523706.1\|120222_120768_+	type 1 fimbrial protein	NA	NA	NA	NA
WP_024429217.1\|120832_121570_+	fimbria/pilus periplasmic chaperone	NA	NA	NA	NA
WP_075019194.1\|121793_124427_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_038726065.1\|124419_124992_+	type 1 fimbrial protein	NA	NA	NA	NA
WP_075019195.1\|125056_125713_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_024429220.1\|125715_127392_+	OmpA family protein	NA	NA	NA	NA
WP_004523700.1\|127769_128309_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_004523699.1\|128342_129842_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_004529642.1\|130041_130524_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_004529643.1\|130651_131194_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_024429221.1\|131199_132549_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_004531577.1\|132545_133847_+	type VI secretion system protein TssL	NA	NA	NA	NA
WP_024429222.1\|133861_137770_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_004529647.1\|137959_138529_+	hypothetical protein	NA	NA	NA	NA
WP_038730952.1\|138626_141191_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	8.9e-35	26.0
WP_004523693.1\|141265_141535_+	PAAR motif protein	NA	NA	NA	NA
WP_024429224.1\|141547_145000_+	RHS repeat protein	NA	NA	NA	NA
WP_038725374.1\|144892_146251_-	hypothetical protein	A0A292GJ55	Xanthomonas_phage	7.6e-110	45.2
WP_024429225.1\|146283_147312_-	fimbrial protein	NA	NA	NA	NA
WP_004529651.1\|147366_148437_-	type VI secretion protein ImpA	NA	NA	NA	NA
WP_024429226.1\|148455_149505_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_004523687.1\|149501_151382_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_004523686.1\|151383_151902_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA

DBSCAN-SWA_2

572981 : 577543

Burkholderia_virus(85.71%)

transposase,integrase

attL 562218:562232|attR 593447:593461

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
562218:562232	attL	NA	NA	NA	NA
WP_004542585.1\|572981_574181_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	A4JX31	Burkholderia_virus	1.1e-224	99.5
WP_043276559.1\|574177_574327_-	hypothetical protein	Q8W6Q6	Burkholderia_virus	8.2e-18	98.0
WP_024430860.1\|575428_575695_+	hypothetical protein	Q8W6Q4	Burkholderia_virus	1.1e-41	97.6
WP_024430861.1\|575679_575901_-	hypothetical protein	NA	NA	NA	NA
WP_004557715.1\|575927_576035_-	hypothetical protein	Q6JIH6	Burkholderia_virus	8.2e-12	97.1
WP_021252031.1\|576036_576168_-	hypothetical protein	Q8W6Q2	Burkholderia_virus	2.2e-14	95.3
WP_038726742.1\|576177_576453_-	hypothetical protein	Q8W6Q1	Burkholderia_virus	4.7e-43	98.9
WP_004549731.1\|577005_577275_+	BrnT family toxin	NA	NA	NA	NA
WP_004525420.1\|577258_577543_+	BrnA antitoxin family protein	K4NZP3	Burkholderia_phage	1.4e-10	50.0
593447:593461	attR	NA	NA	NA	NA

DBSCAN-SWA_3

730173 : 801602

Vibrio_phage(33.33%)

holin,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004188389.1\|730173_730941_-\|holin	phosphocholine cytidylyltransferase family protein	NA	NA	NA	NA
WP_004206084.1\|730979_731981_-	HpnL family protein	NA	NA	NA	NA
WP_004525542.1\|731977_732751_-	hypothetical protein	NA	NA	NA	NA
WP_009933059.1\|732747_733437_-	CDP-alcohol phosphatidyltransferase family protein	NA	NA	NA	NA
WP_024430690.1\|733801_735316_+	acetyl-CoA hydrolase/transferase family protein	NA	NA	NA	NA
WP_075019054.1\|735285_735582_-	hypothetical protein	NA	NA	NA	NA
WP_004530037.1\|737025_737964_+	hypothetical protein	NA	NA	NA	NA
WP_004202234.1\|737997_738546_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_004530038.1\|738542_740054_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_004530039.1\|740197_740725_+	hypothetical protein	NA	NA	NA	NA
WP_004190879.1\|740804_741236_+	GPW/gp25 family protein	NA	NA	NA	NA
WP_004196180.1\|741249_743112_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_004190851.1\|743108_744098_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_004525547.1\|744100_746971_+	type VI secretion system ATPase TssH	A0A2I7REQ1	Vibrio_phage	2.4e-60	27.2
WP_004525548.1\|746961_749253_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_038774636.1\|749418_751707_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_004548408.1\|751710_753927_+	DUF2169 domain-containing protein	NA	NA	NA	NA
WP_004202229.1\|753926_754997_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_004525551.1\|754999_755716_+	DUF3540 domain-containing protein	NA	NA	NA	NA
WP_024430144.1\|755758_756148_+	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_004202226.1\|756153_756747_+	hypothetical protein	NA	NA	NA	NA
WP_004525552.1\|756743_758105_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_075019055.1\|758130_759846_+	OmpA family protein	NA	NA	NA	NA
WP_004525554.1\|759842_763346_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_004190863.1\|763404_763764_+	hypothetical protein	NA	NA	NA	NA
WP_004545583.1\|763786_764218_+	hypothetical protein	NA	NA	NA	NA
WP_004530793.1\|764442_764814_+	hypothetical protein	NA	NA	NA	NA
WP_009923697.1\|764911_765085_-	hypothetical protein	NA	NA	NA	NA
WP_004524288.1\|765364_766264_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_004199051.1\|766350_766479_+	hypothetical protein	NA	NA	NA	NA
WP_020850331.1\|766486_767806_+	glycosyltransferase	NA	NA	NA	NA
WP_004524286.1\|767802_769389_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_011205425.1\|769701_770697_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_024430146.1\|770822_771014_+	hypothetical protein	NA	NA	NA	NA
WP_004528656.1\|771010_772594_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_004186853.1\|773332_774586_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_024430154.1\|775099_776365_-	glycoside hydrolase family 32 protein	NA	NA	NA	NA
WP_075019056.1\|776497_778063_-	glycoside hydrolase 68 family protein	NA	NA	NA	NA
WP_004538946.1\|778251_779268_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_004523135.1\|779757_780957_+	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	8.4e-12	27.2
WP_004198247.1\|781134_782160_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_004530801.1\|782592_783867_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	5.3e-105	54.1
WP_004186989.1\|783939_784911_+	membrane dipeptidase	NA	NA	NA	NA
WP_004186987.1\|785061_785595_+	4-vinyl reductase	NA	NA	NA	NA
WP_004186960.1\|785655_787719_+	NADH:flavin oxidoreductase	NA	NA	NA	NA
WP_004186901.1\|787721_789647_+	(Fe-S)-binding protein	NA	NA	NA	NA
WP_004202150.1\|789651_790824_+	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_004530055.1\|790820_791606_+	drug:proton antiporter	NA	NA	NA	NA
WP_144399211.1\|791630_792899_+	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_004530056.1\|792919_794065_+	hybrid-cluster NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_004523141.1\|794174_795038_+	glycine betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004530057.1\|795218_796874_+	APC family permease	NA	NA	NA	NA
WP_004186920.1\|796960_797836_-	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_004523143.1\|797979_798879_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004186939.1\|799014_800568_+\|holin	choline-sulfatase	NA	NA	NA	NA
WP_075019210.1\|800603_801602_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA

DBSCAN-SWA_4

1427534 : 1533773

107

Burkholderia_virus(46.15%)

holin,portal,terminase,tail,capsid,plate,head,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004199327.1\|1427534_1428407_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_004199325.1\|1428617_1429322_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_011205503.1\|1429491_1430538_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_004199295.1\|1431285_1431444_+	lipoprotein	NA	NA	NA	NA
WP_004199294.1\|1431459_1431981_+	sigma-70 family RNA polymerase sigma factor	A0A076YQ50	Rhizobium_phage	5.1e-06	27.1
WP_004542736.1\|1431977_1432802_+	anti-sigma factor	NA	NA	NA	NA
WP_004536762.1\|1432859_1433846_+	YceI family protein	NA	NA	NA	NA
WP_004528277.1\|1433885_1434245_+	lipoprotein	NA	NA	NA	NA
WP_043276786.1\|1434459_1434690_+	hypothetical protein	NA	NA	NA	NA
WP_004524116.1\|1434711_1435221_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_004524117.1\|1435217_1436222_+	FecR family protein	NA	NA	NA	NA
WP_075019228.1\|1436540_1439006_+	TonB-dependent receptor	NA	NA	NA	NA
WP_004548936.1\|1439224_1440205_-	ABC transporter permease	NA	NA	NA	NA
WP_024429157.1\|1440197_1441283_-	ABC transporter permease	NA	NA	NA	NA
WP_024429158.1\|1441279_1443106_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-09	25.2
WP_004551656.1\|1443102_1444152_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_154219343.1\|1444240_1444669_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011205512.1\|1444783_1445524_+	isoprenylcysteine carboxylmethyltransferase family protein	NA	NA	NA	NA
WP_041188241.1\|1445857_1446109_-	hypothetical protein	NA	NA	NA	NA
WP_004202590.1\|1446271_1447531_-	monooxygenase	NA	NA	NA	NA
WP_004524126.1\|1447750_1449214_-	MFS transporter	NA	NA	NA	NA
WP_004198472.1\|1449631_1449880_-	hypothetical protein	NA	NA	NA	NA
WP_071898081.1\|1450326_1450527_-	hypothetical protein	NA	NA	NA	NA
WP_004524130.1\|1450519_1450792_+	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_004184766.1\|1450895_1452290_-	heavy metal sensor histidine kinase IrlS	W8CYF6	Bacillus_phage	1.2e-20	28.9
WP_024429160.1\|1452286_1452976_-	heavy metal response regulator transcription factor IrlR	W8CYM9	Bacillus_phage	4.4e-37	37.3
WP_004532847.1\|1452982_1456216_-	CusA/CzcA family heavy metal efflux RND transporter	NA	NA	NA	NA
WP_004539131.1\|1456260_1457730_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_133961587.1\|1457740_1459099_-	TolC family protein	NA	NA	NA	NA
WP_004524133.1\|1459360_1459645_-	hypothetical protein	NA	NA	NA	NA
WP_004524134.1\|1460043_1460184_-	bacteriophage protein	NA	NA	NA	NA
WP_024429162.1\|1460858_1461347_-	membrane protein	NA	NA	NA	NA
WP_004197880.1\|1461678_1462164_+	YbaK/EbsC family protein	NA	NA	NA	NA
WP_015600260.1\|1462359_1462689_-	helix-turn-helix domain-containing protein	R4JEU7	Burkholderia_phage	1.2e-53	92.7
WP_038760824.1\|1462921_1463074_+	hypothetical protein	R4JMC2	Burkholderia_phage	3.1e-12	70.0
WP_043276762.1\|1463061_1463931_+	DUF550 domain-containing protein	R4JG80	Burkholderia_phage	1.5e-130	86.3
WP_128972238.1\|1463927_1464428_+	hypothetical protein	NA	NA	NA	NA
WP_024429164.1\|1464458_1464644_+	hypothetical protein	A4JWW7	Burkholderia_virus	5.4e-19	86.9
WP_009897093.1\|1464640_1464862_+	hypothetical protein	A4JWW6	Burkholderia_virus	1.6e-38	100.0
WP_038760828.1\|1464865_1465081_+	hypothetical protein	A4JWW5	Burkholderia_virus	3.9e-29	95.8
WP_038760831.1\|1465089_1465227_+	hypothetical protein	A4JWW4	Burkholderia_virus	8.9e-19	93.3
WP_009971784.1\|1465388_1465601_+	hypothetical protein	A4JWW3	Burkholderia_virus	1.1e-34	100.0
WP_044365827.1\|1467153_1467360_+	DNA methyltransferase	A4JWW1	Burkholderia_virus	2.0e-30	94.1
WP_024429166.1\|1467359_1469153_+	replication endonuclease	A4JWW0	Burkholderia_virus	0.0e+00	92.6
WP_004542802.1\|1469168_1469435_+	ogr/Delta-like zinc finger family protein	A4JWV9	Burkholderia_virus	3.5e-43	98.8
WP_024429167.1\|1469431_1469638_+	ogr/Delta-like zinc finger family protein	A4JWV8	Burkholderia_virus	4.9e-29	89.4
WP_051781513.1\|1470024_1471389_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	5.1e-21	38.0
WP_009979045.1\|1471499_1473749_+	glycosyltransferase	NA	NA	NA	NA
WP_080002914.1\|1473675_1474389_+	cellulose biosynthesis protein BcsS	NA	NA	NA	NA
WP_075019229.1\|1474993_1475317_+	type II toxin-antitoxin system RelE/ParE family toxin	A4JWV2	Burkholderia_virus	9.1e-54	97.2
WP_004202809.1\|1475319_1475676_+	putative addiction module antidote protein	A4JWV1	Burkholderia_virus	3.9e-42	100.0
WP_038789201.1\|1475719_1476775_-\|portal	phage portal protein	A4JWQ2	Burkholderia_virus	1.3e-205	99.1
WP_024429661.1\|1476771_1478541_-\|terminase	terminase ATPase subunit family protein	A4JWU9	Burkholderia_virus	0.0e+00	99.5
WP_015985028.1\|1478684_1479494_+\|capsid	GPO family capsid scaffolding protein	A4JWQ0	Burkholderia_virus	1.3e-144	100.0
WP_024429662.1\|1479527_1480541_+\|capsid	phage major capsid protein, P2 family	A4JWP9	Burkholderia_virus	1.8e-188	99.1
WP_004524435.1\|1480537_1481227_+\|terminase	phage terminase endonuclease subunit	K4NX86	Burkholderia_phage	1.6e-116	99.6
WP_024429663.1\|1481326_1481806_+\|head	head completion/stabilization protein	K4NZV5	Burkholderia_phage	7.6e-81	99.4
WP_004524437.1\|1481805_1482057_+	hypothetical protein	K4NXI9	Burkholderia_phage	7.6e-40	100.0
WP_004524438.1\|1482053_1482260_+\|tail	tail protein	K4PAW7	Burkholderia_phage	2.4e-31	100.0
WP_004524439.1\|1482274_1482619_+	membrane protein	K4NZQ3	Burkholderia_phage	2.9e-50	100.0
WP_004524440.1\|1482620_1482893_+\|holin	phage holin family protein	K4NX91	Burkholderia_phage	8.8e-42	100.0
WP_024429664.1\|1482889_1483702_+	DUF3380 domain-containing protein	A4JWZ0	Burkholderia_virus	7.7e-150	99.6
WP_024429665.1\|1483698_1484139_+	hypothetical protein	K4NXJ2	Burkholderia_phage	4.0e-68	97.3
WP_004531054.1\|1484243_1484660_+\|tail	phage tail protein	A4JWT7	Burkholderia_virus	3.3e-72	100.0
WP_024429666.1\|1484656_1485124_+	phage virion morphogenesis protein	K4NZQ8	Burkholderia_phage	8.8e-74	93.5
WP_004553025.1\|1485380_1485527_+	hypothetical protein	NA	NA	NA	NA
WP_024429667.1\|1485523_1486282_-	site-specific DNA-methyltransferase	A4JWT4	Burkholderia_virus	4.5e-136	94.3
WP_024429668.1\|1486455_1487136_+\|plate	phage baseplate assembly protein V	A4JWY4	Burkholderia_virus	3.4e-119	96.5
WP_024429669.1\|1487132_1487495_+\|plate	baseplate assembly protein	K4PAX6	Burkholderia_phage	5.0e-61	99.2
WP_024429670.1\|1487491_1488397_+\|plate	baseplate assembly protein	K4NZR5	Burkholderia_phage	6.7e-163	99.7
WP_043276251.1\|1488389_1488944_+\|tail	phage tail protein I	A4JWT0	Burkholderia_virus	4.2e-99	98.9
WP_075019089.1\|1488945_1491318_+\|tail	phage tail protein	Q45YG3	Burkholderia_virus	0.0e+00	99.2
WP_024429672.1\|1491334_1492006_+\|tail	tail assembly chaperone	A4JWS8	Burkholderia_virus	2.0e-111	96.0
WP_024429673.1\|1492061_1493234_+\|tail	phage tail sheath protein	Q45YG5	Burkholderia_virus	1.3e-222	99.0
WP_004524455.1\|1493249_1493759_+\|tail	phage major tail tube protein	K4NZR9	Burkholderia_phage	4.9e-94	100.0
WP_004531064.1\|1493816_1494161_+\|tail	phage tail assembly protein	K4NXA3	Burkholderia_phage	1.0e-55	100.0
WP_004552648.1\|1494169_1494283_+\|tail	GpE family phage tail protein	A0A089FGX3	Burkholderia_phage	5.4e-14	100.0
WP_075019090.1\|1494279_1497246_+	hypothetical protein	A4JWX4	Burkholderia_virus	0.0e+00	99.7
WP_004524457.1\|1497263_1497689_+\|tail	phage tail protein	K4NXK5	Burkholderia_phage	1.2e-72	100.0
WP_024429675.1\|1497688_1498789_+	phage late control D family protein	K4PAY4	Burkholderia_phage	7.6e-201	98.6
WP_006027238.1\|1498862_1499081_-	hypothetical protein	NA	NA	NA	NA
WP_009909378.1\|1499161_1499482_-	hypothetical protein	NA	NA	NA	NA
WP_004528294.1\|1500490_1501606_-	alanine dehydrogenase	NA	NA	NA	NA
WP_004524142.1\|1502316_1502646_-	H-NS histone family protein	NA	NA	NA	NA
WP_011205535.1\|1502659_1503211_-	hypothetical protein	NA	NA	NA	NA
WP_075019091.1\|1503650_1504487_+	2-keto-4-pentenoate hydratase	NA	NA	NA	NA
WP_024429676.1\|1504854_1505430_+	DUF2760 domain-containing protein	NA	NA	NA	NA
WP_004549047.1\|1505426_1507274_+	Hsp70 family protein	NA	NA	NA	NA
WP_024429677.1\|1507277_1510085_+	hsp70 family protein	A0A2H4UU19	Bodo_saltans_virus	1.0e-07	26.5
WP_024429678.1\|1510379_1511513_-	CapA family protein	S4VS02	Pandoravirus	3.6e-113	55.9
WP_004528305.1\|1512125_1512386_-	hypothetical protein	NA	NA	NA	NA
WP_024429679.1\|1513842_1514466_-	hypothetical protein	NA	NA	NA	NA
WP_024429680.1\|1514517_1517031_-	cation-translocating P-type ATPase	M1HM40	Paramecium_bursaria_Chlorella_virus	3.6e-57	27.9
WP_004528311.1\|1517128_1517608_-	carboxypeptidase regulatory-like domain-containing protein	NA	NA	NA	NA
WP_011205539.1\|1518630_1519440_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_004557575.1\|1519689_1521120_-	thiamine pyridinylase	NA	NA	NA	NA
WP_004547623.1\|1521202_1522003_-	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_024429682.1\|1522230_1522971_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_004528318.1\|1522986_1523976_-	thymidylate synthase	NA	NA	NA	NA
WP_004528319.1\|1523977_1524433_-	hypothetical protein	NA	NA	NA	NA
WP_011205540.1\|1524429_1524993_-	NUDIX hydrolase	A0A0E3JJF3	Streptomyces_phage	1.9e-14	42.9
WP_004531806.1\|1525491_1526286_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_004533011.1\|1526342_1527491_+	DUF971 domain-containing protein	NA	NA	NA	NA
WP_004551671.1\|1527694_1528531_-	EamA family transporter	NA	NA	NA	NA
WP_024429683.1\|1529235_1530726_+	arginine-ornithine antiporter	NA	NA	NA	NA
WP_004532965.1\|1531025_1531634_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_024429684.1\|1531772_1533773_-\|protease	ATP-dependent zinc metalloprotease FtsH	E5EQU5	Bathycoccus_sp._RCC1105_virus	6.4e-105	46.2

DBSCAN-SWA_5

2055926 : 2107652

Bacillus_virus(16.67%)

transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_144399227.1\|2055926_2056544_-\|transposase	transposase	NA	NA	NA	NA
WP_004198523.1\|2056712_2056898_+	hypothetical protein	NA	NA	NA	NA
WP_024430807.1\|2056983_2057883_+	DMT family transporter	NA	NA	NA	NA
WP_004552420.1\|2057860_2057992_-	hypothetical protein	NA	NA	NA	NA
WP_004525360.1\|2058363_2059218_+	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	1.0e-59	47.4
WP_004546897.1\|2060608_2061826_+	UPF0261 family protein	NA	NA	NA	NA
WP_004201924.1\|2061828_2062671_+	phosphoenolpyruvate hydrolase family protein	NA	NA	NA	NA
WP_004184911.1\|2062716_2063157_+	SRPBCC family protein	NA	NA	NA	NA
WP_004200986.1\|2063563_2065126_+	nitrite reductase, copper-containing	NA	NA	NA	NA
WP_004553512.1\|2065150_2065987_+	formylglycine-generating enzyme family protein	NA	NA	NA	NA
WP_004525356.1\|2065983_2066598_+	SCO family protein	NA	NA	NA	NA
WP_075019248.1\|2066859_2067492_+	hypothetical protein	NA	NA	NA	NA
WP_004525351.1\|2067635_2068661_+	N-acetylmuramoyl-L-alanine amidase	A0A076YN96	Rhizobium_phage	2.4e-07	27.1
WP_011205625.1\|2068929_2070189_+	autotransporter strand-loop-strand O-heptosyltransferase	NA	NA	NA	NA
WP_075019114.1\|2070211_2071777_+	intracellular motility protein A	B0FIT1	Escherichia_phage	2.5e-08	37.0
WP_004184741.1\|2071856_2072234_+	hypothetical protein	NA	NA	NA	NA
WP_075019115.1\|2072518_2074375_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_004206312.1\|2074371_2075109_-	response regulator transcription factor	NA	NA	NA	NA
WP_024430804.1\|2075105_2076938_-	histidine kinase	NA	NA	NA	NA
WP_004200975.1\|2077197_2077692_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_004528790.1\|2077715_2079215_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_004525344.1\|2079434_2079944_+	Hcp family type VI secretion system effector	NA	NA	NA	NA
WP_004525343.1\|2079936_2080398_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_004525342.1\|2080434_2082177_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_024430803.1\|2082164_2083187_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_043289839.1\|2083173_2086275_+	type VI secretion system ATPase TssH	A0A223W0B1	Agrobacterium_phage	2.1e-78	29.6
WP_038755508.1\|2086301_2089325_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.2e-22	24.8
WP_024430800.1\|2089350_2091993_+	DUF2169 domain-containing protein	NA	NA	NA	NA
WP_024430799.1\|2092010_2093075_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_024430798.1\|2093071_2093827_+	DUF3540 domain-containing protein	NA	NA	NA	NA
WP_004200966.1\|2093855_2094248_+	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_004200965.1\|2094257_2095055_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_011853440.1\|2095087_2096485_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_004184888.1\|2096481_2097147_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_024430797.1\|2097158_2101100_+	type VI secretion system protein ImpL	NA	NA	NA	NA
WP_075019116.1\|2101679_2103125_+	peptidase	NA	NA	NA	NA
WP_038735265.1\|2103284_2103578_+	hypothetical protein	NA	NA	NA	NA
WP_004528803.1\|2103582_2104215_+	GTP cyclohydrolase I	A0A0P0HSD2	Acinetobacter_phage	9.9e-20	30.6
WP_153260200.1\|2105275_2106130_-	hypothetical protein	NA	NA	NA	NA
WP_009934666.1\|2106100_2106403_+	hypothetical protein	NA	NA	NA	NA
WP_004551886.1\|2106836_2107280_-	hypothetical protein	NA	NA	NA	NA
WP_004557777.1\|2107364_2107652_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_6

2462323 : 2529084

Burkholderia_phage(18.18%)

transposase,portal,tRNA,protease,integrase

attL 2505811:2505826|attR 2530541:2530556

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_144399223.1\|2462323_2463444_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	9.5e-50	40.4
WP_071898247.1\|2463625_2464126_-	hypothetical protein	NA	NA	NA	NA
WP_004540369.1\|2465243_2466665_-	Do family serine endopeptidase	A0A1B1IT49	uncultured_Mediterranean_phage	1.5e-20	28.5
WP_024430676.1\|2467004_2467847_-	hypothetical protein	NA	NA	NA	NA
WP_080251205.1\|2467917_2468697_-	SapC family protein	NA	NA	NA	NA
WP_124518497.1\|2468706_2471037_-	hypothetical protein	NA	NA	NA	NA
WP_144399222.1\|2471161_2487457_-	hypothetical protein	NA	NA	NA	NA
WP_075019142.1\|2487746_2488127_-	H-NS histone family protein	NA	NA	NA	NA
WP_080002865.1\|2490806_2491418_-	MepB family protein	NA	NA	NA	NA
WP_063828370.1\|2495143_2496694_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_004190933.1\|2498048_2500091_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	4.2e-35	32.0
WP_024430707.1\|2500149_2500488_+	hypothetical protein	NA	NA	NA	NA
WP_024430708.1\|2500534_2502409_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.1e-66	36.0
WP_004190948.1\|2502503_2502950_-	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	8.8e-23	48.6
WP_004190342.1\|2503116_2503329_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_024430709.1\|2503408_2504632_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_004557829.1\|2504777_2505818_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.3e-93	53.1
2505811:2505826	attL	NA	NA	NA	NA
WP_004195713.1\|2506216_2507026_-	GTP cyclohydrolase I FolE2	NA	NA	NA	NA
WP_004540286.1\|2507176_2509081_-	1-deoxy-D-xylulose-5-phosphate synthase	NA	NA	NA	NA
WP_004525142.1\|2509164_2510049_-	(2E,6E)-farnesyl diphosphate synthase	NA	NA	NA	NA
WP_004190549.1\|2510045_2510339_-	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_004190814.1\|2510608_2511715_+	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_075019145.1\|2511865_2513329_-\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	1.8e-80	38.1
WP_024429604.1\|2513451_2514321_+	sulfurtransferase	NA	NA	NA	NA
WP_004190499.1\|2514379_2515255_-	dienelactone hydrolase family protein	NA	NA	NA	NA
WP_004204467.1\|2515414_2515636_-	hypothetical protein	NA	NA	NA	NA
WP_009934941.1\|2515708_2515801_-	hypothetical protein	NA	NA	NA	NA
WP_009926480.1\|2515975_2517769_+	membrane protein	NA	NA	NA	NA
WP_004190401.1\|2518004_2519387_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_024429603.1\|2519705_2522477_-	DNA polymerase I	S5M8J1	Bacillus_phage	1.1e-70	30.0
WP_004530319.1\|2522478_2523228_+	TIGR00730 family Rossman fold protein	A0A1D8KUT5	Synechococcus_phage	5.6e-22	37.8
WP_071898251.1\|2523224_2523494_+	hypothetical protein	NA	NA	NA	NA
WP_009969172.1\|2523645_2523930_+	membrane protein	NA	NA	NA	NA
WP_038735303.1\|2524579_2525071_+	DUF523 domain-containing protein	NA	NA	NA	NA
WP_009926491.1\|2525406_2525583_-	hypothetical protein	NA	NA	NA	NA
WP_004203322.1\|2525507_2525771_-	hypothetical protein	NA	NA	NA	NA
WP_009950024.1\|2525769_2525943_+	hypothetical protein	NA	NA	NA	NA
WP_004525133.1\|2525949_2527176_-\|protease	trypsin-like serine protease	NA	NA	NA	NA
WP_124518488.1\|2527292_2527481_+	hypothetical protein	NA	NA	NA	NA
WP_004529037.1\|2527730_2527868_-	hypothetical protein	NA	NA	NA	NA
WP_004557831.1\|2528113_2528401_+\|portal	phage portal protein	K4NZV0	Burkholderia_phage	4.9e-43	93.3
WP_004544833.1\|2528397_2529084_+\|integrase	tyrosine-type recombinase/integrase	E5E3N4	Burkholderia_phage	1.4e-96	83.0
2530541:2530556	attR	NA	NA	NA	NA

DBSCAN-SWA_7

2860630 : 2917698

Ralstonia_phage(22.22%)

transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004529292.1\|2860630_2861359_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	8.4e-23	31.7
WP_004529293.1\|2861562_2862003_-	hypothetical protein	NA	NA	NA	NA
WP_144399411.1\|2862562_2863683_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	6.2e-49	39.5
WP_024429915.1\|2863713_2864088_-	DUF746 domain-containing protein	NA	NA	NA	NA
WP_011205722.1\|2864306_2866076_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_134868702.1\|2866305_2866578_-	hypothetical protein	NA	NA	NA	NA
WP_009941131.1\|2866586_2866916_-	hypothetical protein	NA	NA	NA	NA
WP_024429917.1\|2866922_2876234_-	filamentous hemagglutinin N-terminal domain-containing protein	NA	NA	NA	NA
WP_071811406.1\|2876385_2876583_-	hypothetical protein	NA	NA	NA	NA
WP_004533385.1\|2876583_2876847_-	hypothetical protein	NA	NA	NA	NA
WP_075019266.1\|2877439_2882071_-	type IV secretion protein Rhs	A0A2H4JFP5	uncultured_Caudovirales_phage	8.3e-23	34.9
WP_004524859.1\|2882084_2883353_-	hypothetical protein	NA	NA	NA	NA
WP_024429919.1\|2883368_2885573_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	7.1e-41	27.7
WP_004540568.1\|2887590_2888190_-	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_004524853.1\|2888214_2888625_-	RidA family protein	NA	NA	NA	NA
WP_004530174.1\|2890054_2890402_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	4.7e-40	72.0
WP_043277381.1\|2890398_2890806_-\|transposase	transposase	A0A0P0ZCV4	Stx2-converting_phage	1.7e-09	44.4
WP_043277340.1\|2891253_2893287_-	hypothetical protein	NA	NA	NA	NA
WP_004546333.1\|2893527_2895699_-	alpha-galactosidase	NA	NA	NA	NA
WP_004524829.1\|2895703_2896555_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_004544732.1\|2896555_2897509_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_004524827.1\|2897541_2898783_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_004524825.1\|2898818_2900063_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.1e-22	32.8
WP_075019267.1\|2900105_2902166_-	hypothetical protein	NA	NA	NA	NA
WP_075019167.1\|2902516_2903575_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_004552182.1\|2904969_2905755_+	hypothetical protein	NA	NA	NA	NA
WP_075019268.1\|2906486_2907086_-	DUF746 domain-containing protein	NA	NA	NA	NA
WP_004203275.1\|2908952_2911157_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	9.6e-46	29.9
WP_024429924.1\|2911153_2913820_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	1.0e-78	30.7
WP_024429925.1\|2913798_2915277_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_004553897.1\|2915273_2917145_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_009935240.1\|2917149_2917698_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP016911

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP016911_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016911_1

4021852-4021931

Orphan

Consensus_repeat	Method
ACGGAATGGGCCCCGGCATGATG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP016911_1

>merge|NZ_CP016911|1|4021852-4021931|CRISPRCasFinder
ACGGAATGGGCCCCGGCATGATGGGCGGCGGCTACGGGCGCGGAATGATGGGCGGCTACGGAATGGGGCCCGGCATGATG

>NZ_CP016911|1|1|4021852-4021931|CRISPRCasFinder
ACGGAATGGGCCCCGGCATGATG	GGCGGCGGCTACGGGCGCGGAATGATGGGCGGCT
ACGGAATGGGGCCCGGCATGATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016911.1\|WP_004525842.1\|4017383_4018259_-\|N-carbamoylputrescine-amidase	unknown	unknown	gnl\|CDD\|274553
NZ_CP016911.1\|WP_004200731.1\|4014186_4014669_+\|DUF2778-domain-containing-protein	unknown	unknown	gnl\|CDD\|378506
NZ_CP016911.1\|WP_009969926.1\|4020647_4021616_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP016911.1\|WP_004533530.1\|4030719_4031064_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016911.1\|WP_045597403.1\|4015023_4016085_-\|phage-portal-protein	unknown	unknown	gnl\|CDD\|222860
NZ_CP016911.1\|WP_043276423.1\|4007226_4009869_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|227061
NZ_CP016911.1\|WP_004543103.1\|4023721_4025170_+\|RNA-polymerase-sigma-factor-RpoD/SigA	unknown	unknown	gnl\|CDD\|274108
NZ_CP016911.1\|WP_004524603.1\|4031552_4032113_-\|spermidine-N1-acetyltransferase	unknown	unknown	gnl\|CDD\|237916
NZ_CP016911.1\|WP_024429982.1\|4018269_4019382_-\|class-II-histone-deacetylase	unknown	unknown	gnl\|CDD\|212521
NZ_CP016911.1\|WP_075019024.1\|4025188_4026790_-\|glutamate--cysteine-ligase	unknown	unknown	gnl\|CDD\|235001
NZ_CP016911.1\|WP_004530511.1\|4029951_4030506_-\|YaeQ-family-protein	unknown	unknown	gnl\|CDD\|377782
NZ_CP016911.1\|WP_024429986.1\|4029394_4029811_+\|lactoylglutathione-lyase	unknown	unknown	gnl\|CDD\|319916
NZ_CP016911.1\|WP_004525837.1\|4022909_4023458_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016911.1\|WP_024429983.1\|4019410_4020505_-\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270377
NZ_CP016911.1\|WP_004523107.1\|4014665_4014950_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016911.1\|WP_004545654.1\|4026960_4027902_-\|DNA-3-methyladenine-glycosylase-2-family-protein	unknown	unknown	gnl\|CDD\|223200
NZ_CP016911.1\|WP_076839945.1\|4023473_4023725_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016911.1\|WP_009962344.1\|4009865_4010996_-\|DNA-repair-exonuclease	unknown	unknown	gnl\|CDD\|277319
NZ_CP016911.1\|WP_024429985.1\|4027898_4028993_-\|bifunctional-DNA-binding-transcriptional-regulator/O6-methylguanine-DNA-methyltransferase-Ada	unknown	unknown	gnl\|CDD\|185333
NZ_CP016911.1\|WP_094188789.1\|4012366_4013487_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|372671

Protein	Function_ID	Function_description	E-value
NZ_CP016911.1\|WP_004525842.1\|4017383_4018259_-\|N-carbamoylputrescine-amidase	gnl\|CDD\|274553	TIGR03381, putative_carbon-nitrogen_hydrolase, N-carbamoylputrescine amidase. Members of this family are N-carbamoylputrescine amidase (3.5.1.53). Bacterial genes are designated AguB. The AguAB pathway replaces SpeB for conversion of agmatine to putrescine in two steps rather than one. [Central intermediary metabolism, Polyamine biosynthesis].	0
NZ_CP016911.1\|WP_004543103.1\|4023721_4025170_+\|RNA-polymerase-sigma-factor-RpoD/SigA	gnl\|CDD\|274108	TIGR02393, RNA_polymerase_sigma_factor_RpoD, RNA polymerase sigma factor RpoD, C-terminal domain. This model represents the well-conserved C-terminal region of the major, essential sigma factor of most bacteria. Members of this clade show considerable variability in domain architecture and molecular weight, as well as in nomenclature: RpoD in E. coli and other Proteobacteria, SigA in Bacillus subtilis and many other Gram-positive bacteria, HrdB in Streptomyces, MysA in Mycobacterium smegmatis, etc. [Transcription, Transcription factors].	2.71742e-88
NZ_CP016911.1\|WP_009969926.1\|4020647_4021616_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	7.2189e-71
NZ_CP016911.1\|WP_045597403.1\|4015023_4016085_-\|phage-portal-protein	gnl\|CDD\|222860	PHA02536, Q, portal vertex protein; Provisional.	0
NZ_CP016911.1\|WP_004200731.1\|4014186_4014669_+\|DUF2778-domain-containing-protein	gnl\|CDD\|378506	pfam10908, DUF2778, Protein of unknown function (DUF2778). This is a bacterial family of uncharacterized proteins.	2.57059e-50
NZ_CP016911.1\|WP_043276423.1\|4007226_4009869_-\|AAA-family-ATPase	gnl\|CDD\|227061	COG4717, COG4717, Uncharacterized conserved protein [Function unknown].	3.59581e-14
NZ_CP016911.1\|WP_004524603.1\|4031552_4032113_-\|spermidine-N1-acetyltransferase	gnl\|CDD\|237916	PRK15130, PRK15130, spermidine N1-acetyltransferase; Provisional.	7.47948e-86
NZ_CP016911.1\|WP_024429982.1\|4018269_4019382_-\|class-II-histone-deacetylase	gnl\|CDD\|212521	cd09996, HDAC_classII_1, Histone deacetylases and histone-like deacetylases, classII. This subfamily includes bacterial as well as eukaryotic Class II histone deacetylase (HDAC) and related proteins. Deacetylases of class II are Zn-dependent enzymes that catalyze hydrolysis of N(6)-acetyl-lysine residues of histones (EC 3.5.1.98) and possibly other proteins to yield deacetylated histones/other proteins. Included in this family is a bacterial HDAC-like amidohydrolase (Bordetella/Alcaligenes species FB18817, denoted as FB188 HDAH) shown to be most similar in sequence and function to class II HDAC6 domain 3 or b (HDAC6b). FB188 HDAH is able to remove the acetyl moiety from acetylated histones, and can be inhibited by common HDAC inhibitors such as SAHA (suberoylanilide hydroxamic acid) as well as class II-specific but not class I specific inhibitors.	5.32905e-174
NZ_CP016911.1\|WP_075019024.1\|4025188_4026790_-\|glutamate--cysteine-ligase	gnl\|CDD\|235001	PRK02107, PRK02107, glutamate--cysteine ligase; Provisional.	0
NZ_CP016911.1\|WP_004530511.1\|4029951_4030506_-\|YaeQ-family-protein	gnl\|CDD\|377782	pfam07152, YaeQ, YaeQ protein. This family consists of several hypothetical bacterial proteins of around 180 residues in length which are often known as YaeQ. YaeQ is homologous to RfaH, a specialized transcription elongation protein. YaeQ is known to compensate for loss of RfaH function.	1.52049e-103
NZ_CP016911.1\|WP_024429986.1\|4029394_4029811_+\|lactoylglutathione-lyase	gnl\|CDD\|319916	cd07253, GLOD5, Human glyoxalase domain-containing protein 5 and similar proteins. Uncharacterized subfamily of VOC family contains human glyoxalase domain-containing protein 5 and similar proteins. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	2.8233e-31
NZ_CP016911.1\|WP_024429983.1\|4019410_4020505_-\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.59682e-148
NZ_CP016911.1\|WP_004545654.1\|4026960_4027902_-\|DNA-3-methyladenine-glycosylase-2-family-protein	gnl\|CDD\|223200	COG0122, AlkA, 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase [DNA replication, recombination, and repair].	8.158e-54
NZ_CP016911.1\|WP_009962344.1\|4009865_4010996_-\|DNA-repair-exonuclease	gnl\|CDD\|277319	cd00840, MPP_Mre11_N, Mre11 nuclease, N-terminal metallophosphatase domain. Mre11 (also known as SbcD in Escherichia coli) is a subunit of the MRX protein complex. This complex includes: Mre11, Rad50, and Xrs2/Nbs1, and plays a vital role in several nuclear processes including DNA double-strand break repair, telomere length maintenance, cell cycle checkpoint control, and meiotic recombination, in eukaryotes. During double-strand break repair, the MRX complex is required to hold the two ends of a broken chromosome together. In vitro studies show that Mre11 has 3'-5' exonuclease activity on dsDNA templates and endonuclease activity on dsDNA and ssDNA templates. In addition to the N-terminal phosphatase domain, the eukaryotic MRE11 members of this family have a C-terminal DNA binding domain (not included in this alignment model). MRE11-like proteins are found in prokaryotes and archaea was well as in eukaryotes. Mre11 belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	1.51546e-34
NZ_CP016911.1\|WP_024429985.1\|4027898_4028993_-\|bifunctional-DNA-binding-transcriptional-regulator/O6-methylguanine-DNA-methyltransferase-Ada	gnl\|CDD\|185333	PRK15435, PRK15435, bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada.	1.42215e-121
NZ_CP016911.1\|WP_094188789.1\|4012366_4013487_+\|IS3-family-transposase	gnl\|CDD\|372671	pfam13683, rve_3, Integrase core domain.	2.39121e-34

>NZ_CP016911.1|WP_009969926.1|4020647_4021616_+|LysR-family-transcriptional-regulator
MRRIDLLSALETFVCAVEEGSLSQAARRLAKTPSAVTKAIAGLEATLGVQLLERTTRRLALTESGRLYLATATDVLRRLADGARQLSERDDEPRGLLRVTAAHSFGHAILAPLCAPFAQAFPRVRIELSLSDHYVDIVGEGFDLALRMGNYDLPSQIVKPIGSNRGLLCASPGYLARRGRPTAPADLARHDCVIYRHPTLANTWTFERGGVRARLEPKGPLVTDDYGLALAAALDGAGVLPCPQWSVVDALEAGRLVPLLVDWRFESASFGEDRICAAYPSSRRGSTKIRRLVERVQARLADSEARVARVLGDALCADLARR
>NZ_CP016911.1|WP_024429983.1|4019410_4020505_-|polyamine-ABC-transporter-substrate-binding-protein
MKRIAWLAAVLASLACAAARAAGGNVLNIYNWAEYFAPDTIAGFEKETGIKVRLDVYDSNEALQTKLTTGNSGYDLVFPSNDFLARQIQAGLYRKLDKSRLPNLTNLDPAIVARAAEVDPGNQYSVPYMQGTFGLGLNVAKVKQALGGPLPANTLELIFNPAYAAKLERCGIAFNDAGSEVFPLALRYIGRDPNTTDPRDYEAALDMMKKIRPTIRQFIATPVMNELATGGVCVVTGYSGAVLVAARRAAEAKNGQQIVYSLPSAGAPFWFDSMAIPKGAAHADHALRFIDYILRPDVVAKISNKVMYPNPNRVATPLVDRRLTANPAIYPDAATMRTLWVKRPMPPQAMRMQTRYWTRFKTGY
>NZ_CP016911.1|WP_024429982.1|4018269_4019382_-|class-II-histone-deacetylase
MIPTGLLFDPAFLSHRQGDLVYVVPHGTLNLGEHFDSPLRLAYTKQLLDAVGMTERLTRVAFARATDEQLLRVHRPEYLRQLAEACAVAGEQVVRLGDDAAGSASTEDVARLAAGAACAAVDAVMTGPLRQAYALIRPSGHHAGADFAMGYCYYNNVAIAARHAQAAHGVERVAIVDWDVHHGNGTQQAFYDDPSVLFVSLHEAANFPVDGGEARETGGGAGAGYNVNVPLPSGTGDAGYRHAFDELVLPLVEAFAPQLILVSAGQDANAFDPLGRMRVQRDGFRHMARALRQAAGSACGGRIVMLQEGGYSLPYLPIATLGVLEGLVGWNAPFDDPHQFVQYPLGEGERAAVKAARAALAPYWPTLHRS
>NZ_CP016911.1|WP_004525842.1|4017383_4018259_-|N-carbamoylputrescine-amidase
MRKTTVAVTQMACDWNVDANLSRAERLVRDAAARGAQIVLLQELFETPYFCIDQHPAHLALAQPYEGHPWLMRFASLARELGVVLPVSFFERAGQTQFNSVAIFDADGRALGIYRKTHIPDGPGYTEKYYFTPGDTGFRVWDTAYGRIGVGICWDQWFPECARAMALAGAELLLYPSAIGSEPHDASIDSRAHWHNAQRGHAAANLMPVAASNRVGVERGASGEIVFYGSSFIAGADGEMIVECDRHGEAIATAEFDLDALAYRRRGWGVFRDRRPECYRALSEGAADRVR
>NZ_CP016911.1|WP_045597403.1|4015023_4016085_-|phage-portal-protein
MLERHQFRGNDFEEQAALNPSAGSAAPARAEVFTFDDPTPVMNRAEILDYVECWSNGEWFEPPVSFAGLAKSFRASTHHSSALFFKANVLASTFRPHRWLSRHAFERWALDFLTFGNGYLERRRNMVGGTLRLEPALAKYVWRKADFSGFVYVNGWQDRHEFAPDSVFQLVRPDINQEVYGLPEYLSSLHSAWLNESSTLFRRKYYENGSHAGFILYMTDAAQKQDDVDNMRDALKNAKGPGNFRNVFMYAPGGKKDGIQLIPVSEVAAKDEFFNIKNVTRDDLLAAHRVPPQLLGIVPSNSGGFGTPDTAARVFGRNEIRPLQARFAELNDWLGDEVVRFDDYEIPPAPVAA
>NZ_CP016911.1|WP_004523107.1|4014665_4014950_+|hypothetical-protein
MKTIGRILLALVLTWPLLTGISSLPLLTHWFANGGEGWNALSPVFRALGSDGGEQNEEIFVGILLVISFVLALVLSFALFGLVDRLRHSTDRRA
>NZ_CP016911.1|WP_004200731.1|4014186_4014669_+|DUF2778-domain-containing-protein
MPAECTFVLNRSRLSTLTCPGFGSVPAFSGNGRYINDPGSTAVADKGPLPAGVYYIIDRQSGGHLGWFRDTVMDAALNTYRAEWFALYRIDGQIDDWTIVNGIRRGHFRLHPVGRLGESDGCITLTSRGQFDKLRAFLKAQPTTQVPGTSFRAYGKVTVK
>NZ_CP016911.1|WP_094188789.1|4012366_4013487_+|IS3-family-transposase
MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFGGMEVSEARRLKDLEVENARLKKLLAEAMLDMEALKVVVKGKPLSPQAKREAVLAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVKLAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRHGVMIEREQLALPGAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVNHGISGLYVARALDRAARFRGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNEHWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV
>NZ_CP016911.1|WP_009962344.1|4009865_4010996_-|DNA-repair-exonuclease
MKLLHTADWQIGKRYGQFDPEEAALLAEARFDVVSRIAELANSQGVDLVLVAGDVFDAQGVSDRTVLRLFQLISGFAGPWVMIPGNHDAGLAESVWTRAARLGAIPPNAHVCFRAEPLTLSDPGVVILPAPLTQRHTYEDLTRWFDSVATPVGVPRIGLAHGSVQGILAEDIDATNPIAPERSALARLDYLALGDWHGTKQIGDRTWYSGTPETDRFRNNDSGQVLLVELAAPGAVPTVTPITTGRYRWRYIERELQLASDVCELVQELETFDTNDVVQLKLSGHVDLESHLSMSRAVGQTQARTRSLLVDLSGLRIQPTDDDIRALHADGYLGEVIADLRAQEGDENAELARDALALLAGILDETRATSANGGQQ
>NZ_CP016911.1|WP_043276423.1|4007226_4009869_-|AAA-family-ATPase
MKLSRLRIEQLRKFRQPAEIADLADGINLFVGPNEAGKSTIAAAIRAAFFERHRSSSVEHLRPWGDGAASPLVEIEFTVGGRAARLRKSFLQRKRCELEIDAQRLEGVQAEDHLSELLGFGFAGRGPSGPEHWGIPGLLWIEQGAAQEIDKPVAHAAEHLQRALGASLGEVASSSGDAVLDRVESARNELLTPATGQPRGDYAEVWKRESALAAELENLEGQVATYRGKVDQLATLRREHAKDSAEHPWQALRADERTAQVKLDEVGAVERSLQAVREKVEQTVQRQTLLIANLDTFDQQDRDLAAREKNRDEAQAQVTAAEAAHASTKARNEQAQVSFDVARKLLSLVRQEENRRSQAAHVDELRAQIATAERKLSEAGVEQEALLTARRAAAATELPDEDLKVLRQQAAQVHELEIRRAAAATRLRYVLEPGRELRTGSDVWAGDGEALITEPATLLLPGIGSLEVIPGGSDLAEVARDLRSVAEGQAALLERLGLSSLEAAEARREMHRVHEAEAKMHDATLKVLAPAGVDVLRSELAAMSARLEEGEKRLAQLPARPDDADGFPPVDEAEAAEENARRDLERQSEALNQAHVAAANAQNAFEAAQREVAAARAKLEAPARAERLRKSQADLLEAKAESARYAAEIDTLEEKISAARPNLLLQDIKRWRASAEALERAHDDRRVRIERLEAELQALGAQGLEERRADVARELEQTRRRVAEMQRRANALDYLLEILRRKRAMVTQRLHAPLQRHLNHYVQLLFPQAMLELGEDFVPRLLTRPGAEVGDFHEMSFGAREQMGVISRLAYADLLKEAGRPTLIMLDDALVHSDDGRLAQMKRVLFDAATRHQILLFSCHPEKWRDLGVGARSVEALLGV
>NZ_CP016911.1|WP_004525837.1|4022909_4023458_+|hypothetical-protein
MEEAYARRALLLHLGSVLQILSRLEGAPDNQSIEALLAANGMLADVPLVEYVVQDMTVREFSARALRAFCLWPQLLLEDPLDCAALALPVRKHLFAGNDAGWKAYAATLREVSPGFDTARSYAAEPHEAEFDLADERDAETGDGPVERDDEADDDGRLRERAAASVESATPAGAPVRRESYE
>NZ_CP016911.1|WP_076839945.1|4023473_4023725_+|hypothetical-protein
MPAAATAPNADRSLRFPNLFRRVPHLGTPLAREPSFAIEISRFAARCMSVRLIGVDGRPRRAEGPGPTDSLRHDVPRPDPRLP
>NZ_CP016911.1|WP_004543103.1|4023721_4025170_+|RNA-polymerase-sigma-factor-RpoD/SigA
MKVSARELRYEQGIDRLLELAGARDDTEYADVADEFASAPSSAFAHDLGEPDSLDHQASDESAGAGSFGDKPTRPAHGDTDVDTDWRDDDAPPSGSNDAAPVDTAASTDPLALFVRRMHAVPLLTHAQEIALAAEIEAGREQVLQALAEALDRLDLASLPADPALGRARAALQRARARGDEGARAFARARTAAYAALAAHGWPSAEVDAVRRAMRRLPTSPEKSDAGAQRAFADGEARISAATARMAEANLRLVLSIARKYASRGLDLADLLQEGNLGLLRAIEKFEHRRGFKFSTYATWWIRQAISRAIADRARTIRVPVHVGDEARRVRKAADRIERRSGVSASLAELSEATGLPAERLRAVLTLPREPRSLNAPLGDDDQAEFGDIVEDTSTPSLFDALAHGQMCDVVTSLLKTMSAQEADILRRRFGIGGDEPWSYEQIAARAGVSREQVRRIEKRALQTLRVTAEACNAHDFLDVQP
>NZ_CP016911.1|WP_075019024.1|4025188_4026790_-|glutamate--cysteine-ligase
MTSRQTDLLQQRLAVLSTSPTREQLPDGLRGIEKESLRVTRDGMIAFTPHPRALGSALTHPSLTTDYSEALVELITPAERDAATTLKRLDELHRYVYASLGDEMLWTDSMPGLLPADDEIPIADYGTSNIGRLKTVYRRGLAYRYGRTMQCIAGIHYNYSLSEEVWRRLHAEEGSTAGIVDYQSERYLALIRNFRRTSWLLMYLFGASPALDAGFLRGRAHKLDTFDAATLYRPHATSLRMSDLGYSNTTAQAALQADYNTLSGYLDALSKAVSEPYPPYEAIGTHRDGEWIQINTNVLQIENEFYSTIRPKRVTYSGERPLHALASRGVQYIEVRCLDIDPFEPTGIALDTARFLDAYLLVCALDESAPLTCDAYRESNANFGRVTMEGRKPGLELTRDGAAVPMRAWADEIFAQIEAAGRVLDDIRGDDAHARAIAAQRAKLDDPELTSSARVLRAMRENGQSFLEFARAQSAAHAAYFHGRPLDEAATRDARALAERSLAEQAELEGKNAGSFDAFVAAYRAYTLNRFSV
>NZ_CP016911.1|WP_004545654.1|4026960_4027902_-|DNA-3-methyladenine-glycosylase-2-family-protein
MSAAVEPAAVRPDSVVLELPFKSPYDWPRVLRFFAGRAIPGVEAVGDGAYRRTVDHHGAIGTLTVRKHPRKRCLVALVEGDAARHADAAFAARLSTMFDLQADPAAIGAHLARDAWFAPLVGAAPGLRVPGAWSGFELIVRAIVGQQVSVKAATTIVGRLVERAGERLAPHAPGAIGWRFPEPAALAACDLSRIGMPGKRAAALQGVARAVAAGDVPLEAYASDPAGVRAALLALPGIGPWTVEYVAMRAWRDADAWPATDLVLMQAIVARDPALDRPASQRLRADAWRPWRAYAAMHLWNEIADRAGSARGG
>NZ_CP016911.1|WP_024429985.1|4027898_4028993_-|bifunctional-DNA-binding-transcriptional-regulator/O6-methylguanine-DNA-methyltransferase-Ada
MKQPPYPTDDARWAALVARDVDADGAFCYAVKTTGVFCRPSCASRLPRRENVSFFADTGAARAAGYRPCKRCRPEGLPRELDIVNRACAVLDAHRQDRFTLAQLSDAVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALRDALQSGAAVTRAAVDAGFNSPSRLYESVPRELGMSPSAFRRKGAGLKIDYATADTRLGVVLVAATSKGICKIAFGDAAAPLVDELRTGFANAQIAESPKRIAPFIAQVDAYLNGTRRRFELPLDLAATEFQQRVWDALRRIPYGETRSYTQIAEALGAPRAVRAVASACASNPVALAIPCHRVVQKGGSLAGYRWGLPRKAALLDAEAQRAAGESVESAVDHAA
>NZ_CP016911.1|WP_024429986.1|4029394_4029811_+|lactoylglutathione-lyase
MKFHIHEIDHVVLRAADLAAMTRFYCDVLGCHVEKEQRELGLVQLRAGRSLIDLLAVGAPIDRAGSGAPGKGRNMDHLCLRVEPFDAAALRTHLAAHGARPGDEVRRYGADGYGPSLYLFDPEGNMVELKGPPEAVAP
>NZ_CP016911.1|WP_004530511.1|4029951_4030506_-|YaeQ-family-protein
MALKSTIYKAELQIADMDRHYYADHSLTVARHPSETDERMMVRIAAFALFAHERLEFCKGLSDTDEPDLWQKDLTGAIEVWVDVGQPDERRIAKASGRAGRVNVIAYGGRTSDIWWQGARGKVERLRNVQVTTLADGVAAALGGLAERTMRLQCTIQDGAAWLSSATHDPVAIEWTTLKAREDA
>NZ_CP016911.1|WP_004533530.1|4030719_4031064_-|hypothetical-protein
MKRTGLFLALTGGIVAFSVAQANGDVSLKPQQEIQLTKNAWGCLSKDNLDSVLNHERDGKAQAKQQYFDDYRCLSVPEGQRFRVVSVDKGDVQFVSAENSDQQGLWTDARFIKQ
>NZ_CP016911.1|WP_004524603.1|4031552_4032113_-|spermidine-N1-acetyltransferase
MQIQNEQHTLALRPLERQDLRFVHELNNDAKIMRYWFEEPYETFTELSQLYDQHVHDQRERRFVAFDSDGELVGLVELIELDYIHRRGEFQIIIAPNRQGRGFATRATRLAVEYAFKVLNLRKLYLIVDKSNVAAIRVYEKCGFKHEAELIEEFFGNGQYHNALRMCIFQRDYFAAQPGAELHARE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

187284 : 193045

Burkholderia_virus(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024430280.1\|187284_187602_+	helix-turn-helix transcriptional regulator	A0A088CD40	Shigella_phage	3.7e-15	57.0
WP_038729261.1\|187601_188519_+	hypothetical protein	A4PE40	Ralstonia_virus	1.2e-45	40.2
WP_009922654.1\|188772_189315_+	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	3.3e-48	56.4
WP_009932249.1\|189572_190025_+	VRR-NUC domain-containing protein	Q8W6S1	Burkholderia_virus	2.3e-31	58.8
WP_024430279.1\|190024_191104_+	DUF3396 domain-containing protein	A9YX32	Burkholderia_phage	4.1e-159	98.6
WP_004525721.1\|191260_191509_+	BrnA antitoxin family protein	K4NZP3	Burkholderia_phage	4.0e-41	97.6
WP_011857935.1\|192343_193045_+	chitin-binding protein	A0A0K1Y848	Apis_mellifera_filamentous_virus	4.8e-07	30.4

DBSCAN-SWA_2

410009 : 428807

Leptospira_phage(25.0%)

plate,protease,integrase,transposase

attL 414030:414046|attR 424302:424318

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191998.1\|410009_411473_+\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	8.8e-80	38.6
WP_004521939.1\|411673_412882_-	Do family serine endopeptidase	A0A1B1IRD3	uncultured_Mediterranean_phage	8.5e-12	31.9
WP_004202811.1\|412903_413650_+	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_004204996.1\|413870_414491_+	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
414030:414046	attL	NA	NA	NA	NA
WP_004199894.1\|414491_415874_+	cytochrome bc complex cytochrome b subunit	NA	NA	NA	NA
WP_024430740.1\|415896_416655_+	cytochrome c1	NA	NA	NA	NA
WP_004185176.1\|416747_417359_+	stringent starvation protein A	NA	NA	NA	NA
WP_075018813.1\|417422_417938_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	1.9e-21	51.0
WP_004555439.1\|418597_419602_+	AAA family ATPase	Q677Q6	Lymphocystis_disease_virus	2.6e-14	31.7
WP_122655376.1\|419973_421093_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	9.5e-50	39.9
WP_122659501.1\|423243_423669_-\|integrase	tyrosine-type recombinase/integrase	A5X9F3	Aeromonas_virus	1.6e-26	49.6
WP_123903074.1\|423593_424121_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	S5WIU1	Leptospira_phage	5.1e-30	49.2
WP_111952238.1\|425517_426108_+	hypothetical protein	NA	NA	NA	NA
424302:424318	attR	NA	NA	NA	NA
WP_009922432.1\|426211_426577_-	phage virion morphogenesis protein	K4NZQ8	Burkholderia_phage	1.1e-52	89.3
WP_024430119.1\|426678_427464_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_004521949.1\|427460_428807_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA

DBSCAN-SWA_3

784747 : 793993

Hokovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194034.1\|784747_786700_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	2.7e-148	49.2
WP_004533593.1\|786965_788096_+	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	3.8e-22	27.6
WP_024429805.1\|788129_790139_+	bifunctional anthranilate synthase component I family protein/class IV aminotransferase	S4VT78	Pandoravirus	1.8e-51	34.7
WP_024429806.1\|790321_791137_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	8.8e-37	33.3
WP_004532195.1\|791201_791885_-	deoxynucleoside kinase	A0A249XZR7	Enterococcus_phage	2.0e-05	26.0
WP_009971015.1\|791881_792409_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_024429807.1\|792445_793993_-	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	4.3e-24	31.2

DBSCAN-SWA_4

1135257 : 1144082

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009921653.1\|1135257_1136658_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.9e-79	38.5
WP_009921652.1\|1136689_1137613_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.3e-15	27.1
WP_004190173.1\|1137671_1138664_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	9.1e-28	30.9
WP_004189725.1\|1138735_1139053_+	competence protein ComE	NA	NA	NA	NA
WP_075018847.1\|1139065_1139383_+	hypothetical protein	NA	NA	NA	NA
WP_004532363.1\|1139394_1140297_+	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	1.9e-53	39.9
WP_075018848.1\|1140523_1141846_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_004522362.1\|1141973_1142897_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	2.4e-43	36.2
WP_024429140.1\|1143239_1144082_-	alpha/beta hydrolase	A7XCB7	Tanapox_virus	4.7e-17	26.6

DBSCAN-SWA_5

1408849 : 1502112

106

uncultured_Caudovirales_phage(21.74%)

protease,terminase,portal,tRNA,integrase,tail,plate,head,capsid

attL 1417648:1417666|attR 1475823:1475841

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012730070.1\|1408849_1410376_-\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	2.1e-84	35.8
WP_004199566.1\|1410469_1411574_-	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	2.2e-06	37.1
WP_009973795.1\|1411935_1413630_-	single-stranded-DNA-specific exonuclease RecJ	A0A0K2FM92	Brevibacillus_phage	5.3e-28	27.1
WP_004193226.1\|1413645_1414722_-	hypothetical protein	NA	NA	NA	NA
WP_004532144.1\|1415294_1416548_+	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_038728458.1\|1416567_1417290_+	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	6.2e-34	38.1
WP_004192516.1\|1417294_1418083_+	TatD family hydrolase	NA	NA	NA	NA
1417648:1417666	attL	NA	NA	NA	NA
WP_152614954.1\|1418135_1420664_+	DNA internalization-related competence protein ComEC/Rec2	NA	NA	NA	NA
WP_004524730.1\|1420700_1421528_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_004192790.1\|1421784_1423446_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.9e-150	52.0
WP_004193658.1\|1423442_1424297_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	2.3e-48	40.9
WP_004192585.1\|1424400_1425684_+	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	6.4e-151	62.6
WP_004191789.1\|1425775_1426207_+	cell division protein FtsB	NA	NA	NA	NA
WP_004532146.1\|1426416_1426764_-	hypothetical protein	NA	NA	NA	NA
WP_004191092.1\|1426847_1427798_-	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_024430506.1\|1427836_1428361_-	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_004202011.1\|1428537_1429389_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_024430507.1\|1429544_1430435_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_004202010.1\|1430677_1431517_+	PHP domain-containing protein	NA	NA	NA	NA
WP_004192132.1\|1431581_1432211_+	threonylcarbamoyl-AMP synthase	NA	NA	NA	NA
WP_004192745.1\|1432309_1432975_+\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_004191887.1\|1432983_1434186_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_024430508.1\|1434182_1434797_+	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_004191516.1\|1434841_1435744_+	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_024430509.1\|1435854_1436997_+	outer membrane protein assembly factor BamC	NA	NA	NA	NA
WP_024430510.1\|1437001_1437778_+	MBL fold metallo-hydrolase	U5PVD0	Bacillus_phage	1.9e-09	26.6
WP_004550225.1\|1438018_1438273_-	lipoprotein	NA	NA	NA	NA
WP_075018859.1\|1438504_1439668_-	cupin domain-containing protein	NA	NA	NA	NA
WP_004524740.1\|1439760_1440306_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_004540138.1\|1440285_1441584_-	hypothetical protein	NA	NA	NA	NA
WP_024430512.1\|1441570_1444243_-	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	9.3e-27	24.3
WP_004547867.1\|1444414_1445716_+\|integrase	integrase family protein	C7BGE7	Burkholderia_phage	2.3e-148	58.9
WP_009890227.1\|1445666_1445909_-	AlpA family phage regulatory protein	C7BGF0	Burkholderia_phage	9.3e-19	59.2
WP_024430513.1\|1445917_1446391_-	hypothetical protein	B5TA88	Burkholderia_phage	2.3e-05	71.4
WP_004555250.1\|1446399_1446729_-	hypothetical protein	NA	NA	NA	NA
WP_024430514.1\|1446842_1448159_-	pyridoxal phosphate biosynthetic protein PdxJ	NA	NA	NA	NA
WP_012730459.1\|1448158_1448608_-	hypothetical protein	NA	NA	NA	NA
WP_004534172.1\|1448604_1449210_-	hypothetical protein	NA	NA	NA	NA
WP_004534202.1\|1449206_1449542_-	hypothetical protein	NA	NA	NA	NA
WP_043277225.1\|1449593_1449812_-	hypothetical protein	NA	NA	NA	NA
WP_128972304.1\|1449940_1450396_-	hypothetical protein	NA	NA	NA	NA
WP_009909040.1\|1450343_1450829_-	helix-turn-helix transcriptional regulator	A0A193GYL7	Enterobacter_phage	4.4e-12	41.2
WP_038707945.1\|1450979_1451207_+	hypothetical protein	NA	NA	NA	NA
WP_009927752.1\|1451295_1451823_+	hypothetical protein	C7BGG0	Burkholderia_phage	9.7e-29	46.5
WP_004552751.1\|1451836_1452190_+	hypothetical protein	NA	NA	NA	NA
WP_014917505.1\|1452496_1452967_+	hypothetical protein	NA	NA	NA	NA
WP_004552754.1\|1453086_1455579_+	virulence protein E	A0A2D1GN57	Marinobacter_phage	4.7e-97	41.8
WP_004533678.1\|1455774_1456362_+	hypothetical protein	NA	NA	NA	NA
WP_009935698.1\|1456709_1457084_+	hypothetical protein	NA	NA	NA	NA
WP_024430517.1\|1457450_1458020_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_024430518.1\|1457982_1459968_+\|terminase	phage terminase large subunit family protein	A0A2D1GMT1	Marinobacter_phage	3.0e-179	53.3
WP_004533700.1\|1459978_1460185_+	hypothetical protein	NA	NA	NA	NA
WP_024430519.1\|1460181_1461675_+\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	1.3e-134	51.2
WP_024430520.1\|1461671_1462772_+\|protease	Clp protease ClpP	A0A2H4JDI2	uncultured_Caudovirales_phage	7.9e-49	36.3
WP_004539732.1\|1462798_1463143_+\|head	head decoration protein	NA	NA	NA	NA
WP_080251186.1\|1463177_1464203_+\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	2.2e-109	59.1
WP_004539695.1\|1464206_1464497_+	hypothetical protein	NA	NA	NA	NA
WP_004539763.1\|1464498_1465029_+\|tail	phage tail protein	A0A2H4JBV1	uncultured_Caudovirales_phage	9.2e-11	28.0
WP_024430522.1\|1465018_1465552_+	hypothetical protein	Q9JML9	Wolbachia_phage	1.1e-22	38.8
WP_024430523.1\|1465554_1466235_+\|plate	phage baseplate assembly protein V	A0A1B2LRU5	Wolbachia_phage	9.0e-19	34.4
WP_009964525.1\|1466299_1466506_+	hypothetical protein	NA	NA	NA	NA
WP_009927735.1\|1466502_1466847_+	hypothetical protein	A0A2H4JA09	uncultured_Caudovirales_phage	4.0e-23	50.0
WP_024430524.1\|1466843_1467737_+\|plate	baseplate J protein	A0A1J0I2M3	Salmonella_phage	1.6e-47	39.8
WP_004547894.1\|1467729_1468305_+\|tail	phage tail protein I	Q6QI98	Burkholderia_phage	6.0e-32	47.7
WP_024430525.1\|1468292_1469756_+	hypothetical protein	A4JWL8	Burkholderia_virus	3.6e-214	78.0
WP_004552412.1\|1469771_1470224_+\|tail	tail assembly chaperone	A4JWL9	Burkholderia_virus	1.4e-44	76.8
WP_024430526.1\|1470289_1471459_+\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	6.2e-161	73.2
WP_004533620.1\|1471469_1471973_+\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	1.2e-41	50.0
WP_004533642.1\|1472042_1472345_+\|tail	phage tail assembly protein	V5YST8	Pseudomonas_phage	1.5e-05	37.2
WP_024430527.1\|1472432_1474847_+\|tail	phage tail tape measure protein	A0A2H4JG00	uncultured_Caudovirales_phage	2.3e-69	33.5
WP_009909076.1\|1474855_1475737_+\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	5.0e-30	37.4
WP_004540041.1\|1475711_1475918_+\|tail	phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	4.0e-15	61.2
1475823:1475841	attR	NA	NA	NA	NA
WP_009890233.1\|1475927_1476980_+	phage late control protein	A0A2H4JBF6	uncultured_Caudovirales_phage	9.2e-79	44.8
WP_004533694.1\|1477055_1477250_+	hypothetical protein	NA	NA	NA	NA
WP_024430528.1\|1477242_1477740_+	lysozyme	A4JX20	Burkholderia_virus	1.7e-67	78.2
WP_038731233.1\|1477739_1478285_+	lysozyme	Q8W6S5	Burkholderia_virus	7.1e-83	95.0
WP_025369299.1\|1478427_1479216_+	DNA adenine methylase	Q8W6S4	Burkholderia_virus	1.8e-151	96.9
WP_024430649.1\|1479256_1479967_-	hypothetical protein	A4PE26	Ralstonia_virus	2.6e-37	41.0
WP_051227144.1\|1479978_1480494_-	hypothetical protein	NA	NA	NA	NA
WP_024430648.1\|1480465_1480939_-	hypothetical protein	NA	NA	NA	NA
WP_043277222.1\|1480931_1481435_-	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	3.3e-18	38.7
WP_024430646.1\|1481434_1481860_-	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	4.9e-15	49.4
WP_009890263.1\|1481921_1482203_-	hypothetical protein	NA	NA	NA	NA
WP_009890265.1\|1482202_1482667_-	hypothetical protein	C7BGE3	Burkholderia_phage	9.7e-49	60.4
WP_024430645.1\|1482748_1483318_+	DUF159 family protein	A4JX27	Burkholderia_virus	2.0e-88	82.3
WP_144399193.1\|1483615_1484086_+	hypothetical protein	NA	NA	NA	NA
WP_024430644.1\|1484438_1484900_+	excisionase family DNA-binding protein	K4ICM4	Acidithiobacillus_phage	1.9e-44	61.4
WP_143292436.1\|1485881_1486184_+	hypothetical protein	NA	NA	NA	NA
WP_024430642.1\|1486662_1487802_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_024430641.1\|1487798_1488632_+	hypothetical protein	NA	NA	NA	NA
WP_009954883.1\|1489870_1490086_+	hypothetical protein	NA	NA	NA	NA
WP_009921282.1\|1489989_1490241_-	hypothetical protein	NA	NA	NA	NA
WP_004527347.1\|1490269_1490542_+	hypothetical protein	NA	NA	NA	NA
WP_004191664.1\|1490821_1491625_-	inositol monophosphatase	NA	NA	NA	NA
WP_071893098.1\|1491668_1491920_+	hypothetical protein	NA	NA	NA	NA
WP_004202006.1\|1491916_1492837_+	RNA methyltransferase	NA	NA	NA	NA
WP_004193377.1\|1493027_1493813_+	serine O-acetyltransferase	NA	NA	NA	NA
WP_009921276.1\|1493867_1494080_+	hypothetical protein	NA	NA	NA	NA
WP_004550230.1\|1494148_1494949_-	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_004193779.1\|1494973_1495465_-	peptidyl-prolyl cis-trans isomerase	A0A1V0SCU1	Indivirus	4.2e-10	33.3
WP_011851872.1\|1495545_1496121_-	peptidyl-prolyl cis-trans isomerase	A0A1V0SCU1	Indivirus	5.3e-12	39.3
WP_004191389.1\|1496177_1496843_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_004192752.1\|1497131_1498529_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.8e-42	33.8
WP_004205123.1\|1498576_1499515_+	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_004193249.1\|1499618_1500590_+	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_024430640.1\|1500633_1502112_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA

DBSCAN-SWA_6

1705005 : 1709411

Burkholderia_virus(57.14%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043277238.1\|1705005_1705191_+	hypothetical protein	Q8W6S4	Burkholderia_virus	3.2e-19	87.8
WP_071897863.1\|1705174_1705360_+	hypothetical protein	Q8W6S4	Burkholderia_virus	4.4e-21	85.2
WP_076804729.1\|1705380_1705692_-	hypothetical protein	A4PE26	Ralstonia_virus	4.5e-26	60.2
WP_038763587.1\|1706112_1706715_-	hypothetical protein	NA	NA	NA	NA
WP_024430096.1\|1707056_1707563_-	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	3.0e-19	39.4
WP_024430095.1\|1707559_1707985_-	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	3.8e-15	49.4
WP_009937072.1\|1708265_1708661_-	hypothetical protein	NA	NA	NA	NA
WP_004531416.1\|1708914_1709142_+	hypothetical protein	Q8W6S4	Burkholderia_virus	3.8e-22	75.8
WP_004527234.1\|1709177_1709411_-	hypothetical protein	A4PE26	Ralstonia_virus	4.3e-13	60.6

DBSCAN-SWA_7

2559919 : 2628555

Burkholderia_virus(88.61%)

terminase,portal,integrase,tail,holin,head,capsid

attL 2573460:2573508|attR 2628685:2628733

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024430357.1\|2559919_2560342_+	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	4.9e-15	43.5
WP_024430356.1\|2560338_2560845_+	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	1.1e-18	38.7
WP_024430720.1\|2560837_2561311_+	hypothetical protein	NA	NA	NA	NA
WP_011204999.1\|2561282_2561789_+	hypothetical protein	NA	NA	NA	NA
WP_004534505.1\|2561797_2562511_+	hypothetical protein	A4PE26	Ralstonia_virus	1.5e-32	43.8
WP_122879358.1\|2562531_2562738_-	hypothetical protein	Q8W6S4	Burkholderia_virus	3.7e-16	86.7
WP_038738024.1\|2562885_2563131_+\|integrase	tyrosine-type recombinase/integrase	A4PE72	Ralstonia_virus	1.2e-18	80.0
WP_004521810.1\|2563424_2564255_-	undecaprenyl-diphosphate phosphatase	NA	NA	NA	NA
WP_024430719.1\|2564802_2565711_+	aldose epimerase	NA	NA	NA	NA
WP_004192768.1\|2566007_2566709_+	peptidoglycan DD-metalloendopeptidase family protein	A0A292GJG6	Xanthomonas_phage	9.9e-13	44.8
WP_004531123.1\|2566786_2566960_-	hypothetical protein	NA	NA	NA	NA
WP_075018913.1\|2567022_2568690_+	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	2.3e-68	35.4
WP_004555943.1\|2568954_2569305_+	DUF2288 domain-containing protein	NA	NA	NA	NA
WP_004521813.1\|2569312_2570704_+	MATE family efflux transporter	NA	NA	NA	NA
WP_024430717.1\|2570958_2571150_-	hypothetical protein	NA	NA	NA	NA
WP_011203877.1\|2571224_2571488_+	hypothetical protein	NA	NA	NA	NA
WP_004266561.1\|2571838_2572657_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_004550641.1\|2572808_2573267_-	phosphohistidine phosphatase SixA	NA	NA	NA	NA
2573460:2573508	attL	NA	NA	NA	NA
WP_024430716.1\|2573705_2574377_-	DUF159 family protein	Q8W6R8	Burkholderia_virus	7.5e-135	99.6
WP_011325405.1\|2574462_2575104_+	hypothetical protein	Q8W6R9	Burkholderia_virus	1.2e-118	100.0
WP_004526688.1\|2575236_2576328_-	DUF3396 domain-containing protein	Q8W6S0	Burkholderia_virus	1.5e-212	100.0
WP_004552924.1\|2576355_2577090_-	VRR-NUC domain-containing protein	Q8W6S1	Burkholderia_virus	3.6e-138	100.0
WP_051227149.1\|2577827_2578562_-	hypothetical protein	Q8W6S3	Burkholderia_virus	3.6e-130	99.6
WP_004526686.1\|2578814_2579603_-	DNA adenine methylase	Q8W6S4	Burkholderia_virus	6.9e-156	100.0
WP_004552927.1\|2579745_2580291_-	lysozyme	Q8W6S5	Burkholderia_virus	4.3e-88	100.0
WP_004552928.1\|2580290_2580782_-	lysozyme	Q6JIK8	Burkholderia_virus	7.8e-89	100.0
WP_004552929.1\|2580774_2580987_-\|holin	class II holin gp23	Q8W6S7	Burkholderia_virus	6.6e-29	100.0
WP_004552930.1\|2581029_2581764_-	hypothetical protein	Q8W6S8	Burkholderia_virus	1.2e-146	100.0
WP_004552931.1\|2581763_2582030_-	hypothetical protein	Q8W6S9	Burkholderia_virus	2.5e-49	100.0
WP_024429296.1\|2582074_2585380_-\|tail	phage tail protein	Q6JIL2	Burkholderia_virus	0.0e+00	99.5
WP_024429295.1\|2585376_2585961_-\|tail	tail assembly protein	A4JX15	Burkholderia_virus	2.0e-99	99.5
WP_015984981.1\|2585957_2586710_-	C40 family peptidase	A4JX14	Burkholderia_virus	2.7e-149	100.0
WP_015985005.1\|2586759_2587443_-\|tail	phage minor tail protein L	A4JX13	Burkholderia_virus	1.3e-134	100.0
WP_024429294.1\|2587439_2588828_-\|tail	tail fiber domain-containing protein	A4JX12	Burkholderia_virus	1.6e-272	99.8
WP_004548805.1\|2588836_2589175_-\|tail	phage tail protein	Q8W6T5	Burkholderia_virus	8.0e-61	100.0
WP_024429293.1\|2589171_2593236_-\|tail	phage tail tape measure protein	A4JX10	Burkholderia_virus	0.0e+00	97.6
WP_004526674.1\|2593249_2593534_-	DUF4035 domain-containing protein	Q6JIL9	Burkholderia_virus	6.8e-45	100.0
WP_024429292.1\|2593533_2593998_-\|tail	tail assembly protein	Q6JIM0	Burkholderia_virus	9.6e-81	96.1
WP_024429291.1\|2594024_2594483_-	hypothetical protein	Q8W6T9	Burkholderia_virus	2.8e-64	84.9
WP_004526671.1\|2594544_2594892_-	DUF3168 domain-containing protein	Q6JIM2	Burkholderia_virus	4.5e-59	100.0
WP_024429290.1\|2594888_2595311_-	HK97 gp10 family phage protein	A4JX05	Burkholderia_virus	1.0e-68	99.3
WP_024429289.1\|2595303_2595630_-\|head	phage head closure protein	A4JX04	Burkholderia_virus	1.8e-49	87.0
WP_024429288.1\|2595629_2596196_-	hypothetical protein	A4JX03	Burkholderia_virus	2.8e-74	71.3
WP_024429287.1\|2596202_2596388_-	hypothetical protein	A4JX02	Burkholderia_virus	6.2e-15	62.3
WP_024429286.1\|2596448_2597756_-\|capsid	phage major capsid protein	A4JX01	Burkholderia_virus	2.4e-193	82.1
WP_024429285.1\|2597857_2598826_-	S49 family peptidase	A4JX00	Burkholderia_virus	5.0e-164	97.2
WP_024429284.1\|2598822_2600082_-\|portal	phage portal protein	A4JWZ9	Burkholderia_virus	3.8e-241	99.8
WP_024429283.1\|2600086_2600272_-	hypothetical protein	A4JWZ8	Burkholderia_virus	2.6e-21	98.4
WP_024429282.1\|2600268_2601984_-\|terminase	terminase large subunit	A4JWZ7	Burkholderia_virus	0.0e+00	99.6
WP_004549538.1\|2601987_2602464_-\|terminase	phage terminase small subunit P27 family	A4JWZ6	Burkholderia_virus	2.1e-86	99.4
WP_024429281.1\|2602601_2602958_-	HNH endonuclease	Q6JIE9	Burkholderia_virus	2.2e-53	84.7
WP_038738294.1\|2603046_2603625_-	hypothetical protein	S5FXQ0	Shigella_phage	1.4e-20	40.2
WP_143281104.1\|2603626_2604538_-	hypothetical protein	NA	NA	NA	NA
WP_004525420.1\|2604799_2605084_-	BrnA antitoxin family protein	K4NZP3	Burkholderia_phage	1.4e-10	50.0
WP_004549731.1\|2605067_2605337_-	BrnT family toxin	NA	NA	NA	NA
WP_004548453.1\|2605385_2605829_-	hypothetical protein	NA	NA	NA	NA
WP_024429361.1\|2605825_2606086_-	hypothetical protein	Q8W6N5	Burkholderia_virus	2.0e-35	82.6
WP_038725178.1\|2606061_2606394_-	hypothetical protein	Q6JIF6	Burkholderia_virus	1.8e-57	97.3
WP_038738296.1\|2606423_2606822_-	DUF1364 family protein	Q6JIF7	Burkholderia_virus	1.4e-72	98.5
WP_043289604.1\|2606836_2607184_-	DUF2591 domain-containing protein	F8TVJ2	EBPR_siphovirus	1.1e-09	39.7
WP_143297881.1\|2607180_2607525_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024429363.1\|2607534_2608071_-	DUF1064 domain-containing protein	A4JX56	Burkholderia_virus	6.8e-70	77.1
WP_038738301.1\|2608067_2609060_-	hypothetical protein	A4JX55	Burkholderia_virus	2.9e-175	98.8
WP_004526650.1\|2609213_2609474_-	helix-turn-helix domain-containing protein	Q6JIG2	Burkholderia_virus	4.2e-41	100.0
WP_015967391.1\|2609470_2610292_-	chromosome partitioning protein	Q8W6P2	Burkholderia_virus	8.0e-147	100.0
WP_024429365.1\|2610326_2611289_-	phosphoadenosine phosphosulfate reductase family protein	A9YWY5	Burkholderia_phage	3.5e-170	99.3
WP_024429366.1\|2611726_2612041_+	DUF4145 domain-containing protein	A4JX50	Burkholderia_virus	1.6e-50	98.1
WP_009896483.1\|2612187_2612628_-	hypothetical protein	Q6JIG6	Burkholderia_virus	2.9e-79	100.0
WP_024429367.1\|2612842_2613061_+	hypothetical protein	Q6JIG7	Burkholderia_virus	7.3e-31	97.2
WP_024429368.1\|2613057_2613390_-	hypothetical protein	Q6JIG8	Burkholderia_virus	7.6e-56	97.3
WP_004552953.1\|2613506_2613821_-	transcriptional regulator	Q6JIG9	Burkholderia_virus	3.0e-54	100.0
WP_015973603.1\|2613884_2614286_+	hypothetical protein	Q6JIH0	Burkholderia_virus	1.7e-65	100.0
WP_024429369.1\|2614282_2614546_-	hypothetical protein	Q6JIH1	Burkholderia_virus	7.9e-40	97.7
WP_024429370.1\|2614629_2615919_-	MFS transporter	Q6JIH2	Burkholderia_virus	5.2e-233	99.1
WP_004526641.1\|2616073_2616967_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.3e-170	99.3
WP_004526640.1\|2617468_2617744_+	hypothetical protein	Q6JIH4	Burkholderia_virus	7.2e-44	100.0
WP_015967385.1\|2617753_2617885_+	hypothetical protein	Q8W6Q2	Burkholderia_virus	5.2e-16	100.0
WP_009946436.1\|2617886_2617994_+	hypothetical protein	Q6JIH6	Burkholderia_virus	1.3e-12	100.0
WP_011853575.1\|2618228_2618576_+	hypothetical protein	A4JX37	Burkholderia_virus	1.7e-58	100.0
WP_075018996.1\|2619016_2619715_-	hypothetical protein	Q6JII1	Burkholderia_virus	2.2e-105	96.6
WP_004537646.1\|2619856_2620006_+	bacteriophage protein Gp44	Q8W6Q6	Burkholderia_virus	3.3e-19	100.0
WP_015967381.1\|2620002_2620815_+	prohibitin family protein	Q8W6Q7	Burkholderia_virus	5.1e-146	100.0
WP_024429396.1\|2621088_2621796_+	hypothetical protein	Q8W6Q8	Burkholderia_virus	7.5e-109	90.6
WP_024429397.1\|2621809_2622481_+	hypothetical protein	Q6JII5	Burkholderia_virus	8.3e-118	96.0
WP_080124839.1\|2622741_2622960_+	hypothetical protein	Q6JII7	Burkholderia_virus	1.0e-32	98.6
WP_024429399.1\|2622974_2624558_+	hypothetical protein	Q6JII8	Burkholderia_virus	1.6e-143	64.1
WP_004526632.1\|2624554_2624812_+	hypothetical protein	Q6JIJ0	Burkholderia_virus	1.7e-42	100.0
WP_128972389.1\|2624804_2625047_+	hypothetical protein	Q6JIJ1	Burkholderia_virus	1.2e-39	98.8
WP_004526630.1\|2625036_2625375_+	hypothetical protein	Q6JIJ2	Burkholderia_virus	3.1e-60	100.0
WP_080251143.1\|2625332_2626343_+	phage Gp37/Gp68 family protein	Q6JIJ3	Burkholderia_virus	3.8e-199	99.1
WP_024429401.1\|2626415_2626661_-	hypothetical protein	Q6JIJ4	Burkholderia_virus	1.0e-36	98.8
WP_004552963.1\|2626669_2626879_-	hypothetical protein	Q6JIJ5	Burkholderia_virus	1.8e-34	100.0
WP_004526625.1\|2627230_2627455_+	DUF4224 domain-containing protein	Q6JIJ7	Burkholderia_virus	2.9e-35	100.0
WP_004526624.1\|2627454_2628555_+\|integrase	tyrosine-type recombinase/integrase	Q6JIJ8	Burkholderia_virus	5.4e-215	100.0
2628685:2628733	attR	NA	NA	NA	NA

DBSCAN-SWA_8

2993496 : 3026962

Pseudomonas_phage(20.0%)

protease,terminase,portal,integrase,tail,head,capsid

attL 2987900:2987915|attR 3001623:3001638

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2987900:2987915	attL	NA	NA	NA	NA
WP_024430024.1\|2993496_2994714_+\|integrase	tyrosine-type recombinase/integrase	B7SYF8	Stenotrophomonas_phage	9.6e-88	45.1
WP_144399179.1\|2995002_2996007_+	hypothetical protein	NA	NA	NA	NA
WP_154219364.1\|2996398_2997268_+	hypothetical protein	NA	NA	NA	NA
WP_024430022.1\|2997370_2997631_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_075018923.1\|2997634_2998000_+	hypothetical protein	A0A1B0VRK7	Pseudomonas_phage	8.0e-06	47.9
WP_038769830.1\|2997996_2998302_+	hypothetical protein	NA	NA	NA	NA
WP_009936876.1\|2998291_2998477_+	hypothetical protein	NA	NA	NA	NA
WP_011204959.1\|2998460_2998664_+	hypothetical protein	NA	NA	NA	NA
WP_024430019.1\|2998641_2998866_+	hypothetical protein	NA	NA	NA	NA
WP_024430018.1\|2998862_2999045_+	hypothetical protein	NA	NA	NA	NA
WP_024430017.1\|2999037_2999289_+	hypothetical protein	NA	NA	NA	NA
WP_024430016.1\|2999281_2999560_+	hypothetical protein	Q3HQY6	Burkholderia_phage	3.0e-21	68.4
WP_075018924.1\|2999495_2999789_+	hypothetical protein	NA	NA	NA	NA
WP_024430014.1\|2999785_3000013_+	hypothetical protein	NA	NA	NA	NA
WP_004541756.1\|3000012_3000561_+	hypothetical protein	NA	NA	NA	NA
WP_024430012.1\|3001232_3001535_+	hypothetical protein	NA	NA	NA	NA
WP_075018925.1\|3001531_3001822_+	HNH endonuclease	NA	NA	NA	NA
3001623:3001638	attR	NA	NA	NA	NA
WP_024430011.1\|3001926_3002367_+	hypothetical protein	A0A286S1P9	Klebsiella_phage	3.5e-40	59.7
WP_024430010.1\|3002348_3003869_+\|terminase	phage terminase	B5WZR8	Pseudomonas_phage	3.5e-228	79.0
WP_024430009.1\|3003919_3005815_+\|capsid	phage major capsid protein	S4TNE3	Salmonella_phage	2.3e-133	44.8
WP_020850751.1\|3005827_3006007_+	hypothetical protein	NA	NA	NA	NA
WP_024430008.1\|3006006_3007296_+\|portal	phage portal protein	F8TVA0	EBPR_siphovirus	2.0e-88	45.8
WP_024430007.1\|3007285_3007603_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_071897679.1\|3007748_3008393_-	hypothetical protein	NA	NA	NA	NA
WP_024430006.1\|3008389_3009496_-	DUF262 domain-containing protein	A0A0R6PKN1	Moraxella_phage	4.6e-20	28.4
WP_071897713.1\|3009909_3010314_+	DUF4102 domain-containing protein	Q7M297	Enterobacteria_phage	4.5e-10	48.2
WP_009952729.1\|3010247_3012005_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_004526362.1\|3012029_3012254_-	CDI system lipoprotein BcpO	NA	NA	NA	NA
WP_004526361.1\|3012265_3012505_-	hypothetical protein	NA	NA	NA	NA
WP_071897716.1\|3012627_3022023_-	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	1.7e-35	34.4
WP_004526357.1\|3023692_3024169_-	hypothetical protein	NA	NA	NA	NA
WP_075018926.1\|3024267_3024639_+	hypothetical protein	NA	NA	NA	NA
WP_004200110.1\|3024635_3024860_+	hypothetical protein	NA	NA	NA	NA
WP_004193210.1\|3025188_3026325_+	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_004522511.1\|3026422_3026962_-\|protease	serine protease inhibitor ecotin	NA	NA	NA	NA

DBSCAN-SWA_9

3189201 : 3200173

Agrobacterium_phage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004196461.1\|3189201_3191502_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	5.1e-167	42.1
WP_004194131.1\|3191498_3191813_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	4.4e-13	44.6
WP_004196460.1\|3192345_3192549_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.8e-23	81.8
WP_024429959.1\|3192677_3194294_-	multicopper oxidase family protein	NA	NA	NA	NA
WP_009929279.1\|3194306_3194489_+	hypothetical protein	NA	NA	NA	NA
WP_004189552.1\|3194461_3195721_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	5.2e-12	63.0
WP_004189780.1\|3195987_3196566_+	pseudouridine synthase	NA	NA	NA	NA
WP_071810810.1\|3196829_3197048_+	hypothetical protein	NA	NA	NA	NA
WP_004185496.1\|3197239_3197749_+	DUF192 domain-containing protein	A0A1B1IUW8	uncultured_Mediterranean_phage	5.5e-13	41.2
WP_004197486.1\|3198058_3200173_+	elongation factor G	E4ZFJ7	Streptococcus_phage	5.8e-56	26.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP016912

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP016911

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection