CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP018215	Lactobacillus delbrueckii subsp. lactis strain KCCM 34717 chromosome, complete genome	3 crisprs	DinG,cas3,DEDDh,csa3,cas14k,cas14j,cas2,cas1,cas4,cas7,cas8c,Cas14u_CAS-V,c2c9_V-U4	0	2	22	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP018215_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018215_1

943259-943696

TypeI

Consensus_repeat	Method
ATTTCAATCCACGCATCCCATGCGGGATGCGAC	CRISPRCasFinder
ATTTCAATCCACGCATCCCATGCGGGATGCGAC	CRT
ATTTCAATCCACGCATCCCATGCGGGATGCGAC	PILER-CR

6 spacers

cas2,cas1,cas4,cas7,cas8c,cas3

The CRISPR arrays of NZ_CP018215_1

>merge|NZ_CP018215|1|943259-943696|CRISPRCasFinder,CRT,PILER-CR
ATTTCGATCCACACATCTTATGTGGGATGCGACTTGTTGTAACTCTGTTACTTTTGTACCAGCAAATATTTCAATCCACGCATCCCATGCGGGATGCGACATGGCCCCATGCTCGTTCATGTCCTCTTCTGAGGCATTTCAATCCACGCATCCCATGCGGGATGCGACGAATTGCAGCTTTACGAGCTTCATAGAGTTCTTCCTATTTCAATCCACGCATCCCATGCGGGATGCGACGGTGAGCATAGCGGTACCGATTTCCCATTGCTGATTTCAATCCACGCATCCCATGCGGGATGCGACTCAGCTTGGCCTACTTTTGTATATAGAGTAAGCGTATTTCAATCCACGCATCCCATGCGGGATGCGACCGTGCAACCTTTTAAGTATTCCAACGTTGAGACTATTTCAATCCACGCATCCCATGCGGGATGCGAC

>NZ_CP018215|1|1|943259-943696|CRISPRCasFinder
ATTTCGATCCACACATCTTATGTGGGATGCGAC	TTGTTGTAACTCTGTTACTTTTGTACCAGCAAAT
ATTTCAATCCACGCATCCCATGCGGGATGCGAC	ATGGCCCCATGCTCGTTCATGTCCTCTTCTGAGGC
ATTTCAATCCACGCATCCCATGCGGGATGCGAC	GAATTGCAGCTTTACGAGCTTCATAGAGTTCTTCCT
ATTTCAATCCACGCATCCCATGCGGGATGCGAC	GGTGAGCATAGCGGTACCGATTTCCCATTGCTG
ATTTCAATCCACGCATCCCATGCGGGATGCGAC	TCAGCTTGGCCTACTTTTGTATATAGAGTAAGCGT
ATTTCAATCCACGCATCCCATGCGGGATGCGAC	CGTGCAACCTTTTAAGTATTCCAACGTTGAGACT
ATTTCAATCCACGCATCCCATGCGGGATGCGAC

>NZ_CP018215|1|1|943259-943696|CRT
ATTTCGATCCACACATCTTATGTGGGATGCGAC	TTGTTGTAACTCTGTTACTTTTGTACCAGCAAAT
ATTTCAATCCACGCATCCCATGCGGGATGCGAC	ATGGCCCCATGCTCGTTCATGTCCTCTTCTGAGGC
ATTTCAATCCACGCATCCCATGCGGGATGCGAC	GAATTGCAGCTTTACGAGCTTCATAGAGTTCTTCCT
ATTTCAATCCACGCATCCCATGCGGGATGCGAC	GGTGAGCATAGCGGTACCGATTTCCCATTGCTG
ATTTCAATCCACGCATCCCATGCGGGATGCGAC	TCAGCTTGGCCTACTTTTGTATATAGAGTAAGCGT
ATTTCAATCCACGCATCCCATGCGGGATGCGAC	CGTGCAACCTTTTAAGTATTCCAACGTTGAGACT
ATTTCAATCCACGCATCCCATGCGGGATGCGAC

>NZ_CP018215|1|1|943326-943696|PILER-CR
ATTTCAATCCACGCATCCCATGCGGGATGCGAC	ATGGCCCCATGCTCGTTCATGTCCTCTTCTGAGGC
ATTTCAATCCACGCATCCCATGCGGGATGCGAC	GAATTGCAGCTTTACGAGCTTCATAGAGTTCTTCCT
ATTTCAATCCACGCATCCCATGCGGGATGCGAC	GGTGAGCATAGCGGTACCGATTTCCCATTGCTG
ATTTCAATCCACGCATCCCATGCGGGATGCGAC	TCAGCTTGGCCTACTTTTGTATATAGAGTAAGCGT
ATTTCAATCCACGCATCCCATGCGGGATGCGAC	CGTGCAACCTTTTAAGTATTCCAACGTTGAGACT
ATTTCAATCCACGCATCCCATGCGGGATGCGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018215.1\|WP_003613864.1\|933605_934043_-\|D-tyrosyl-tRNA(Tyr)-deacylase	unknown	unknown	gnl\|CDD\|235383
NZ_CP018215.1\|WP_035165464.1\|943864_944155_-\|CRISPR-associated-endonuclease-Cas2	cas2	cd09725_cas2_CAS-I:CAS-II:CAS-III:CAS-V	gnl\|CDD\|187856
NZ_CP018215.1\|WP_035164808.1\|950871_953304_-\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	COG1203_cas3_CAS-I	gnl\|CDD\|224124
NZ_CP018215.1\|WP_035164818.1\|937480_937987_+\|aminoacyl-tRNA-deacylase	unknown	unknown	gnl\|CDD\|237976
NZ_CP018215.1\|WP_035164812.1\|944168_945200_-\|type-I-C-CRISPR-associated-endonuclease-Cas1	cas1	cd09721_cas1_CAS-I-C	gnl\|CDD\|188360
NZ_CP018215.1\|WP_003617706.1\|941960_943061_-\|thiolase-family-protein	unknown	unknown	gnl\|CDD\|238383
NZ_CP018215.1\|WP_013440320.1\|949092_950271_-\|IS256-like-element-ISLdl2-family-transposase	unknown	unknown	gnl\|CDD\|307151
NZ_CP018215.1\|WP_035162655.1\|940732_941959_-\|hydroxymethylglutaryl-CoA-reductase,-degradative	unknown	unknown	gnl\|CDD\|153082
NZ_CP018215.1\|WP_035164822.1\|932034_933321_-\|histidine--tRNA-ligase	unknown	unknown	gnl\|CDD\|273080
NZ_CP018215.1\|WP_035164813.1\|939565_940729_-\|hydroxymethylglutaryl-CoA-synthase	unknown	unknown	gnl\|CDD\|213655
NZ_CP018215.1\|WP_035162649.1\|936473_937418_-\|50S-ribosomal-protein-L11-methyltransferase	unknown	unknown	gnl\|CDD\|234786
NZ_CP018215.1\|WP_003617688.1\|953351_954611_-\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP018215.1\|WP_003617679.1\|955284_955893_-\|GTP-pyrophosphokinase	unknown	unknown	gnl\|CDD\|225232
NZ_CP018215.1\|WP_003617686.1\|954613_955282_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP018215.1\|WP_035164816.1\|938043_939402_-\|threonine/serine-exporter-family-protein	unknown	unknown	gnl\|CDD\|377697
NZ_CP018215.1\|WP_035164811.1\|945196_945856_-\|CRISPR-associated-protein-Cas4	cas4	cd09637_cas4_CAS-I:CAS-II:CAS-V	gnl\|CDD\|273040
NZ_CP018215.1\|WP_035165463.1\|945860_946715_-\|type-I-C-CRISPR-associated-protein-Cas7/Csd2	cas7	COG3649_cas7_CAS-I-C	gnl\|CDD\|187820
NZ_CP018215.1\|WP_035164809.1\|946734_948609_-\|type-I-C-CRISPR-associated-protein-Cas8c/Csd1	cas8c	pfam09709_cas8c_CAS-I-C	gnl\|CDD\|378245
NZ_CP018215.1\|WP_035164824.1\|930174_932019_-\|aspartate--tRNA-ligase	unknown	unknown	gnl\|CDD\|234775
NZ_CP018215.1\|WP_035164819.1\|934071_936333_-\|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|223394

Protein	Function_ID	Function_description	E-value
NZ_CP018215.1\|WP_003613864.1\|933605_934043_-\|D-tyrosyl-tRNA(Tyr)-deacylase	gnl\|CDD\|235383	PRK05273, PRK05273, D-tyrosyl-tRNA(Tyr) deacylase; Provisional.	5.77324e-87
NZ_CP018215.1\|WP_035165464.1\|943864_944155_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|187856	cd09725, Cas2_I_II_III, CRISPR/Cas system-associated protein Cas2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas2 is present in majority of CRISPR/Cas systems along with Cas1; RNAse specific to U-rich regions; Possesses an RRM/ferredoxin fold.	2.54047e-25
NZ_CP018215.1\|WP_035164808.1\|950871_953304_-\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|224124	COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms].	3.91018e-50
NZ_CP018215.1\|WP_035164818.1\|937480_937987_+\|aminoacyl-tRNA-deacylase	gnl\|CDD\|237976	cd00002, YbaK_deacylase, This CD includes cysteinyl-tRNA(Pro) deacylases from Haemophilus influenzae and Escherichia coli and other related bacterial proteins. These trans-acting, single-domain proteins are homologs of ProX and also the cis-acting prolyl-tRNA synthetase (ProRS) inserted (INS) editing domain. The bacterial amino acid trans-editing enzyme YbaK is a deacylase that hydrolyzes cysteinyl-tRNA(Pro)'s mischarged by prolyl-tRNA synthetase. YbaK also hydrolyzes glycyl-tRNA's, alanyl-tRNA's, seryl-tRNA's, and prolyl-tRNA's. YbaK is homologous to the INS domain of prolyl-tRNA synthetase (ProRS) as well as the trans-editing enzyme ProX of Aeropyrum pernix which hydrolyzes alanyl-tRNA's and glycyl-tRNA's.	2.28201e-65
NZ_CP018215.1\|WP_035164812.1\|944168_945200_-\|type-I-C-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|188360	TIGR03640, cas1_DVULG, CRISPR-associated endonuclease Cas1, subtype I-C/DVULG. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the DVULG subtype of CRISPR/Cas system.	1.21068e-171
NZ_CP018215.1\|WP_003617706.1\|941960_943061_-\|thiolase-family-protein	gnl\|CDD\|238383	cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine. They are found in prokaryotes and eukaryotes (cytosol, microbodies and mitochondria). There are 2 functional different classes: thiolase-I (3-ketoacyl-CoA thiolase) and thiolase-II (acetoacetyl-CoA thiolase). Thiolase-I can cleave longer fatty acid molecules and plays an important role in the beta-oxidative degradation of fatty acids. Thiolase-II has a high substrate specificity. Although it can cleave acetoacyl-CoA, its main function is the synthesis of acetoacyl-CoA from two molecules of acetyl-CoA, which gives it importance in several biosynthetic pathways.	3.2487e-161
NZ_CP018215.1\|WP_013440320.1\|949092_950271_-\|IS256-like-element-ISLdl2-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	4.20336e-101
NZ_CP018215.1\|WP_035162655.1\|940732_941959_-\|hydroxymethylglutaryl-CoA-reductase,-degradative	gnl\|CDD\|153082	cd00644, HMG-CoA_reductase_classII, Class II hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase (HMGR). Hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase (HMGR), class II, prokaryotic enzyme is a homodimer. Class II enzymes are found primarily in prokaryotes and Archaeoglobus fulgidus and are soluble as they lack the membrane region. Enzymes catalyze the synthesis of coenzyme A and mevalonate in isoprenoid synthesis. Bacteria, such as Pseudomonas mevalonii, which rely solely on mevalonate for their carbon source, catalyze the reverse reaction, using an NAD-dependent HMGR to deacetylate mevalonate into 3-hydroxy-3-methylglutaryl-CoA. Human and bacterial HMGR differ in their active site architecture.	0
NZ_CP018215.1\|WP_035164822.1\|932034_933321_-\|histidine--tRNA-ligase	gnl\|CDD\|273080	TIGR00442, hisS, histidyl-tRNA synthetase. This model finds a histidyl-tRNA synthetase in every completed genome. Apparent second copies from Bacillus subtilis, Synechocystis sp., and Aquifex aeolicus are slightly shorter, more closely related to each other than to other hisS proteins, and actually serve as regulatory subunits for an enzyme of histidine biosynthesis. They were excluded from the seed alignment and score much lower than do single copy histidyl-tRNA synthetases of other genomes not included in the seed alignment. These putative second copies of HisS score below the trusted cutoff. The regulatory protein kinase GCN2 of Saccharomyces cerevisiae (YDR283c), and related proteins from other species designated eIF-2 alpha kinase, have a domain closely related to histidyl-tRNA synthetase that may serve to detect and respond to uncharged tRNA(his), an indicator of amino acid starvation; these regulatory proteins are not orthologous and so score below the noise cutoff. [Protein synthesis, tRNA aminoacylation].	0
NZ_CP018215.1\|WP_035164813.1\|939565_940729_-\|hydroxymethylglutaryl-CoA-synthase	gnl\|CDD\|213655	TIGR01835, 3-hydroxy-3-methylglutaryl_CoA_synthase, 3-hydroxy-3-methylglutaryl CoA synthase, prokaryotic clade. This clade of hydroxymethylglutaryl-CoA (HMG-CoA) synthases is found in a limited spectrum of mostly gram-positive bacteria which make isopentenyl pyrophosphate (IPP) via the mevalonate pathway. This pathway is found primarily in eukaryotes and archaea, but the bacterial homologs are distinct, having aparrently diverged after being laterally transferred from an early eukaryote. HMG-CoA synthase is the first step in the pathway and joins acetyl-CoA with acetoacetyl-CoA with the release of one molecule of CoA. The Borellia sequence may have resulted from a separate lateral transfer event.	9.3547e-131
NZ_CP018215.1\|WP_035162649.1\|936473_937418_-\|50S-ribosomal-protein-L11-methyltransferase	gnl\|CDD\|234786	PRK00517, prmA, 50S ribosomal protein L11 methyltransferase.	1.92469e-92
NZ_CP018215.1\|WP_003617688.1\|953351_954611_-\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.00969e-27
NZ_CP018215.1\|WP_003617679.1\|955284_955893_-\|GTP-pyrophosphokinase	gnl\|CDD\|225232	COG2357, COG2357, PpGpp synthetase catalytic domain [General function prediction only].	1.08103e-64
NZ_CP018215.1\|WP_003617686.1\|954613_955282_-\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	3.40873e-66
NZ_CP018215.1\|WP_035164816.1\|938043_939402_-\|threonine/serine-exporter-family-protein	gnl\|CDD\|377697	pfam06738, ThrE, Putative threonine/serine exporter. ThrE is a family of bacterial and Archaeal proteins that catalyze the export of L-threonine from the cell. UniProtKB:Q79VD1 has been characterized as being necessary for this export. The domain exhibits 10 putative TMs and catalyzes the proton-motive-force-dependent efflux of threonine and serine.	2.65304e-64
NZ_CP018215.1\|WP_035164811.1\|945196_945856_-\|CRISPR-associated-protein-Cas4	gnl\|CDD\|273040	TIGR00372, conserved_hypothetical_protein, CRISPR-associated protein Cas4. This model represents a family of proteins associated with CRISPR repeats in a wide set of prokaryotic genomes. This scope of this model has been broadened since it was first built to describe an archaeal subset only. The function of the protein is undefined. Distantly related proteins, excluded from this model, include ORFs from Mycobacteriophage D29 and Sulfolobus islandicus filamentous virus and a region of the Schizosaccharomyces pombe DNA replication helicase Dna2p.	4.23111e-29
NZ_CP018215.1\|WP_035165463.1\|945860_946715_-\|type-I-C-CRISPR-associated-protein-Cas7/Csd2	gnl\|CDD\|187820	cd09689, Cas7_I-C, CRISPR/Cas system-associated RAMP superfamily protein Cas7. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas7 is a RAMP superfamily protein; Subunit of the Cascade complex; also known as Csd2 family.	1.36191e-107
NZ_CP018215.1\|WP_035164809.1\|946734_948609_-\|type-I-C-CRISPR-associated-protein-Cas8c/Csd1	gnl\|CDD\|378245	pfam09709, Cas_Csd1, CRISPR-associated protein (Cas_Csd1). CRISPR loci appear to be mobile elements with a wide host range. This entry represents proteins that tend to be found near CRISPR repeats. The species range, so far, is exclusively bacterial and mesophilic, although CRISPR loci are particularly common among the archaea and thermophilic bacteria. Clusters of short DNA repeats with nonhomologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins.	1.66293e-93
NZ_CP018215.1\|WP_035164824.1\|930174_932019_-\|aspartate--tRNA-ligase	gnl\|CDD\|234775	PRK00476, aspS, aspartyl-tRNA synthetase; Validated.	0
NZ_CP018215.1\|WP_035164819.1\|934071_936333_-\|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	gnl\|CDD\|223394	COG0317, SpoT, Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription].	0

>NZ_CP018215.1|WP_003617706.1|941960_943061_-|thiolase-family-protein
MQDIYIVAAKRTPFGRYHKQLADFSAIDLGQIALHGALKEAGLDAEALDALFMGNVLSAGLGQNIARQIALNAGMRQDSVAVSINEVCGSSLKAARLAEAQMLIGDLGLVAVGGSESMTNAPKEIMFSDGLVDSFSGKSMGITAENVAKRNHISRQDADAFSLSSHQKAVKAQAEGLFADEIIQIEDLKQDENVRPDTSLEALAGLKTSFLEDGTVTAGNASPISDGASMIILATAEKVAEYQLTPLAKLGAYAEVGYDPEFMGYGPYYAIRKLLNETGRQVADYDFFEINEAFAATTLAVVRDLEIPLAKVNKQGGAIALGHPLGASGTRLLATAARQLQRGGQRAIASLCIGGGLAIAFEIEKA
>NZ_CP018215.1|WP_035162655.1|940732_941959_-|hydroxymethylglutaryl-CoA-reductase,-degradative
MKFYQLPPEERRQFLQEDGVALEDIPAADLARLDEMSENVVGEVKFPLSCLTSALVNGKNWRIPMTTEEASVVAAANHGMSVFAKAGGVKATSQRDGIYGQIVLEVTEAFSLADFKNKFPAYIKEANKEFASLIRHGGGLKDLTARQEADLVYLLALVDPAEAMGANKTNAILEFLAQKMLAFPGVEAKLFAILSNYPSQLTTAKVAIPVSLLSKKGDLAEGREVAKKMALLAKIGSSDPYRAVTNNKGIMNGVDAVMLATGNDYRAVEAACHAYAAKSGQYRSLSSWKLEGEKLLGQVTLPLALGVVGGSISSRPDIRQSYAILGKIKAAELAELTASVALANNFAALNAISTKGIQAGHMRLQSRNVVQTLPAAAEEKEAVYQMMISQGKYGETAAKNFLKELRGQ
>NZ_CP018215.1|WP_035164813.1|939565_940729_-|hydroxymethylglutaryl-CoA-synthase
MDIGIDQIGFYTPNKFVDMVDLANARNQDPNKFLIGIGQDRMAVADKTQDAVSMGINATAEYLDQVDLEQLGLLIFATESGIDQSKSASLFVKEALNLPVRIRTFEIKEACFALTASLQVARDYVRAHPHHSAMIIGSDIARYGLATAGEVTQGAGAISMLIKENPAIIALEDGHTSHSENINDFWRPNNLATAVVDGHYSRDVYLDFFKSTFKPFLAEKQLQVSDFAGICYHLPYTKMGYKAHKIAIEGQDDETVKRLSDNFQLSAKYSRQVGNIYTASLYMSVLSLLENGDLEAGDRIGFFSYGSGAMAEFFSGKVVAGYQKRLRPALHARMLKERIRLGVGQYEDIFTEGLENLPENVEFTSDANHGTWYLAGQEGYVRQYKQK
>NZ_CP018215.1|WP_035164816.1|938043_939402_-|threonine/serine-exporter-family-protein
MKTESTEQEYHHHLSHHHHMRVQWEEFFQSDDETKIKEATLIEKGSIISRVGMMMLSCGTGAWRVRDAMDTLARTLDLTCSTDIGLISIVCTYFDVDNQSYSQSLALPTTGVNMAKLNELEKFVRQFEAAGGDFEIKTIRRRLGEIEHMKGRYPLWGSSLAAALACGGFIFLLGGGIPEIICSFIGAGLGQFARGSLAKRRITIAATTAVGVAAACLSYYLAFMLGHLFFNVDMIHMHGYIGAMLFVIPGFPFITSGLDIAKLDMRSGLERMAYAIFIILIATGTGWVMATALQIKPGDLPALHLSKAILTACRLVASFCGVFGFSLMFNSHRRMAAAAGLVGAIANTMRLSLVDFAHFPAPLAAFLAALLAGLLAGYVREKVGYPRIALTVPSIVIMVPGLYMYRGIFLLVLTNVGAGATWMTEALMLVMSLPAGLLTARILTDKKWRRVD
>NZ_CP018215.1|WP_035164818.1|937480_937987_+|aminoacyl-tRNA-deacylase
MSKKKKNKDKLDKTLVEKILDQHKIAYEQHISKISEDHGVAQVGTGKPVLDGHPVYKTLAVNGNKTGPIVGVVPLSGHLDLKKIAKASGNKKCEMIPLKQLEKTTGYVHGANTPIGIYHSKKFPIFLDESVLNEDGIWVSSGEVGRSVMVNPLDLQKLVKATVADLQE
>NZ_CP018215.1|WP_035162649.1|936473_937418_-|50S-ribosomal-protein-L11-methyltransferase
MKLLEIKIESSYDVEDALAYFATEDLKALGTEARRRSDFEQAGWLHDSTVVDMDDIPNLPDELEFIAYFDEETDPEETVKCFKDKLAELAGYGLKTAPGEISVDYVADQDWNTVWQKYYHVINLSRHLAIVPEWEDYQPAFKDQEIIRLDPGLAFGTGNHQTTQLAMLGIERAMVKPLTVADVGTGSGILAIAAHKLGAKSVLATDISDESMTAAKENAALNGIHDIALQKTSLLAGVDGKFDLIVANILAEILLDLIPQLDSHLSEDGQVIFSGIDYLQLPKIEQALAENGFQIDLKMRAGRWIGLAISRKHD
>NZ_CP018215.1|WP_035164819.1|934071_936333_-|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase
MSKYIEMTHEQVMAACKKYMTADQLAFVESAYQFAARAHEGQTRVSGQPYIVHPTQVAGTLANLGLDPDTVAAGFLHDTVEDTSVTNDDIKEEFGADVAFIVDGVTKLNKYEYKSHKEFLAENHRKMLIAMAKDLRVILVKLADRLHNMHTLEHLRPDKQRRIAAETLDIYAPLADRLGIGTIKWELEDMSFHYMNPEAYYKIVSMMDAKRSEREDYIKDAIDYLRGTLDSLGIKYDISGRPKHIYSIYKKMVNKHKDFNEIYDLLAVRVIVPTVKDCYAVLGAVHTKWKPMPGRFKDYIAMPKANGYQSLHTTIIGPGGKPLEIQIRTEEMHKVAEYGVAAHWAYKRGNFQGVDEKDGGALDIGREILELQKDSNNADEFMEAVHSDIFADKVYVFTPKGEVYELPKGSVTLDFAYAIHTQVGDHGIGAKVNDKLVPLDYKLKNGDVVDILTQSNARPSRDWAEMVKTSRAKNKIRRYFRDVDREESLARGKSELVDLLKENGLSAKDFLDKSHIDEVLDHFSFKTDEDMYAAIGFGNMSAVSIYNRLTADLRRQQEEEKQKQFEAQIMSAGQQAAASSVVKKPASQKDDAKSKTKGKKTDSLVRVQGLEDLDMHFAKCCNPVPGDPIVGYVTKGRGVTVHRADCRNVVSADPAAQGRMIDVEWNNIDEGKQASFNANFELFGYNRQKLLGDVINRLNALTKNITNVSASVNEENIAHFYITVEVRNAAQLNDIMAKLRDIPDVYDTKRTDN
>NZ_CP018215.1|WP_003613864.1|933605_934043_-|D-tyrosyl-tRNA(Tyr)-deacylase
MRVVIQRVNHAAVRIDGETVGQIQKGLLLLVGLAEGDGEEQVVKAADKIAKMRIFEDEAGKTNLGIKDVGGQILSVSQFTLLADTKKGNRPSFVHAMRPPKSSQLWEEFNQELVKRGLTVETGEFGADMKVELENDGPFTIVLDL
>NZ_CP018215.1|WP_035164822.1|932034_933321_-|histidine--tRNA-ligase
MRVQRPKGTVDILPETSGQWEKVEQIARDLFKRANYHEIRTPSFENYELFSRSSGETSDVVEKEMYDFEDKGGRHIALRPEGTAGVVRAYVENKIYGPDYVKPFNVYYIAAMYRYERPQAGRQREFHQIGVESFGSDGYLADVETILLGHDLLAELGVKNYELHINTLGDSEVRQAYHDALVDYFTPVKDQLSEDSQRRLGKNPLRILDSKAEEDQQFLPEAPKIRDYLDEESKENFNKILASLDKLGVKYVIDDDLVRGLDYYTGVIFEFMVDDPTLWASPSTVLGGGRYNHLVEEFSGPETPAVGFGIGEERLMLVLSKQNPEMFEDQGIDFFITNIGEGTDIKAVEVARQLRSLGFSAQYDVDQKKLKAQFRKADRVGARYVVTLGAKELAEGKLTVKRLSDGQQFSLEFTDLEDKANLLSKIEK
>NZ_CP018215.1|WP_035164824.1|930174_932019_-|aspartate--tRNA-ligase
MMQMEKRTDYCGNITSQYLDQDVLLYSWVQRVRNLGQLIFIDLRDREGIVQVVVNHDSGQELMDVASSLGQEYVVEVKGHVNERSSKNPDMKTGDVEVIASEITVLNKAKTPPFEIKDDLVASEQTRLKYRYLDLRRPTLQNALIMRAQIMTATNAYLSGEGFINIETPDLGKSTPEGARDYLVPSRVYPGSFYALPQSPQIFKQLLMGAGFDKYYQIARCFRDEDLRGDRQPEFTQIDLETSFMDEEGVQEVTEGLLAKVMKDVKGIDLQLPLPRITWQESMDKYGCDKPDTRYEMLIHDLGNVFAKSGFKVFASALENGGFVRGIAVKGGAKFYSRKKIEAMQDYIKRYHAKGLAWVKYEDGDFSGPVSRFLSEDEKAGLVQEFCLEGGELLLFIADQWKVCCDSLDYLRRQTAKETGIIPKDTYKYLWVVDWPLFEYDEGDERWIAAHHPFTMPDDKGIELLETDPHKAHARSYDIVLNGYELGGGSIRIHKRDIQEKMFKSLGFTKERAYEQFGFLMDALDMGFPPHAGLAIGLDRFAMLLAGKDNIRDVIAFPKNASASEPMMHAPAPVADQQLTDLGIKVAEAAKEGVEKYEASLEAEAAEDVKSHEE
>NZ_CP018215.1|WP_035165464.1|943864_944155_-|CRISPR-associated-endonuclease-Cas2
MMVIVSYDVNTETASGKKRLRNVSKICNDYGQRVQNSVFECLVDSTKLEEMKERLLKVYDEECDSLYFFNVGKKYENKVQSYGCKQVLDLGKPVVF
>NZ_CP018215.1|WP_035164812.1|944168_945200_-|type-I-C-CRISPR-associated-endonuclease-Cas1
MRQLLNTLYVNTPEAYLAADGNNVKVLIDQKCVGEVPLQNFESIVTFGYSGVSPGLMQKCLDQGISISFISKSGYLKGRVVGKPTGNVYLRRIQYRLADTQAASLEISKNFIIGKVYNQRWIVERYIRDHSFQIDADMFKKVSESLKNGIEEIRNAENMDVLRGVEGKLATDYFSIFDQMIINQKEDFFYHGRNRRPPLDRVNALLSLTYTLLGNECASGLIANGLDPYVGFMHVDRPGRESLALDLMEELRGVMADRFVLKLINKKMLHADDFVEKESGAILLKDGARKRVLAEWQNNKVTTIEHPFLKEKIEWGLIPFVQAQLLARYLRGDLDGYPPFLWK
>NZ_CP018215.1|WP_035164811.1|945196_945856_-|CRISPR-associated-protein-Cas4
MAYYEDDFLMISGIQHFVFCRRQWALGHIEDQWEDNYLTLKGDQLHEKADDPFLKESRGSKFIVRAMPIHSVEYGLTGICDIVEFTKDDVNGVPVRGKKEKYLPIPVEYKHGQKKSDHSDELQLLAEAVCLEEMLFCHLEYGYLYYGKTKHRTKVEFTPELRAMLVRTVNEMHQYWDRKYTPKVKPTEKCKSCSLRNICLPSLLKTETVDEYLRRRLDD
>NZ_CP018215.1|WP_035165463.1|945860_946715_-|type-I-C-CRISPR-associated-protein-Cas7/Csd2
MANVLNHRIDFKVVFSVAGANPNGDPLNGNRPRQTSDGYGEVSDVAIKRKLRNRLQEMGEKIFVQSQDRADDGLKSLKARADSVKELKGQKDESKYQEVACQTWFDVRAFGQVFAFDKGSSVGVRGPVSIQTARSITPIMINDMQITKSVNSKDAAGRSSDTMGMKYSIDYAVYQFNGSINVQLAEKTGFTEEDANAIHEALKTLFYNDESSARPAGSMEVLRVYWWEHKNKLGDESPAKIFRTVEIKPNEGVDVVKSTEDIDWGSADSAAKTIQCDKLDIFED
>NZ_CP018215.1|WP_035164809.1|946734_948609_-|type-I-C-CRISPR-associated-protein-Cas8c/Csd1
MSWLSEFVDVYDKNEKNLGITSYRIYHPKSGEESKKAYQMLPVSHIFLNCTLQIDLNADGTFAGAFVVDDPKTIVPATIESSIRSGSGSYLVPLPVDDKLQYLARDYSKWSGDEKYIESHKKYLEQFRAYLSFLKEYPDQYVYRTLQAVYRYVTENDIINDLWTGKIFGENVAKEKVAGNNLFKSTVRFNIRNPENVKKFENRRFFDAWTQYYHQVLQTDTVSGGTDEGIDYITGEENVILTSKHPKGILDNAANAKLISANDTTNFTFKGRFLTADEAVTIGYDSSQKAHAAMKWLLTKQGFKIGDRYYLAWEVNGENTADLSIVSQNPLLALAQKKFAETTEIDTNTNIAENFRKVLIDGANKDDYSLQGSVHLIELESPVNGRFGVVYYQAMSLQQYINKFASWYRKITIDDRQSFFNLKQVCYDIYGDRVDDKRMAATVSQLSHMILGSQIVPWSLLSAIYNRAIRPASFNDDKGWRRVMRTASKLFKAYYDEGEIKTMLNDSYHDRSYSFGRLLAIADIIEEGVLQGSENSEGRVTNAKRYMSSFAQRPLDTWKIIYTNLQPYLRKSKYSFKASKLIDEIFASLDAEDKHLNDPLNGKFLIGYSQQRNDWYQKKKTSNE
>NZ_CP018215.1|WP_013440320.1|949092_950271_-|IS256-like-element-ISLdl2-family-transposase
MTDFNKECLNALLNKEKFDEFMRTQLEEGLDQLLESELTAFLGYDPYAREGWNSGNSRNGSYFRQVKTQFGPIKVQVPRDRKGEFHQHTLPAYGQHTDTLESTVIQLYSHGVTTREISDLIEKMYGSYYSAGTVSNISKQVASQVESYHQRQLSDKFFCVYLDATYIPLRRDTYQREAVYVAVGIKPNGHKEIIDYRIAPVENIEIWGEMISNFKERGLEQVELFLSDGFVGIKDMLKQYYPKSKFQRCLVHVMRNIKGKVRVSDRKEALDDFKQVHKQSSLKEAETVLHAFYDKYDSKYSSMIKNLQKIEEDLLVFYQYPKQIRPSIYSTNMIESINNMIKRKTKPKSEFPTEESLDNFLGVQAIGYNDRNANRTHKGFGQVTDTLESYFD
>NZ_CP018215.1|WP_035164808.1|950871_953304_-|CRISPR-associated-helicase/endonuclease-Cas3
MTYIAHTKENSEEIQTLRDHLWNSKMYAEKYGDILGIPHVTGVAALVHDLGKYRQEFQKYIRHSEKAKKGSVDHSSFGAVFLKEKVKELSQQPEGFSADSLFAEIISNAVFSHHNSLGLKDYLNARLKSPYYERVEKFDIDPEKKIELKQAESLFYQETMAENDFNIYLKTAMREFSQLFKELLKDQDGLLDNLYYVGQFIYSCLLDADRTDTSLFSFGKSATEYQYDEIFEQYYGKLLNSISKFDQSTKINQARSEMSDECDAFADQADGIYRLSIPTGGGKTLASLRYGLKHAIKTKKKHIIYVLPYITIIEQNVEVIRNMLNGNSKNTTNILEFHSNVSNDLTEDDTEVEKTVRLAEDNWDSPIVITTTVQFLNCIYAKSTVNRRRFHNLCDSVIIFDEVQKLPLKTISMFNKLLNFLSNIGKCDIVLCTATQPAFDNLSSGTLLKLAGKPEMISNLSSRIQQFKRVKIIDRTKKDGADHQLTVTEAAEMILEAARAQGSVLAIFNTISATERVFNEIKKGAQDYVYILTTRMCPEHRKKAIEKIKELLAEGKNVICISTALIEAGVDISFSCVFRSLCGLDSIVQSAGRCNRNAEKKYGTVNLILMDQTAEKLNSLQEIKNGKEIVQGMLDGKYKADSFLEDETINYYFQVLYRDADKEYLVSDHGYQVYLADCIDGSKLMQKYVNEYHSGPKTIEGSASETIARNFEVIDEDTVSLIAPYGLGKEIITKLNSREGSRQLKELLKVSQPYLVGVYRTKLKELIDKGAVISLGDEYQKNEIFAIRDDHYDDGIGLVENPTNNNFVSF
>NZ_CP018215.1|WP_003617688.1|953351_954611_-|HAMP-domain-containing-histidine-kinase
MIKKIRRRFIWLATLSLFLVMFFSFSSLIGISLFESNHEADQVLSIIVKNNGRLDEVQAKKRLGDQYNKEGIFKYRYFTAKINTKKQTLTVIDADHIIGYSINSVSSRKKQISMRLSAGQLKGTIQSNGVRFRYLAKKISANKYYICFIDLSPLMQSALLLVRYALIFTFSGILVFVIIMALLADKAIQPIKDAYDKQRRFITNAGHELKTPLAVISANAEMEELLGNDDEWNESTKEQVVRMTGLINQLITLTRMSEPEELVLSKVNFSEITKESADSFKSVLAKDNKKYVVSIDPDLYINAEQHSLLELANILIDNAQKYCDPEGEVMVVLAKSRLNQNAVLTVTNSYKNGAGIDTNRFFERFYREDESHHYDQKQKNGFGIGLSMAQDLVAAFGGKINAGWSDGVMNFTVTFKRVH
>NZ_CP018215.1|WP_003617686.1|954613_955282_-|response-regulator-transcription-factor
MKILLAEDEAQLNRVLTVAMQKSGYDVDSVFNGQEAVDAVKKHPYDVIIMDIMMPVKNGLDAVKEIRATGDKTYIMMLTAKSEIDDRVTGLDVGADDYLTKPFSLKELLARLRSKERRSEDYNSTQELNYDNLKLDLNSQELSSNNSISLSKQETGLMRYFLLNPGKAISTEELFNHVWKNEDESEDVVWVYVSFLRSKLASIGANVQISGEKGGEFCLERA
>NZ_CP018215.1|WP_003617679.1|955284_955893_-|GTP-pyrophosphokinase
MSIYGKYADYLPQILDSVLQQIQGIGQEYSAKHGQKLYEYLKGRVKGEESMTQKCERKGMPLTPESALIENRDAIGLRIVCNFIDDIYTCIDLLKKQDNFKIINEKDYITDAKPNGYRSYHLIMEVVTPFEDVHGNKPGTYYVEIQLRTIAMDTWASLEHEMNYKHDIKNPERISKELKRVADELASCDVSMQTIRQLIKEG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP018215_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018215_2

1514230-1514324

TypeV

Consensus_repeat	Method
AGCCGCGGACTTAGAGCTGGCCT	CRISPRCasFinder

1 spacers

c2c9_V-U4,cas14j

The CRISPR arrays of NZ_CP018215_2

>merge|NZ_CP018215|2|1514230-1514324|CRISPRCasFinder
AGCCGCGGACTTAGAGCTGGCCTGGCTTGAGGAGGATTTTGTCGAACTAACGGCAGAACTGGCCGCGGATTTAGCCGCCGACTTAGAGCTGGCCT

>NZ_CP018215|2|2|1514230-1514324|CRISPRCasFinder
AGCCGCGGACTTAGAGCTGGCCT	GGCTTGAGGAGGATTTTGTCGAACTAACGGCAGAACTGGCCGCGGATTT
AGCCGCCGACTTAGAGCTGGCCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018215.1\|WP_072538267.1\|1509181_1509592_-\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	cas14j	-	gnl\|CDD\|223747
NZ_CP018215.1\|WP_072538202.1\|1510896_1512075_+\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151
NZ_CP018215.1\|WP_003616841.1\|1515958_1516513_+\|cysteine-hydrolase	unknown	unknown	gnl\|CDD\|238245
NZ_CP018215.1\|WP_035160956.1\|1506854_1507475_+\|prolyl-oligopeptidase-family-serine-peptidase	unknown	unknown	gnl\|CDD\|224423
NZ_CP018215.1\|WP_035164542.1\|1518094_1518571_-\|large-conductance-mechanosensitive-channel-protein-MscL	unknown	unknown	gnl\|CDD\|376605
NZ_CP018215.1\|WP_072538269.1\|1512112_1512295_-\|ComC/BlpC-family-leader-containing-pheromone/bacteriocin	unknown	unknown	gnl\|CDD\|368018
NZ_CP018215.1\|WP_035164546.1\|1506052_1506853_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|130314
NZ_CP018215.1\|WP_003616826.1\|1522942_1524337_+\|amino-acid-permease	unknown	unknown	gnl\|CDD\|236904
NZ_CP018215.1\|WP_072538268.1\|1509651_1510479_-\|helix-turn-helix-domain-containing-protein	c2c9_V-U4	-	gnl\|CDD\|378838
NZ_CP018215.1\|WP_002876643.1\|1519603_1520611_-\|asparaginase	unknown	unknown	gnl\|CDD\|199207
NZ_CP018215.1\|WP_035160955.1\|1508624_1508912_-\|bacteriocin-immunity-protein	unknown	unknown	gnl\|CDD\|370205
NZ_CP018215.1\|WP_035160948.1\|1521932_1522865_-\|homocysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|181899
NZ_CP018215.1\|WP_035164536.1\|1521415_1521877_-\|YbaK/EbsC-family-protein	unknown	unknown	gnl\|CDD\|239825
NZ_CP018215.1\|WP_035160953.1\|1513337_1513604_+\|DUF1294-domain-containing-protein	unknown	unknown	gnl\|CDD\|377743
NZ_CP018215.1\|WP_035164396.1\|1514699_1515749_-\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP018215.1\|WP_035164538.1\|1520607_1521054_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP018215.1\|WP_003616859.1\|1505345_1506056_+\|metal-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224046
NZ_CP018215.1\|WP_003616851.1\|1512470_1513241_+\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|223979
NZ_CP018215.1\|WP_035164541.1\|1518656_1519487_-\|Cof-type-HAD-IIB-family-hydrolase	unknown	unknown	gnl\|CDD\|369792
NZ_CP018215.1\|WP_035164544.1\|1516581_1518015_+\|nicotinate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|236426

Protein	Function_ID	Function_description	E-value
NZ_CP018215.1\|WP_072538267.1\|1509181_1509592_-\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.46201e-10
NZ_CP018215.1\|WP_072538202.1\|1510896_1512075_+\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	2.95337e-100
NZ_CP018215.1\|WP_003616841.1\|1515958_1516513_+\|cysteine-hydrolase	gnl\|CDD\|238245	cd00431, cysteine_hydrolases, Cysteine hydrolases; This family contains amidohydrolases, like CSHase (N-carbamoylsarcosine amidohydrolase), involved in creatine metabolism and nicotinamidase, converting nicotinamide to nicotinic acid and ammonia in the pyridine nucleotide cycle. It also contains isochorismatase, an enzyme that catalyzes the conversion of isochorismate to 2,3-dihydroxybenzoate and pyruvate, via the hydrolysis of the vinyl ether bond, and other related enzymes with unknown function.	3.79494e-45
NZ_CP018215.1\|WP_035160956.1\|1506854_1507475_+\|prolyl-oligopeptidase-family-serine-peptidase	gnl\|CDD\|224423	COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism].	1.24348e-06
NZ_CP018215.1\|WP_035164542.1\|1518094_1518571_-\|large-conductance-mechanosensitive-channel-protein-MscL	gnl\|CDD\|376605	pfam01741, MscL, Large-conductance mechanosensitive channel, MscL.	2.26723e-47
NZ_CP018215.1\|WP_072538269.1\|1512112_1512295_-\|ComC/BlpC-family-leader-containing-pheromone/bacteriocin	gnl\|CDD\|368018	pfam04604, L_biotic_typeA, Type-A lantibiotic. Lantibiotics are antibiotic peptides distinguished by the presence of the rare thioether amino acids lanthionine and/or methyl-lanthionine. They are produced by Gram-positive bacteria as gene-encoded precursor peptides and undergo post-translational modification to generate the mature peptide. Based on their structural and functional features lantibiotics are currently divided into two major groups: the flexible amphiphilic type-A and the rather rigid and globular type-B. Type-A lantibiotics act primarily by pore formation in the bacterial membrane by a mechanism involving the interaction with specific docking molecules such as the membrane precursor lipid II.	0.00534304
NZ_CP018215.1\|WP_035164546.1\|1506052_1506853_+\|ABC-transporter-permease	gnl\|CDD\|130314	TIGR01247, drrB, daunorubicin resistance ABC transporter membrane protein. This model describes daunorubicin resistance ABC transporter, membrane associated protein in bacteria and archaea. The protein associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc. [Transport and binding proteins, Other].	1.06522e-06
NZ_CP018215.1\|WP_003616826.1\|1522942_1524337_+\|amino-acid-permease	gnl\|CDD\|236904	PRK11387, PRK11387, S-methylmethionine permease.	0
NZ_CP018215.1\|WP_072538268.1\|1509651_1510479_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|378838	pfam12323, HTH_OrfB_IS605, Helix-turn-helix domain. This is the N terminal helix-turn-helix domain of Transposase_2 pfam01385.	0.00010122
NZ_CP018215.1\|WP_002876643.1\|1519603_1520611_-\|asparaginase	gnl\|CDD\|199207	cd08963, L-asparaginase_I, Type I (cytosolic) bacterial L-asparaginase. Asparaginases (amidohydrolases, E.C. 3.5.1.1) are enzymes that catalyze the hydrolysis of asparagine to aspartic acid and ammonia. In bacteria, there are two classes of amidohydrolases. This model represents type I L-asparaginases, which are highly specific for asparagine and localized in the cytosol. Type I L-asparaginase acts as a dimer. A conserved threonine residue is thought to supply the nucleophile hydroxy-group that attacks the amide bond. Many bacterial L-asparaginases have both L-asparagine and L-glutamine hydrolysis activities, to a different degree, and some of them are annotated as asparaginase/glutaminase. One example of an enzyme with no L-glutaminase activity is the type I L-asparaginase from Wolinella succinogenes.	2.75499e-136
NZ_CP018215.1\|WP_035160955.1\|1508624_1508912_-\|bacteriocin-immunity-protein	gnl\|CDD\|370205	pfam08951, EntA_Immun, Enterocin A Immunity. Gram-positive lactobacilli produce bacteriocins to kill closely-related competitor species. To protect themselves from the bacteriocidal activity of this molecule they co-express an immunity protein (for discussion of this operon see Bacteriocin_IIc pfam10439). The immunity protein structure is a soluble, cytoplasmic, antiparallel four alpha-helical globular bundle with a fifth, more flexible and more divergent C-terminal helical hair-pin. The C-terminal hair-pin recognizes the C-terminus of the producer bacteriocin and this interaction is sufficient to dis-orient the bacteriocin within the membrane and close up the permeabilising pore that on its own the bacteriocin creates. These immunity proteins interact in the same way with other bacteriocins, family Bacteriocin_II, pfam01721. Since many enterococci can produce more than one bacteriocin it seems likely that the whole operon can be carried on transferable plasmids.	6.33059e-06
NZ_CP018215.1\|WP_035160948.1\|1521932_1522865_-\|homocysteine-S-methyltransferase	gnl\|CDD\|181899	PRK09485, mmuM, homocysteine methyltransferase; Provisional.	9.19455e-158
NZ_CP018215.1\|WP_035164536.1\|1521415_1521877_-\|YbaK/EbsC-family-protein	gnl\|CDD\|239825	cd04333, ProX_deacylase, This CD, composed mainly of bacterial single-domain proteins, includes the Thermus thermophilus (Tt) YbaK-like protein, a homolog of the trans-acting Escherichia coli YbaK Cys-tRNA(Pro) deacylase and the Agrobacterium tumefaciens ProX Ala-tRNA(Pro) deacylase and also the cis-acting prolyl-tRNA synthetase-editing domain (ProRS-INS). While ProX and ProRS-INS hydrolyze misacylated Ala-tRNA(Pro), the E. coli YbaK hydrolyzes misacylated Cys-tRNA(Pro). A few CD members are N-terminal, YbaK-ProX-like domains of an uncharacterized protein with a C-terminal, predicted Fe-S protein domain.	7.17315e-70
NZ_CP018215.1\|WP_035160953.1\|1513337_1513604_+\|DUF1294-domain-containing-protein	gnl\|CDD\|377743	pfam06961, DUF1294, Protein of unknown function (DUF1294). This family includes a number of hypothetical bacterial and archaeal proteins of unknown function.	4.03472e-19
NZ_CP018215.1\|WP_035164396.1\|1514699_1515749_-\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	4.97732e-70
NZ_CP018215.1\|WP_035164538.1\|1520607_1521054_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	4.83544e-15
NZ_CP018215.1\|WP_003616859.1\|1505345_1506056_+\|metal-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224046	COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism].	7.02641e-59
NZ_CP018215.1\|WP_003616851.1\|1512470_1513241_+\|NUDIX-hydrolase	gnl\|CDD\|223979	COG1051, COG1051, ADP-ribose pyrophosphatase [Nucleotide transport and metabolism].	1.37468e-16
NZ_CP018215.1\|WP_035164541.1\|1518656_1519487_-\|Cof-type-HAD-IIB-family-hydrolase	gnl\|CDD\|369792	pfam08282, Hydrolase_3, haloacid dehalogenase-like hydrolase. This family contains haloacid dehalogenase-like hydrolase enzymes.	7.53925e-62
NZ_CP018215.1\|WP_035164544.1\|1516581_1518015_+\|nicotinate-phosphoribosyltransferase	gnl\|CDD\|236426	PRK09243, PRK09243, nicotinate phosphoribosyltransferase; Validated.	0

>NZ_CP018215.1|WP_035160953.1|1513337_1513604_+|DUF1294-domain-containing-protein
MNNFWQSSLLLINLIAFALYGIDKAKARMHAWRIPERLLLTCGLLAPAGSGLGMLAFHHKIRKPYFCLTVLAGFILWAAIGYFIFSLN
>NZ_CP018215.1|WP_003616851.1|1512470_1513241_+|NUDIX-hydrolase
MPELEKIVERPLITITNLIWSFNKETHRVQLLLVKRKDEPFADRWALPETLLRENESADQAAVRLIKEKIGLDLPETSTEQLATFTSSHRTPGERALALTYMTYLPAMPNLRPGYGASDVAWFAFENFGHKYELFSADKDLTFELEEKSHALAFDHDEIIAVAIQRIRNKLDYQPSILQILGPEFTLREAREVYAPFFQTTVDEIDNSNFRKTHGSLFTELGVQKNYHKSGRPPKIYCLKETQSNILWRKANNKQG
>NZ_CP018215.1|WP_072538269.1|1512112_1512295_-|ComC/BlpC-family-leader-containing-pheromone/bacteriocin
MDNNLHKVETLTDEELEQIVGGSIEGFLPYVSLYKGIRWGDHLKDFLPIIRKIDTVNSFV
>NZ_CP018215.1|WP_072538202.1|1510896_1512075_+|IS256-family-transposase
MTDFKKECLNALLNKEKFDEFMRTQLEEGLDQLLESELTAFLGYDPYAREGWNSGNSRNGSYFRQVKTQFGPIKVQVPRDRKGEFHQHTLPAYGQHTDTLESTVIQLYSHGVMTREISDLIEKMYGSYYSAGTVSNISKQVASQVESYHQRQLSDKFFCVYLDATYIPLRRDTYQREAVYVAVGIKPNGHKEIIDYRIAPVENIEIWGEMISNFKERGLGQVELFLSDGFVGIKDMLKQYYPKSKFQRCLVHVMRNIKGKVRVSDRKEALDDFKQVHKQSSLKEAETVLHAFYDKYDSKYSSMIKNLQKIEEDLLVFYQYPKQIRPSIYSTNMIESINNMIKRKTKPKSEFPTEESLDNFLGVQAIGYNDRNANRTHKGFGQVTDTLESYFD
>NZ_CP018215.1|WP_072538268.1|1509651_1510479_-|helix-turn-helix-domain-containing-protein
MAEQVEEVPAGLIQTRVYELHPNKTMRRVLDEACDYRRYCWNQGLALWNEMYKARQALKSSLASDSKKLTEEQKVLLKDKPSPSERRVRNMLVADKKDWQYAQSARILQLAISDLGKAWNNFFDKAQPGWGKPKFRSKREARQGFKSDRSKIKDGIFYLERARRSSVPKDQWRGFKLSEKPLSDEFGVVSYFKEKGHYYVAIPYKIKAEDVKLPDKTGKATAVDVNVGHFDYTGGRVNVLSKKLDRIYKKSSTIKGSLPKSESKMEKLLAKARTT
>NZ_CP018215.1|WP_072538267.1|1509181_1509592_-|IS200/IS605-family-element-transposase-accessory-protein-TnpB
MHKFTTELVNDYDKIVIENLSVKGMLMSYIASKGVHRSMFGKFKQILTYKCDWYGKDLILANKLYPSTQRCAACGNVKKGDDKITLYGNKKHGTKHNEYVCYNQKCPNYNKVVDRDKNAMLSLLALTEHPELNHAL
>NZ_CP018215.1|WP_035160955.1|1508624_1508912_-|bacteriocin-immunity-protein
MFFNKKENEAEEAFKKQLETVANDPAVKANAALSNLIEAAVKKVEKSESIRSIASNLDTQLRSNFAENELPKAVFSLQLDLARYSAVGANGVVLK
>NZ_CP018215.1|WP_035160956.1|1506854_1507475_+|prolyl-oligopeptidase-family-serine-peptidase
MRKIVEYIFCRDSEKVYFYLHGGPFFSLGSWQEDPFATMLYNEQRNLILVNYPIVYGNGGISDYQFLKEYFGKYKREHPNTEMILLGESYGGYLASLFAAEYIFRKIITISAFTSIDYQELFSSERSWLKNYLSENALDFYTLCRDNKVNTQTIFINGSRDSRVPYQQFLALPFMKKFKVNILPGFTHRECGTRLEYVISLVKQEL
>NZ_CP018215.1|WP_035164546.1|1506052_1506853_+|ABC-transporter-permease
MNPQHFRNISLGLRSIRIVANNEWRAFVHNKGLLLSMFMQPLITYGLLVMALNQNLASVHYKSLILPYKQYALTGVLSFFMTAQMSQAMYRATVDKEYGLLAIKFTNGVQPWHYLTGMSFFPIAGLLFQSAVLIVLGLATGGVYNLGLLLLSLLVLIISLEFWSTLGIVLSTRISSYQQRDIIMTLIFSPVAYAAPTLYVFSDNSPLIIKVLAYINPLSYQLKALRTVAFGIFNINDLLIALALTIIMIIFAQIILRRMPLSLAER
>NZ_CP018215.1|WP_003616859.1|1505345_1506056_+|metal-ABC-transporter-ATP-binding-protein
MISTNNLNIGYKDTVVVHDLSFSLDKGMFIALIGANGAGKSTLINSLIGVIPPVSGQISWKLKTDRVNPFNDVGFSPQSQLIDWYTSVYDNVYQGPLLAGFKPKEAQKTTKQALKLLDISDLSAKPVDHISGGQQQRVQIAREIAREPQVYILDEPTTGLDVETSEKLFTYLKQKVDAGSIVLTSSHDLTLLESYASHVLFLDDHEQKYFGPLTDFLDSGTSLREKYLNERKAIEK
>NZ_CP018215.1|WP_035164396.1|1514699_1515749_-|IS30-family-transposase
MDHSYSNTKPHQKGKHLTLNDRTTIQELHSKGYSNRAIARELNCSPSTVGYELKRGTVSVYTGNVKRYKAVEGQSTYELHRSECGRKSLFLRRHKFIDYVSHCFHNRGWSLDACVGYALAKGIFQKDQVVSTKTLYNYVDLGLMDIKNGDLPEKVKRNTKTRRARVNKRILGRSIDERSPRIESRKDFGHWECDLVLGHKTKDDDVLLTLCERKTRQFFMIKIEDKTSASVMKAFDKLREYYGSKWNQIFKSITTDNGSEFADLSDLEQVSKTLVYYAHPYTSCDKGSVERHNGLIRRYIPKGDRMDKYSVEDIAKIEVWCNSLPRKILNYKTPEEYFDTELDRIYRRR
>NZ_CP018215.1|WP_003616841.1|1515958_1516513_+|cysteine-hydrolase
MENEALLIIDYTNDFVDDKGALTCGAPAQALAGQIVSLADQFLAAGKWVILPTDKHFKGNPYHPETKLFPPHNLPNTWGREFYGPLQTWYNKHQDDKHVLVLDKSRYSAFCATGLDLFLRERKVSRVHLAGVCTDICVLHTAMDAYNHGYDITVHEKAVAALNDAGQEWALNHFKSCLGAEVVD
>NZ_CP018215.1|WP_035164544.1|1516581_1518015_+|nicotinate-phosphoribosyltransferase
MSLSHALITDLYEFSMANGYFETLPRDTEAVFDVFYRTVPDNGSFVVSAGLEQVVEQLRGFHYTKEDIDYLKSLNLFSGEFISYLETMTFDCVVYAIPEGTPVFPRVPILTVKGPLIQCQLLETFVLNLINHQSLIATKSRRINLAAAGRPVMEFGARRAQGPDASVLGARAAVIGGCGSTSNVLSAAKYNIPVAGTMAHAWVQSYPTELEAFEKWAEVYPDNALLLVDTYDVLTSGVPNAIKVFKELRAKGHKKFGIRIDSGDIAKLSRKARKMMDDAGFPEATITASNALNENVIHSLLQEGAPLDSFGVGEQLITSSSSPVLSGVFKLAALKIGDGEWQPKIKLSNSKEKVTLPGEKKAYRLYHKGTKNAFADVIALADESLPEEFVGINMDPMMTETEANLKDFDAVLLTQVVVGPKAKSIETDTFKIQKHMYEKLAELPEETQRLLNPDRYPVYLTPALADLQAKMIKDHKL
>NZ_CP018215.1|WP_035164542.1|1518094_1518571_-|large-conductance-mechanosensitive-channel-protein-MscL
MPKRINLPDGQQAVESTKGFFGEFKTFISKGNVMDMAVGIIIGSAFTTIVKSLVSDIISPLLGLVGGMNFDQFSLKFAGVTLAYGKFLTAVINFLMMAFVLFLIVKAFNRGGFLIKKEEEVEEEATTKVCPYCKSEIDIEASRCPMCTSQLEEKMAEQ
>NZ_CP018215.1|WP_035164541.1|1518656_1519487_-|Cof-type-HAD-IIB-family-hydrolase
MMIKLIASDLDETLLGPGSRVVEENLRAIKKCQELGIKFVPATGRGFYSLRQTLEELGQADQAGQYTICYNGGAVFENKGPRLISFTGMDGDLVEEIFKRGQELGLGMHIYTEDQVYGYQLTQEEIDFCQGRADFAALPGGDLTALRASGARFAKILYVDTNFPRLKKLRKDLADFEKVSEMSFSSNRYLEFNPPKVNKGTGLKKLCQELGYQLDETMAIGDSFNDLAMIKAAGTGVGVANVSPEMRADCDKITEKAFDQGAVAEAIGRWVLPDYE
>NZ_CP018215.1|WP_002876643.1|1519603_1520611_-|asparaginase
MTNKKILLLSTGGTIASVASEEGLIPGKSGAELLHTLGGLPYEVEVKDILSLDSSNIQPEEWAFIAEQIYKLRRGFDGIVVSHGTDTMAYTASMLTFMLQGIDLPVVLTGSQAPMQAILSDAPDNLRVAFAAAATCKPGIYIAFNRQIMRGCRCVKIRTTGFDAFKSINVDPVAMVTSDGIDIKHKDFEYVPSEHAICTLNTKVETQVAMIKLFPGFDPAVLSAMVDSGVRGIVIEAYGLGGMNYMRRNMVKAIGEIIKRGVPVVACSQCLYERTDLTKYEVGRAAMLEGAISGRDMTSESAVTKLMWALGQGMGLEDVRAFFNKDIAGEVTITD
>NZ_CP018215.1|WP_035164538.1|1520607_1521054_-|MarR-family-transcriptional-regulator
MDLGLRVKKINDLMAKRGNHELKKLGLTFSQFHCLVYLEKCAGQQAPLKQLENHFEVAQATMAGIVGRLEGKGYVRSRLAESDKRVKIVCLTDEGRQICASAKKGMHKLQEKVEQLYSRQELSQLEKYLDRLYELLAEENREACEEKR
>NZ_CP018215.1|WP_035164536.1|1521415_1521877_-|YbaK/EbsC-family-protein
MAVERVKDFFKDTDVNVIELPESSATVALAAQALDTEPDQIAKTLSFLVDDAPILVVMAGEAKTDNHKYKATFHKKAKMIPFDQVEDYIGHALGGVCPFAVKPGVKVYLDESLKRHTEVYPAAGSSNSAVRLTIPALEKYSDYTAWVDVTKTA
>NZ_CP018215.1|WP_035160948.1|1521932_1522865_-|homocysteine-S-methyltransferase
MADLPTLLTQGPVTLDGSMSTPLEAWGEDTNSDLWTAKALADNPDLVYRVHQEYFKAGARVTITDSYQASLSAFMKHGLSEDAARGLIRESAAVAIKARDDFEKATGIHNFVAGSVGPYGAYLADGSEYRGDYALSHEEYVDFHAPRIEELVAGGVDCLAVETQPKLSEVRAILDHLKAKYPDLPVYVSFSLKDPATISEGLPLTEAVEEVSAYAQVFAAGANCFKLAWTVDVVKNLRASKLPIVVYPNSGAEYDPSVKKWVYPPEAADFGQAGADWLAAGAKLVGGCCTTMPEDIAGLAAAVKKVYTAF
>NZ_CP018215.1|WP_003616826.1|1522942_1524337_+|amino-acid-permease
MAQQEKVDHLERKMEARHIQMISLGGVIGTGLFLSSGYTISQAGPIGTIIAYFFGAILVYAVMLCLGELSVAMPYTGSFHVYAKNLLNPATGFTVAILYWLTWTIALGSEFTAAGIIMRHWFPSVPVWIWSLVFMILIFLSNFFSVKIFAESEFWFAAVKVAAIVAFIILGGLAVVGVIPLKGSQGAPGLTNLTEDGWFPTGFGGVFTTMLTVNFAFSGTELIGITAGEAKEPEKTLPKAIHTTLWRLIIFFIGSIFIMACLIPYKQAGVTESPFVHVFNMMGIPFASDLMNFVVLTAIISAGNSGLYASTRMLWSLGNEGTIPVVFAKTNKRGIPAISLLISMLGGVFSLLTSVYAADTIYLVLVSISGLAVVFVWMAIALCQLKFRQKWLKEGHTEDELKFKTPLYPFTPWFAFIASLASCLLIWFDPSQRVALYATIPFVIFCYVAHHFYAKNQEKKQTSL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP018215_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018215_3

2145785-2146270

Orphan

Consensus_repeat	Method
GAAGNCTGCNAAGAAGGC	CRT

9 spacers

The CRISPR arrays of NZ_CP018215_3

>merge|NZ_CP018215|3|2145785-2146270|CRT
GAAGGCTGCCAAGAAGTCAGCTAAGAAGAGCACTAAGAAGAGCACTAAGAAGGCTGCAAAGAAGTCAACTAAGAAGGCTACCAAGAAGGTAGCCAAGAAGTCAACTAAGAAGGCTGCAAAGAAGGCAACCAAGAAGTCAACTAAGAAGGCTGCAAAGAAGTCAACTAAGAAGGCTACCAAGAAGGTAGCTAAGAAGGATGCAAAGAAGGCAACCAAGAAGTCAACTAAGAAGGCTGCAAAGAAGGCAACCAAGAACACTAAGAAGGTAGCTAAGAGCACTAAGAAGGCAAACAAGAAGTCAACTAAGAAGGCTGCAAAGAAGGCAACCAAGAACACTAAGAAGGCTGCCAAGAAGGTAGCTAAGACTACTAAGAAGTCAACTAAGAAGGCTGCTAAGAACACCAAGAAGGCAGCTAAGACTACCAAGAAGTCAACTAAGGAGGCTGCTAAGAACACCAAGAAGGCAGCTAAGACTGCTAAGAAGGC

>NZ_CP018215|3|2|2145785-2146270|CRT
GAAGGCTGCCAAGAAGTC	AGCTAAGAAGAGCACTAAGAAGAGCACTAA
GAAGGCTGCAAAGAAGTC	AACTAAGAAGGCTACCAAGAAGGTAGCCAAGAAGTCAACTAA
GAAGGCTGCAAAGAAGGC	AACCAAGAAGTCAACTAA
GAAGGCTGCAAAGAAGTC	AACTAAGAAGGCTACCAAGAAGGTAGCTAA
GAAGGATGCAAAGAAGGC	AACCAAGAAGTCAACTAA
GAAGGCTGCAAAGAAGGC	AACCAAGAACACTAAGAAGGTAGCTAAGAGCACTAAGAAGGCAAACAA
GAAGTCAACTAAGAAGGC	TGCAAAGAAGGCAACCAAGAACACTAAGAAGGCTGCCAAGAAGGTAGCTAAGACTACTAA
GAAGTCAACTAAGAAGGC	TGCTAAGAACACCAAGAAGGCAGCTAAGACTACCAA
GAAGTCAACTAAGGAGGC	TGCTAAGAACACCAAGAAGGCAGC
TAAGACTGCTAAGAAGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018215.1\|WP_035165293.1\|2148902_2149271_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP018215.1\|WP_035160962.1\|2138092_2138275_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018215.1\|WP_003614385.1\|2146437_2146578_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018215.1\|WP_035165292.1\|2150134_2151022_-\|DNA/RNA-non-specific-endonuclease	unknown	unknown	gnl\|CDD\|372824
NZ_CP018215.1\|WP_035165536.1\|2149522_2149819_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018215.1\|WP_035165295.1\|2146592_2146904_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238075
NZ_CP018215.1\|WP_072538322.1\|2140974_2142849_+\|PTS-glucose-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|273919
NZ_CP018215.1\|WP_072538323.1\|2157562_2158597_+\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP018215.1\|WP_035165289.1\|2156252_2157233_+\|LCP-family-protein	unknown	unknown	gnl\|CDD\|181811
NZ_CP018215.1\|WP_035160960.1\|2137752_2138100_-\|IS66-family-insertion-sequence-element-accessory-protein-TnpB	unknown	unknown	gnl\|CDD\|377551
NZ_CP018215.1\|WP_013440320.1\|2144017_2145196_-\|IS256-like-element-ISLdl2-family-transposase	unknown	unknown	gnl\|CDD\|307151
NZ_CP018215.1\|WP_002879841.1\|2142907_2143093_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018215.1\|WP_078256804.1\|2134753_2136016_+\|IS3-like-element-ISL6-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP018215.1\|WP_013439920.1\|2137463_2137697_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379018
NZ_CP018215.1\|WP_072538321.1\|2138390_2140043_-\|alpha,alpha-phosphotrehalase	unknown	unknown	gnl\|CDD\|274115
NZ_CP018215.1\|WP_035165287.1\|2158739_2159855_+\|UDP-galactopyranose-mutase	unknown	unknown	gnl\|CDD\|223636
NZ_CP018215.1\|WP_016396242.1\|2140053_2140761_-\|trehalose-operon-repressor	unknown	unknown	gnl\|CDD\|274116
NZ_CP018215.1\|WP_035165290.1\|2154783_2156013_+\|LCP-family-protein	unknown	unknown	gnl\|CDD\|181811
NZ_CP018215.1\|WP_003616107.1\|2147754_2148768_+\|NAD(P)-dependent-glycerol-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|234629
NZ_CP018215.1\|WP_035164407.1\|2136163_2137507_-\|IS66-family-transposase	unknown	unknown	gnl\|CDD\|376980

Protein	Function_ID	Function_description	E-value
NZ_CP018215.1\|WP_035165293.1\|2148902_2149271_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.38439e-15
NZ_CP018215.1\|WP_035165292.1\|2150134_2151022_-\|DNA/RNA-non-specific-endonuclease	gnl\|CDD\|372824	pfam13930, Endonuclea_NS_2, DNA/RNA non-specific endonuclease.	7.32429e-51
NZ_CP018215.1\|WP_035165287.1\|2158739_2159855_+\|UDP-galactopyranose-mutase	gnl\|CDD\|223636	COG0562, Glf, UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane].	0
NZ_CP018215.1\|WP_016396242.1\|2140053_2140761_-\|trehalose-operon-repressor	gnl\|CDD\|274116	TIGR02404, Trehalose_operon_transcriptional_repressor, trehalose operon repressor, B. subtilis-type. This family consists of repressors of the GntR family typically associated with trehalose utilization operons. Trehalose is imported as trehalose-6-phosphate and then hydrolyzed by alpha,alpha-phosphotrehalase to glucose and glucose-6-P. This family includes repressors mostly from Gram-positive lineages and does not include the TreR from E. coli. [Regulatory functions, DNA interactions].	1.48411e-86
NZ_CP018215.1\|WP_072538322.1\|2140974_2142849_+\|PTS-glucose-transporter-subunit-IIA	gnl\|CDD\|273919	TIGR01995, beta-glucosides_PTS_EIIBCA, PTS system, beta-glucoside-specific IIABC component. This model represents a family of PTS enzyme II proteins in which all three domains are found in the same polypeptide chain and which appear to have a broad specificity for beta-glucosides including salicin (beta-D-glucose-1-salicylate) and arbutin (Hydroquinone-O-beta-D-glucopyranoside). These are distinct from the closely related sucrose-specific and trehalose-specific PTS transporters.	0
NZ_CP018215.1\|WP_072538323.1\|2157562_2158597_+\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	4.28443e-68
NZ_CP018215.1\|WP_035165289.1\|2156252_2157233_+\|LCP-family-protein	gnl\|CDD\|181811	PRK09379, PRK09379, LytR family transcriptional regulator.	5.92876e-70
NZ_CP018215.1\|WP_035160960.1\|2137752_2138100_-\|IS66-family-insertion-sequence-element-accessory-protein-TnpB	gnl\|CDD\|377551	pfam05717, TnpB_IS66, IS66 Orf2 like protein. This protein is found in insertion sequences related to IS66. The function of these proteins is uncertain, but they are probably essential for transposition.	5.85667e-45
NZ_CP018215.1\|WP_013440320.1\|2144017_2145196_-\|IS256-like-element-ISLdl2-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	4.20336e-101
NZ_CP018215.1\|WP_078256804.1\|2134753_2136016_+\|IS3-like-element-ISL6-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	3.96949e-46
NZ_CP018215.1\|WP_013439920.1\|2137463_2137697_-\|hypothetical-protein	gnl\|CDD\|379018	pfam13007, LZ_Tnp_IS66, Transposase C of IS166 homeodomain. This is a leucine-zipper-like or homeodomain-like region of transposase TnpC of insertion element IS66.	4.0126e-07
NZ_CP018215.1\|WP_072538321.1\|2138390_2140043_-\|alpha,alpha-phosphotrehalase	gnl\|CDD\|274115	TIGR02403, Trehalose-6-phosphate_hydrolase, alpha,alpha-phosphotrehalase. Trehalose is a glucose disaccharide that serves in many biological systems as a compatible solute for protection against hyperosmotic and thermal stress. This family describes trehalose-6-phosphate hydrolase, product of the treC (or treA) gene, which is often found together with a trehalose uptake transporter and a trehalose operon repressor.	0
NZ_CP018215.1\|WP_035165295.1\|2146592_2146904_-\|hypothetical-protein	gnl\|CDD\|238075	cd00130, PAS, PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in signal transduction.	0.000516764
NZ_CP018215.1\|WP_035165290.1\|2154783_2156013_+\|LCP-family-protein	gnl\|CDD\|181811	PRK09379, PRK09379, LytR family transcriptional regulator.	6.28717e-72
NZ_CP018215.1\|WP_003616107.1\|2147754_2148768_+\|NAD(P)-dependent-glycerol-3-phosphate-dehydrogenase	gnl\|CDD\|234629	PRK00094, gpsA, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase.	1.05921e-158
NZ_CP018215.1\|WP_035164407.1\|2136163_2137507_-\|IS66-family-transposase	gnl\|CDD\|376980	pfam03050, DDE_Tnp_IS66, Transposase IS66 family. Transposase proteins are necessary for efficient DNA transposition. This family includes IS66 from Agrobacterium tumefaciens.	1.1679e-101

>NZ_CP018215.1|WP_013440320.1|2144017_2145196_-|IS256-like-element-ISLdl2-family-transposase
MTDFNKECLNALLNKEKFDEFMRTQLEEGLDQLLESELTAFLGYDPYAREGWNSGNSRNGSYFRQVKTQFGPIKVQVPRDRKGEFHQHTLPAYGQHTDTLESTVIQLYSHGVTTREISDLIEKMYGSYYSAGTVSNISKQVASQVESYHQRQLSDKFFCVYLDATYIPLRRDTYQREAVYVAVGIKPNGHKEIIDYRIAPVENIEIWGEMISNFKERGLEQVELFLSDGFVGIKDMLKQYYPKSKFQRCLVHVMRNIKGKVRVSDRKEALDDFKQVHKQSSLKEAETVLHAFYDKYDSKYSSMIKNLQKIEEDLLVFYQYPKQIRPSIYSTNMIESINNMIKRKTKPKSEFPTEESLDNFLGVQAIGYNDRNANRTHKGFGQVTDTLESYFD
>NZ_CP018215.1|WP_002879841.1|2142907_2143093_-|hypothetical-protein
MQFTKQFEGTFAQVKEQIDKFVAEGGHIDAVITDHTGEKVTEDHTFGYKMRVIAICSEEES
>NZ_CP018215.1|WP_072538322.1|2140974_2142849_+|PTS-glucose-transporter-subunit-IIA
MAKKDYSGLAKTIIANVGGKENINSLIHCITRLRFYLKDESKANDEVLKETDGVIDVMHASGQYQVVIGNAVTQVYDAVMAELGGLPEGGEAAETAETKEDDGKNPVSKAFGNLIGFITGSMSPVVGVIVASGIIKGILALLTLPQLGALLNVKSTAYITVSAMADSAFYFLPILVGFAAAKKLNGDPIVAAVIGGVLTYPQLVTWGGQYKTMFSLGGFNFQFLNYTYSIFPMILAAWLAKKLEDWLRDHLPDYLQMIFTPMITILLVSAVTLMITGPVIQGVANGIADLINWVVSASGWIGGLLIGAFYQVLVIFGLHWGVVPLVAQQIAQSGQSSLNAIISVTMVSQGAAVLAVALKTKKKGTKTLGISAAVSAFCGVTEPAIYGINLRFKKVFISGLIGSAVGGLITGLMHGTMYGFTGSLIGFSSFFNPKNPSDLTSFYAFLLSSAAALVISFIVAWVWGYNDEMVAGKKVEKKQRPGSEAKRKSETLTAPVAGKVIALSSVNDPVFSTGAMGEGFAVVPTEGAVKAPVDGEVAALFETGHAIGLKTTAGAEVLIHIGIDTVMLKGKGFNVKVAQGDLVKAGQTLIEFDLDGIKEAGYDPTVMTVVTDKHDVDIKLPSVE
>NZ_CP018215.1|WP_016396242.1|2140053_2140761_-|trehalose-operon-repressor
MTAKQDMITQDLAGKIRHGIYPPKSFLPSENELANLYGASRNTVRKSLEDLTSLGLIQKIKGKGSIVLDFSRLSFPISRITTFNELNQSLGLKAETKLLEIKEVKKVPDDFSCDNTEPFIKVKRLRIIDGEPDVLDVDYISTKYVKEISPSVAEHSLYDYFENDLGLKISYAVKDVSVQTVSEELAKMLELDPDRKAVLVKSMVYLEDTSLFQLTASYHNPNRFRFIDFARRSKI
>NZ_CP018215.1|WP_072538321.1|2138390_2140043_-|alpha,alpha-phosphotrehalase
MQNLGQKVIYQIYPKSFYDANGDGIGDLRGIIEKIDYIKKLNVDMIWFNPFYVSPQNDNGYDIANYREIDPLFGTMADFEELQAKLADIGVGVMLDMVLNHCSTEHEWFKKALAGDEKYRKFFYLRPGKPDGSLPNNWQSKFGGPAWSKFGDTDLYYLHLYDSTQADLDWHNPEVRKELEDVVNFWRGKGVRGFRFDVINVTGKSEDLVDSTDPTEEKTLYTDTPVVHDYLKELNRTTFGQDEDSITVGEMSSTTIPNSVRYTNPKEKELSMVFTFHHLKVDYKDGEKWTKTPFDFMKLKGLLSSWQTGMTEGGGWNAVFWNNHDQPWALNRFGDPVHYREKSAEMLAATIHFLRGTPFIYQGEELGMVNPDYQSMDEYVDVECKNAYQELLDKGMSEDEAFAIIKAKSRDNSRVPMHWDDSKYAGFSQVKPWLLPTHQDEINVKKELAEGEIFAFYQKLIALRKQEAVISAGGFREILPDDQQVFAYVRELDGEKLVVFNNFYGKEAVISVPSDLQECGQILLDNYKRELSCLPGELSLRPYESLAFRI
>NZ_CP018215.1|WP_035160962.1|2138092_2138275_-|hypothetical-protein
MTEHPIVPLELPKGKLRPRNKLPKNRLVLNLKSNGVELSFYSDATNELMLEVVDRVLSHD
>NZ_CP018215.1|WP_035160960.1|2137752_2138100_-|IS66-family-insertion-sequence-element-accessory-protein-TnpB
MINLAELGRVFIVCGKTDMRRGIDSLAYIVKKSFNLDPFSGCVFLFCGSRRDRFKALYWDGQGFWLLYKRFENGKLAWPNNDDEVRELSDEQVMRLMQGFTIDPKINTARAREFY
>NZ_CP018215.1|WP_013439920.1|2137463_2137697_-|hypothetical-protein
MTDKETSALIEALKANNEELLKQVALLTEQVAYLTNKLYGKSSEKRAVNPDQLSLFEEDNASQDDEDLPSHYRNYYL
>NZ_CP018215.1|WP_035164407.1|2136163_2137507_-|IS66-family-transposase
MTRTCPRITETITYKRRKQVGRKQDILDSLPGEEVHYQLDDLTCPDCQHELKEIGSFCARKELLYIPAQVKRIDHIQHSYKCQHCSDEAPADKIIKAPVPKAPLTNSLGSASLIADTIYQKYVLKVPAYRQEKDLRRMGLPLDHKTVSNWHIKVCEYYLSSLYELLRQELLKLDVIHADETPYRVLDSERAKDYVWTFLSGKHAEKPIVLYHHGSRKGAEAWDFLTGFSGYLHCDQYPGYLRLSQQDVTLVGCMAHARRKFHDSLPKDKARESDATSVANQGIHYCNQMFSLERAWEDLSAEERYEKRQSELRPLLEKFSDWCSKKSISVLPSGKLGTAFQYCIKHMDKFMNVLKDGRLELSNNRAERAVKEIVMGRKNWLFSQSSTGAKSMTIIMSILETAKQNGLDQFKYINYLLDKLPNELSLSDNQRLEAYLPWAENVKLHCK
>NZ_CP018215.1|WP_078256804.1|2134753_2136016_+|IS3-like-element-ISL6-family-transposase
MVDLIQKHGEDILDRPQQKYTANFKLAAIDRVLLGGEALSQVSLDLGLTNTGILANWLRSFKESGYTVITKKKGRPPKNAQKQGQTTDQRAGRASKEAYSRACIHKKIGGLNSRTEEPRKEELARAITELRQELRLSVKYIIDVINANPGLPHISRSNYYYQTHKPDKDSGNQKLMDRIKEIFLEHSRRYGYRRIYGQLRREVYEINHKKVQRLMQKMGLFAISIRKKRKYSSYYGVQGKIKPDLIKRNFYAIIPDRHWFTDVTEFHLKDQKFYLSPIIDGCTQEIISYNISRHPDLKQVMTMLDDAFEKHPALNGLIFHSDRGWQYQHQAYQAALANRGIDQSMSRLGNSLDDGLMEGFFGILKREMFYGQEHKYKDLNELEQAIHKYIDYYNNVRIKTGRKNMTPIEYRNHVLTTLTA
>NZ_CP018215.1|WP_003614385.1|2146437_2146578_-|hypothetical-protein
MAEEEKKLNITNLQILGQDDSPLFQGAGSEGKSVTYPKKFANHPGF
>NZ_CP018215.1|WP_035165295.1|2146592_2146904_-|hypothetical-protein
MQMDTKEAIYVNKSLLELFGCELSSEFYDYYGQSLLNLISPGDQARVKEEFTDFVESAVDEERFRGDCQILTADARTLRVFCDIKYSVNQRYGALVYISFVLN
>NZ_CP018215.1|WP_003616107.1|2147754_2148768_+|NAD(P)-dependent-glycerol-3-phosphate-dehydrogenase
MAKIGVLGAGTWGMALARMLSNSGHEVTVWSALPQEVDELSRTRRQKNLPGMVIPDEIKFTKEIAEACQDKDIILFAVPSVFVRSTAKTAAAFIPDGQIIVDVAKGIEPDTLLTLTEVIADELNKDGKHGNVHYVAMSGPTHAEEVAKDLPTTIVSACEDQAVAEKVQDVFMNKNMRVYTNSDRLGVELCGALKNVIALASGICSGLGYGDNMRAALIIRGMAEIKRLGLKMGGKEDSFDGLAGMGDLIVTATSKESRNNNAGYLIGKGKSAEEAKKEVGMVVEGINAIPAALELADKYDVEMPIVFAVDAVVNRGADARETVDALMLREKKSEMTK
>NZ_CP018215.1|WP_035165293.1|2148902_2149271_+|helix-turn-helix-transcriptional-regulator
MEKNMIGKYLRDLRRRRGMSQQELALALGVSKQTISNWEVGRKVPRMKAVEKIANIFGVSRNSVLAGLPVEMLVQEGQEDRRVVDLTDRDIRLTYLGQQVPREYIDIVEKLMHCDIAERDAQ
>NZ_CP018215.1|WP_035165536.1|2149522_2149819_+|hypothetical-protein
MPIYFPVGGAKPRYFYRKKVAIGGAEGSLTGVYWFKGNRGQIEKIGSQAHFKKLFRQISLNKLEESPMPVKKTKTEKKKMSKKTTKKTEKQSSKKKAE
>NZ_CP018215.1|WP_035165292.1|2150134_2151022_-|DNA/RNA-non-specific-endonuclease
MKKAMQKLTTLLLASASFLVASPAKASSLADRNYQGQKVITVNQNRPTFSKKALSTKKGAWQSYHKLDSLNRAGEADALLNKRLMPTKAREPLYWNPTAWHNKKIAGGWLYNRSHLIGYQLTGQNNNPKNLITGTRQLNDPGMLKYENQVASYIKSSSRHYIRYRVKPIFRGRELLARGVEMEAQSTGSNAVRFHVYIFNIQDGVKLNYSNGTSVVTGAAKKSAKKTVVKKAAAKKSTSSKKKIKTSTTGRIVGNRRSKIYHVPGQAGYHMNSANAVYFRTETEAKRAGYRRALR
>NZ_CP018215.1|WP_035165290.1|2154783_2156013_+|LCP-family-protein
MKTLKNDNNINTRVGKRKKRGKAKRVFWSILAVLLLGIGGFAYYEYHTVKNGADSAYKSGGISSAENGSKNSVISSSKPIAILLMGTDTGALGRTYKGRTDSIMVAVLNPKTKKTTLVSFERDQQVNLPDYPDKSPSKLNAAYAYGNAKELAKVLKKYYNIPINAYVLINMGDLKTIVNKVGGIDIALVLSFSYEGYTFTKGKTTHMNGAKALAYSRMRYDDPQGDYGRQKRQRQVLSALLKKAESATTLLNSSFISSLSKQVQTDLTFADLTSLAKNYLAATKNLKTNYTHGTGYMQNGVSYQKISVSERQRISNLIRKALGLKTKKVSTDSSDTSTSSSTSSSSSSSAGNTPGSNASGSTTAPGSDTNTGSNYNSNYGSNSNSTYNSGYGTQDSSQNMHGQNTGTGY
>NZ_CP018215.1|WP_035165289.1|2156252_2157233_+|LCP-family-protein
MNEKKLNTRTEKRKKRNKFWRIFWIVVGVFVVGLAGFAWYEYSSVKNAANTAYRSGGISSAENGSKNDVISNKKPMAVLLMGTDTGALGRTYKGRTDSIMVAVLNPKTKKTTLVSFERDIQVNLPDYPEHSPSKLNAAYAYGNAGELAKVLKKYFNIPINAYVLVNMGGLKTIVDKVGGVDIAPVLSFSYEGYTFTKGQKTHMDGAKALAYSRMRNDDPEGDYGRQKRQRQVLQALVKKAESAQTLLNTSFISSLSKQVQTDLTFSDLTSLASSYLPATKNVVTDYTHGTGFMQDGVSYQQVSTTERQRISDLIRKAMGLKTKSVQ
>NZ_CP018215.1|WP_072538323.1|2157562_2158597_+|IS30-family-transposase
MDHSYSNTKPHQKGKHLTLNDRTTIQELHSKGYSNRAIARELNCSPSTVGYEHKRGTVSVYRYKAVEGQSTYELHRSECGRKSLFLRRHKFIDYVSHCFHNHGWSLDACVGYALAKGIFQKDQVVSTKTLYNYVDLGLMDIKNGDLPEKVKRNTKTRRARVNKRILGRSIDERSPRIESRKDFGHWECDLVLGHKTKDDDVLLTLCERKTRQFFMIKIEDKTSASVMKAFDKLREYYGSKWNQIFKSITTDNGSEFADLSDLEQVSKTLVYYAHPYTSCDKGSVERYNGLIRRYIPKGDRMDKYSVEDIAKIEVWCNSLPRKILNYKTPEEYFDTELDRIYRRR
>NZ_CP018215.1|WP_035165287.1|2158739_2159855_+|UDP-galactopyranose-mutase
MSKYLVVGAGLFGAVFAREAAKRGHEVTVIEKRDHIAGNIYTKEIDGIQVHQYGAHIFHTSDKEVWEYVQQFAEFNRYTNSPVANYKGHMYNLPFNMNTFAQMWGIRTPQEALDKINEQRAEMAGKEPQNLEEQAISLIGRDIYEKLIKGYTEKQWGRKATELPAFIIKRVPVRLIYDNNYFNDDYQGIPKGGYTKLVENMLKSDRITVETNTNFFDNKDEYLKNFDKVVYTGPIDEFFDYQLGELEYRSLRFETEEVNVGNYQGNAVINYTDAETPYTRVIEHKHFEFGKGDPDKSVITREYPANWSKGDEPYYPVNNDKNNALYAQYKDLAAKEDAKVIFGGRLGQYKYYNMDQVIRAALDAVNTEFGE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP018215_3	3.4\|2145947\|30\|NZ_CP018215\|CRT	2145947-2145976	30	NC_028662	Mycobacterium phage Phlei, complete genome	17628-17657	3	0.9
NZ_CP018215_3	3.4\|2145947\|30\|NZ_CP018215\|CRT	2145947-2145976	30	NC_008694	Yersinia phage Berlin, complete genome	25511-25540	6	0.8
NZ_CP018215_3	3.4\|2145947\|30\|NZ_CP018215\|CRT	2145947-2145976	30	MT374859	Yersinia phage vB_YpP_T3, complete genome	25932-25961	6	0.8
NZ_CP018215_3	3.4\|2145947\|30\|NZ_CP018215\|CRT	2145947-2145976	30	NC_028800	Klebsiella phage K5, complete genome	18217-18246	6	0.8
NZ_CP018215_3	3.4\|2145947\|30\|NZ_CP018215\|CRT	2145947-2145976	30	NC_011038	Yersinia phage Yepe2, complete genome	25598-25627	6	0.8
NZ_CP018215_3	3.4\|2145947\|30\|NZ_CP018215\|CRT	2145947-2145976	30	NC_047773	Klebsiella phage vB_KpnP_KpV766, complete genome	18691-18720	6	0.8
NZ_CP018215_3	3.4\|2145947\|30\|NZ_CP018215\|CRT	2145947-2145976	30	AM183667	Bacteriophage Berlin complete genome	25511-25540	6	0.8
NZ_CP018215_3	3.4\|2145947\|30\|NZ_CP018215\|CRT	2145947-2145976	30	JQ965702	Yersinia phage YpP-G, complete sequence	25750-25779	6	0.8
NZ_CP018215_3	3.4\|2145947\|30\|NZ_CP018215\|CRT	2145947-2145976	30	HQ333270	Yersinia phage Yep-phi, complete genome	25528-25557	6	0.8
NZ_CP018215_3	3.4\|2145947\|30\|NZ_CP018215\|CRT	2145947-2145976	30	NC_013647	Klebsiella phage KP32, complete genome	18617-18646	6	0.8
NZ_CP018215_3	3.1\|2145803\|30\|NZ_CP018215\|CRT	2145803-2145832	30	KY554772	Lactococcus phage AM5, complete genome	86432-86461	8	0.733
NZ_CP018215_3	3.1\|2145803\|30\|NZ_CP018215\|CRT	2145803-2145832	30	NC_049856	Lactococcus phage AM4, complete genome	68477-68506	8	0.733
NZ_CP018215_3	3.4\|2145947\|30\|NZ_CP018215\|CRT	2145947-2145976	30	KU682439	Stenotrophomonas phage vB_SmaS-DLP_6, complete genome	85873-85902	8	0.733

1. spacer 3.4|2145947|30|NZ_CP018215|CRT matches to NC_028662 (Mycobacterium phage Phlei, complete genome) position: , mismatch: 3, identity: 0.9

aactaagaaggctaccaagaaggtagctaa	CRISPR spacer
cactaagaaggctaccgagaaggcagctaa	Protospacer
 ***************.******.******

2. spacer 3.4|2145947|30|NZ_CP018215|CRT matches to NC_008694 (Yersinia phage Berlin, complete genome) position: , mismatch: 6, identity: 0.8

aactaagaaggctaccaagaaggtagctaa---	CRISPR spacer
gactaagaaggctaccactaaggt---taaggc	Protospacer
.****************  *****   ***

3. spacer 3.4|2145947|30|NZ_CP018215|CRT matches to MT374859 (Yersinia phage vB_YpP_T3, complete genome) position: , mismatch: 6, identity: 0.8

aactaagaaggctaccaagaaggtagctaa---	CRISPR spacer
gactaagaaggctaccactaaggt---taaggc	Protospacer
.****************  *****   ***

4. spacer 3.4|2145947|30|NZ_CP018215|CRT matches to NC_028800 (Klebsiella phage K5, complete genome) position: , mismatch: 6, identity: 0.8

aactaagaaggctaccaagaaggtagctaa	CRISPR spacer
gattaagaaggccatcaagaaggtagtcaa	Protospacer
.*.*********.*.***********..**

5. spacer 3.4|2145947|30|NZ_CP018215|CRT matches to NC_011038 (Yersinia phage Yepe2, complete genome) position: , mismatch: 6, identity: 0.8

aactaagaaggctaccaagaaggtagctaa---	CRISPR spacer
gactaagaaggctaccactaaggt---taaggc	Protospacer
.****************  *****   ***

6. spacer 3.4|2145947|30|NZ_CP018215|CRT matches to NC_047773 (Klebsiella phage vB_KpnP_KpV766, complete genome) position: , mismatch: 6, identity: 0.8

aactaagaaggctaccaagaaggtagctaa	CRISPR spacer
gattaagaaggccatcaagaaggtagtcaa	Protospacer
.*.*********.*.***********..**

7. spacer 3.4|2145947|30|NZ_CP018215|CRT matches to AM183667 (Bacteriophage Berlin complete genome) position: , mismatch: 6, identity: 0.8

aactaagaaggctaccaagaaggtagctaa---	CRISPR spacer
gactaagaaggctaccactaaggt---taaggc	Protospacer
.****************  *****   ***

8. spacer 3.4|2145947|30|NZ_CP018215|CRT matches to JQ965702 (Yersinia phage YpP-G, complete sequence) position: , mismatch: 6, identity: 0.8

aactaagaaggctaccaagaaggtagctaa---	CRISPR spacer
gactaagaaggctaccactaaggt---taaggc	Protospacer
.****************  *****   ***

9. spacer 3.4|2145947|30|NZ_CP018215|CRT matches to HQ333270 (Yersinia phage Yep-phi, complete genome) position: , mismatch: 6, identity: 0.8

aactaagaaggctaccaagaaggtagctaa---	CRISPR spacer
gactaagaaggctaccactaaggt---taaggc	Protospacer
.****************  *****   ***

10. spacer 3.4|2145947|30|NZ_CP018215|CRT matches to NC_013647 (Klebsiella phage KP32, complete genome) position: , mismatch: 6, identity: 0.8

aactaagaaggctaccaagaaggtagctaa	CRISPR spacer
gattaagaaggccatcaagaaggtagtcaa	Protospacer
.*.*********.*.***********..**

11. spacer 3.1|2145803|30|NZ_CP018215|CRT matches to KY554772 (Lactococcus phage AM5, complete genome) position: , mismatch: 8, identity: 0.733

agctaagaagagcactaagaagagcactaa	CRISPR spacer
gcctaagaagggcactaagaagaagtcaac	Protospacer
. ********.************.  * *

12. spacer 3.1|2145803|30|NZ_CP018215|CRT matches to NC_049856 (Lactococcus phage AM4, complete genome) position: , mismatch: 8, identity: 0.733

agctaagaagagcactaagaagagcactaa	CRISPR spacer
gcctaagaagggcactaagaagaagtcaac	Protospacer
. ********.************.  * *

13. spacer 3.4|2145947|30|NZ_CP018215|CRT matches to KU682439 (Stenotrophomonas phage vB_SmaS-DLP_6, complete genome) position: , mismatch: 8, identity: 0.733

aactaagaaggctaccaagaaggtagctaa	CRISPR spacer
ggcgaagaaggttgccaagaaggtagccgc	Protospacer
..* *******.*.*************..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3297 : 85479

Streptococcus_phage(23.53%)

tRNA,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003612150.1\|3297_4605_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.0e-91	49.0
WP_035165238.1\|4762_5326_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_003616015.1\|5339_6206_+	DUF3298 domain-containing protein	NA	NA	NA	NA
WP_072538165.1\|12055_13105_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	33.1
WP_013438997.1\|13235_14519_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.9e-58	33.3
WP_072538166.1\|14776_16000_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	1.3e-97	49.2
WP_035165234.1\|16429_17032_+	amidohydrolase family protein	NA	NA	NA	NA
WP_035165232.1\|17110_17830_-\|tRNA	tRNA synthetase subunit beta	NA	NA	NA	NA
WP_016396985.1\|17906_18776_-	DNA-binding domain-containing protein	NA	NA	NA	NA
WP_016396975.1\|19082_20084_+	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_003616007.1\|20102_21032_+	carbamate kinase	NA	NA	NA	NA
WP_035165231.1\|21195_22419_+	arginine deiminase	NA	NA	NA	NA
WP_035164983.1\|24161_25211_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.1e-42	32.8
WP_072538167.1\|26759_28127_-\|transposase	ISL3-like element ISLdl1 family transposase	A4PE56	Ralstonia_virus	4.2e-31	29.1
WP_013438997.1\|28282_29566_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.9e-58	33.3
WP_003616000.1\|31094_32264_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_003611152.1\|32256_33306_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_003615999.1\|33298_34312_+	flippase-like domain-containing protein	NA	NA	NA	NA
WP_035165229.1\|34330_36403_+	LTA synthase family protein	W6LM83	Streptococcus_phage	1.8e-139	45.2
WP_002876914.1\|36457_36691_+	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_035165228.1\|36757_39127_+	ribonuclease R	Q0GXV6	Lactococcus_phage	3.9e-77	35.2
WP_003611142.1\|39149_39611_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	7.9e-43	58.6
WP_011544204.1\|39776_40145_+	hypothetical protein	NA	NA	NA	NA
WP_003615992.1\|40144_40621_+	hypothetical protein	NA	NA	NA	NA
WP_035165225.1\|40632_41868_+	ABC transporter permease	NA	NA	NA	NA
WP_003615989.1\|41867_42548_+	ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	1.2e-15	31.3
WP_003615988.1\|42550_42718_+	hypothetical protein	NA	NA	NA	NA
WP_035160962.1\|42915_43098_+	hypothetical protein	NA	NA	NA	NA
WP_035160960.1\|43090_43438_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_013439920.1\|43493_43727_+	hypothetical protein	NA	NA	NA	NA
WP_035164407.1\|43683_45027_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.6e-48	29.9
WP_016396090.1\|45228_45453_-	hypothetical protein	NA	NA	NA	NA
WP_072538168.1\|45424_47176_-\|transposase	transposase	NA	NA	NA	NA
WP_035165222.1\|48818_50702_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_003615985.1\|50785_51568_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_035165218.1\|51776_52265_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_035165217.1\|52437_52932_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_035165215.1\|53142_53922_+	Fe-S cluster assembly ATPase SufC	A0A285PWH2	Cedratvirus	5.0e-13	29.2
WP_035165213.1\|53931_55095_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_003615977.1\|55075_56290_+	SufS family cysteine desulfurase	Q2XUY6	environmental_halophage	1.5e-88	41.4
WP_003615975.1\|56276_56717_+	SUF system NifU family Fe-S cluster assembly protein	NA	NA	NA	NA
WP_016396957.1\|56717_58145_+	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_035165211.1\|58230_59445_-	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
WP_013440320.1\|60885_62064_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_078256838.1\|62126_62306_-	hypothetical protein	NA	NA	NA	NA
WP_172822841.1\|68893_70375_+\|transposase	transposase	NA	NA	NA	NA
WP_035165207.1\|70859_72239_-	Na+/H+ antiporter NhaC	NA	NA	NA	NA
WP_035165205.1\|73129_74131_+	PTS mannose transporter subunit IIAB	NA	NA	NA	NA
WP_035165203.1\|74149_74962_+	PTS mannose/fructose/sorbose transporter subunit IIC	NA	NA	NA	NA
WP_035165202.1\|74990_75905_+	PTS mannose/fructose/sorbose transporter family subunit IID	NA	NA	NA	NA
WP_003615959.1\|75914_76283_+	DUF956 family protein	NA	NA	NA	NA
WP_035165200.1\|76906_78277_-	amino acid permease	NA	NA	NA	NA
WP_035165198.1\|78469_79312_+	C40 family peptidase	NA	NA	NA	NA
WP_016396850.1\|79504_80494_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	3.3e-54	39.0
WP_035165197.1\|80573_83714_-	DUF3427 domain-containing protein	A0A0A1ENT0	Lactobacillus_phage	3.0e-32	29.4
WP_016396848.1\|83852_84161_+	hypothetical protein	NA	NA	NA	NA
WP_078256804.1\|84216_85479_-\|transposase	IS3-like element ISL6 family transposase	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7

DBSCAN-SWA_2

161609 : 214286

unidentified_phage(30.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035164396.1\|161609_162659_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.2e-43	33.1
WP_003611827.1\|162839_164228_+	amino acid permease	NA	NA	NA	NA
WP_002876384.1\|164431_165283_+	S-adenosyl-l-methionine hydroxide adenosyltransferase family protein	NA	NA	NA	NA
WP_035165156.1\|165306_165867_+	ECF-type riboflavin transporter substrate-binding protein	NA	NA	NA	NA
WP_035162569.1\|165878_167597_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.1e-19	32.8
WP_016396785.1\|167589_168417_+	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_035165520.1\|168846_170241_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_003615835.1\|171917_172421_+	ECF transporter S component	NA	NA	NA	NA
WP_118979685.1\|172512_172728_-	GGDEF domain-containing protein	NA	NA	NA	NA
WP_016396782.1\|174074_174506_-	hypothetical protein	NA	NA	NA	NA
WP_035165157.1\|174769_175891_+	aminopeptidase P family protein	NA	NA	NA	NA
WP_035164983.1\|176782_177832_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.1e-42	32.8
WP_035165160.1\|178659_179727_+	hypothetical protein	NA	NA	NA	NA
WP_035165162.1\|179741_180923_+	carboxylate--amine ligase	NA	NA	NA	NA
WP_035165164.1\|180919_182140_+	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_003615813.1\|182180_182705_-	NUDIX hydrolase	A0A1S6L1P8	Vibrio_phage	3.9e-06	28.6
WP_016396775.1\|182836_184456_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002876367.1\|184829_185198_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_013440010.1\|185199_185898_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.8e-14	27.1
WP_016396774.1\|185897_186734_+	hypothetical protein	NA	NA	NA	NA
WP_002876356.1\|186878_188381_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_035162587.1\|188462_189488_-	YeiH family putative sulfate export transporter	NA	NA	NA	NA
WP_072538176.1\|189602_190652_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	8.1e-43	32.8
WP_035165137.1\|190858_191734_+	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	6.4e-09	35.7
WP_035162591.1\|193049_193616_-	NUDIX hydrolase	NA	NA	NA	NA
WP_035165136.1\|193758_195183_+\|tRNA	cysteine--tRNA ligase	A0A1V0SAQ2	Catovirus	1.4e-53	30.4
WP_002876476.1\|195175_195619_+	ribonuclease iii family protein	NA	NA	NA	NA
WP_035165133.1\|195605_196355_+	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_016396767.1\|196466_197036_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_002876482.1\|197103_197319_+	hypothetical protein	NA	NA	NA	NA
WP_003615790.1\|198341_200093_-	1-deoxy-D-xylulose-5-phosphate synthase	NA	NA	NA	NA
WP_002876495.1\|200268_200418_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_003615789.1\|200424_200595_+	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_002876498.1\|200686_201241_+	transcription termination/antitermination protein NusG	NA	NA	NA	NA
WP_002876501.1\|201366_201792_+	50S ribosomal protein L11	NA	NA	NA	NA
WP_003615785.1\|201875_202571_+	50S ribosomal protein L1	NA	NA	NA	NA
WP_035162599.1\|202733_203738_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_101868787.1\|205077_205296_+	hypothetical protein	NA	NA	NA	NA
WP_035165129.1\|205315_205717_-	hypothetical protein	NA	NA	NA	NA
WP_002876508.1\|205977_206487_+	50S ribosomal protein L10	NA	NA	NA	NA
WP_002876509.1\|206539_206905_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_013439993.1\|208933_209206_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.1e-25	70.0
WP_095582936.1\|209770_210973_+\|transposase	transposase	NA	NA	NA	NA
WP_013440320.1\|211642_212821_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_078256804.1\|213023_214286_+\|transposase	IS3-like element ISL6 family transposase	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7

DBSCAN-SWA_3

239297 : 301469

unidentified_phage(13.64%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035164983.1\|239297_240347_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.1e-42	32.8
WP_003615746.1\|240549_241080_+	folate family ECF transporter S component	NA	NA	NA	NA
WP_002876548.1\|241097_241820_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_003615744.1\|241824_242355_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_003615743.1\|242357_243398_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	8.5e-53	36.3
WP_035165111.1\|243464_245381_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	1.1e-58	28.6
WP_035165109.1\|245672_246359_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_002876557.1\|246514_246799_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.9e-15	44.1
WP_003615736.1\|246821_248435_+	chaperonin GroEL	A0A219YK78	uncultured_virus	1.5e-160	56.0
WP_003615735.1\|248573_251144_+	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	7.1e-40	25.7
WP_016396738.1\|251143_253114_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	2.6e-50	40.5
WP_035162520.1\|253123_253717_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_003615731.1\|253731_254742_+	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	7.9e-11	25.3
WP_016396737.1\|254830_255226_+	preprotein translocase subunit YajC	NA	NA	NA	NA
WP_016396736.1\|255319_256768_+	glucose-6-phosphate dehydrogenase	M4SIY3	Cyanophage	9.4e-58	31.2
WP_035165108.1\|256767_257883_+	DNA polymerase IV	NA	NA	NA	NA
WP_003615726.1\|257945_258905_+	bifunctional oligoribonuclease/PAP phosphatase NrnA	NA	NA	NA	NA
WP_003615724.1\|258897_260259_+	DEAD/DEAH box helicase	E3T5E1	Cafeteria_roenbergensis_virus	1.4e-47	30.4
WP_003615721.1\|260497_263131_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	7.9e-63	33.2
WP_003615719.1\|263196_263454_+	IreB family regulatory phosphoprotein	NA	NA	NA	NA
WP_002876575.1\|263453_263882_+	Holliday junction resolvase RuvX	NA	NA	NA	NA
WP_016396732.1\|263884_264208_+	DUF1292 domain-containing protein	NA	NA	NA	NA
WP_035162552.1\|264274_266635_+	endonuclease MutS2	Q94M10	Lactobacillus_phage	1.4e-21	50.4
WP_035164396.1\|266759_267809_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.2e-43	33.1
WP_016396729.1\|267980_268292_+	thioredoxin	A0A1J0GW78	Streptomyces_phage	1.1e-19	46.9
WP_013438997.1\|268360_269644_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.9e-58	33.3
WP_016396728.1\|269877_270273_-	YslB family protein	NA	NA	NA	NA
WP_003615712.1\|270511_271132_+	XTP/dITP diphosphatase	Q66YC8	Euphorbia_ringspot_virus	1.8e-10	28.5
WP_016396727.1\|271173_272025_-	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_016396726.1\|272156_272576_+	DUF948 domain-containing protein	NA	NA	NA	NA
WP_035162517.1\|272598_272976_+	hypothetical protein	NA	NA	NA	NA
WP_035165107.1\|273376_274483_-	aminopeptidase P family protein	NA	NA	NA	NA
WP_003615703.1\|274635_275637_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_002876592.1\|275743_276076_+	hypothetical protein	NA	NA	NA	NA
WP_035162512.1\|276086_277517_+	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_035162510.1\|277464_278010_+	YutD family protein	NA	NA	NA	NA
WP_035165105.1\|278006_278777_+	TIGR01457 family HAD-type hydrolase	NA	NA	NA	NA
WP_002876598.1\|278773_279379_+	TIGR01906 family membrane protein	NA	NA	NA	NA
WP_016396720.1\|279450_280110_-	VTT domain-containing protein	NA	NA	NA	NA
WP_078256836.1\|280144_281071_-	NAD(P)/FAD-dependent oxidoreductase	A0A2K9L162	Tupanvirus	2.0e-08	21.9
WP_035165099.1\|287448_288645_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.1e-141	67.6
WP_035162207.1\|288707_290156_+	MFS transporter	NA	NA	NA	NA
WP_035164983.1\|290362_291412_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.1e-42	32.8
WP_003615690.1\|291760_294175_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	66.7
WP_035165096.1\|294269_295889_+	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_072538183.1\|296086_297370_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	6.4e-58	33.3
WP_035162216.1\|297704_300119_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	3.0e-125	31.8
WP_013440320.1\|300290_301469_+\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

312123 : 356069

Streptococcus_phage(25.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072538184.1\|312123_313302_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_072538185.1\|314246_314630_+	sortase	NA	NA	NA	NA
WP_035165082.1\|314804_315509_+	L,D-transpeptidase	NA	NA	NA	NA
WP_003615669.1\|315634_316546_+	class II fructose-bisphosphate aldolase family protein	NA	NA	NA	NA
WP_002879784.1\|316640_317489_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_035162231.1\|317629_319717_+	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_016396947.1\|319758_320112_+	YlbF family regulator	NA	NA	NA	NA
WP_013439938.1\|320114_321320_+	DNA repair exonuclease	NA	NA	NA	NA
WP_072538186.1\|321316_323743_+	AAA family ATPase	NA	NA	NA	NA
WP_003613948.1\|323735_324686_+	HD domain-containing protein	NA	NA	NA	NA
WP_035165513.1\|325030_325393_+	shikimate kinase	NA	NA	NA	NA
WP_172822842.1\|325302_326022_+	chorismate synthase	NA	NA	NA	NA
WP_035162242.1\|326103_327027_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_035162245.1\|327153_327777_-	orotate phosphoribosyltransferase	Q58MW1	Prochlorococcus_phage	8.5e-08	26.0
WP_013439932.1\|327766_328489_-	orotidine-5'-phosphate decarboxylase	NA	NA	NA	NA
WP_035162250.1\|328752_329682_+	dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_003615649.1\|329761_330112_-	YtxH domain-containing protein	NA	NA	NA	NA
WP_025895565.1\|330128_330566_-	HIT family protein	Q19XP5	Mycobacterium_phage	3.9e-07	32.6
WP_035162252.1\|330669_331410_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.0e-20	29.4
WP_002879805.1\|331402_332620_+	ABC transporter permease	NA	NA	NA	NA
WP_002879806.1\|332696_333353_+\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_002879808.1\|333431_333752_+	thioredoxin family protein	NA	NA	NA	NA
WP_003611557.1\|333774_334422_+\|tRNA	DUF4479 and tRNA-binding domain-containing protein	NA	NA	NA	NA
WP_013439927.1\|334540_335860_+	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
WP_013439924.1\|336622_336847_+	FAD-binding protein	NA	NA	NA	NA
WP_013440320.1\|337665_338844_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_035160962.1\|339637_339820_+	hypothetical protein	NA	NA	NA	NA
WP_035160960.1\|339812_340160_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_013439920.1\|340215_340449_+	hypothetical protein	NA	NA	NA	NA
WP_035164407.1\|340405_341749_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.6e-48	29.9
WP_035165075.1\|342201_343383_-	class I SAM-dependent methyltransferase	A0A2K9L4K8	Tupanvirus	5.2e-46	35.9
WP_095582932.1\|343755_344958_+\|transposase	transposase	NA	NA	NA	NA
WP_035165071.1\|345146_346070_-	cysteine synthase A	A0A1X9I5F1	Streptococcus_phage	1.8e-107	64.7
WP_072538176.1\|346160_347210_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	8.1e-43	32.8
WP_035165069.1\|347364_348147_-	homoserine O-succinyltransferase	NA	NA	NA	NA
WP_003615571.1\|349737_352116_-	Xaa-Pro dipeptidyl-peptidase	NA	NA	NA	NA
WP_035165068.1\|352603_354742_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	1.6e-98	45.6
WP_013440320.1\|354890_356069_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

390377 : 437708

Prochlorococcus_phage(20.0%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003611980.1\|390377_391325_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	4.8e-10	32.1
WP_035165046.1\|391314_392631_+	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_072538191.1\|392636_393392_+	Stp1/IreP family PP2C-type Ser/Thr phosphatase	NA	NA	NA	NA
WP_035165045.1\|393381_395388_+	Stk1 family PASTA domain-containing Ser/Thr kinase	A0A1V0SD90	Indivirus	3.7e-20	26.3
WP_035165043.1\|395388_396282_+	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
WP_003615506.1\|396311_396995_+	thiamine diphosphokinase	NA	NA	NA	NA
WP_003615505.1\|397190_397328_+	hypothetical protein	NA	NA	NA	NA
WP_003618477.1\|397559_397802_+	hypothetical protein	NA	NA	NA	NA
WP_072538192.1\|397798_398509_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_072538193.1\|398668_399703_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.6e-43	32.9
WP_035165041.1\|399910_401482_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	3.2e-11	30.8
WP_003615500.1\|401582_401768_-	50S ribosomal protein L28	NA	NA	NA	NA
WP_002879711.1\|401943_402306_+	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_035161987.1\|402325_403990_+	DAK2 domain-containing protein	NA	NA	NA	NA
WP_003615494.1\|403989_406029_+	ATP-dependent DNA helicase RecG	NA	NA	NA	NA
WP_002879716.1\|406054_407047_+	phosphate acyltransferase PlsX	NA	NA	NA	NA
WP_003615490.1\|407108_407351_+	acyl carrier protein	E3SSM9	Prochlorococcus_phage	5.6e-08	55.2
WP_035164983.1\|407523_408573_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.1e-42	32.8
WP_013440320.1\|408762_409941_+\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_072538195.1\|410520_411744_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	1.6e-95	48.0
WP_072538196.1\|411866_413120_-\|transposase	transposase	NA	NA	NA	NA
WP_035162293.1\|413313_414306_-	adenosine deaminase	NA	NA	NA	NA
WP_035162291.1\|414522_414864_-	HIRAN domain-containing protein	NA	NA	NA	NA
WP_016396904.1\|415056_415986_+	DegV family protein	NA	NA	NA	NA
WP_035162289.1\|416074_416875_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	A0A218MNE0	uncultured_virus	2.9e-61	45.5
WP_035164347.1\|416920_417220_-	5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase	A0A218MNE0	uncultured_virus	5.0e-06	66.7
WP_035164349.1\|419302_419674_-	hypothetical protein	NA	NA	NA	NA
WP_035164351.1\|419774_420995_-	MFS transporter	NA	NA	NA	NA
WP_016396909.1\|421245_422583_-	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_016396910.1\|422720_423977_-	methionine gamma-lyase family protein	NA	NA	NA	NA
WP_035164353.1\|423982_424900_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_003614167.1\|424980_425382_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_003614169.1\|425444_425672_-	YqgQ family protein	NA	NA	NA	NA
WP_003614162.1\|425671_426343_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_003615603.1\|426335_426908_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_002879260.1\|426961_427111_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_016396914.1\|427197_429312_-	penicillin-binding protein 2	NA	NA	NA	NA
WP_003615605.1\|429397_431980_+	YfhO family protein	NA	NA	NA	NA
WP_003615606.1\|433688_434177_-	transcription elongation factor GreA	NA	NA	NA	NA
WP_035164357.1\|434247_436659_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_003615610.1\|436658_437708_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2I2L4E3	Orpheovirus	1.1e-31	34.9

DBSCAN-SWA_6

470816 : 609131

114

Streptococcus_phage(20.51%)

tRNA,integrase,transposase,protease

attL 540488:540547|attR 607708:609292

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072538199.1\|470816_471995_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_035165038.1\|472133_473900_+	oligopeptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_172822843.1\|474072_475815_+	oligopeptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002879727.1\|475939_476635_+	ribonuclease III	A0A2K9R4Y7	Dishui_lake_phycodnavirus	5.2e-22	34.1
WP_035165036.1\|476634_480195_+	chromosome segregation protein SMC	NA	NA	NA	NA
WP_003615484.1\|480197_481469_+	signal recognition particle-docking protein FtsY	NA	NA	NA	NA
WP_035165034.1\|481504_481687_+	hypothetical protein	NA	NA	NA	NA
WP_003615482.1\|481738_482080_+	transcriptional regulator	NA	NA	NA	NA
WP_003615481.1\|482081_483512_+	signal recognition particle protein	NA	NA	NA	NA
WP_002879737.1\|483605_483878_+	30S ribosomal protein S16	NA	NA	NA	NA
WP_003615480.1\|483939_484443_+	ribosome maturation factor RimM	NA	NA	NA	NA
WP_003615479.1\|484442_485174_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_035165031.1\|485193_488751_+	DEAD/DEAH box helicase	M1GYP4	Paramecium_bursaria_Chlorella_virus	1.6e-37	29.3
WP_003612033.1\|488872_489220_+	50S ribosomal protein L19	NA	NA	NA	NA
WP_003615476.1\|489486_491337_+	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_035165029.1\|491468_493367_+	TerB N-terminal domain-containing protein	NA	NA	NA	NA
WP_003615467.1\|493366_494689_+	ATP-binding protein	NA	NA	NA	NA
WP_035165027.1\|494712_496947_+	DEAD/DEAH box helicase	NA	NA	NA	NA
WP_003615463.1\|497003_497537_+	hypothetical protein	NA	NA	NA	NA
WP_035165026.1\|497732_498593_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_003615459.1\|498699_499548_-	sugar transporter	NA	NA	NA	NA
WP_002876773.1\|499747_500368_-	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	1.9e-15	58.2
WP_072538167.1\|500454_501822_-\|transposase	ISL3-like element ISLdl1 family transposase	A4PE56	Ralstonia_virus	4.2e-31	29.1
WP_035165024.1\|502038_502275_+	DUF896 domain-containing protein	NA	NA	NA	NA
WP_002876770.1\|502387_502612_+	YneF family protein	NA	NA	NA	NA
WP_003615455.1\|502722_504483_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	4.8e-48	27.8
WP_035162034.1\|504475_506266_+	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	1.6e-22	28.4
WP_003615452.1\|506314_506749_-	ACT domain-containing protein	NA	NA	NA	NA
WP_035161955.1\|506888_508037_+	homoserine dehydrogenase	NA	NA	NA	NA
WP_003615450.1\|508029_509244_+	aspartate kinase	NA	NA	NA	NA
WP_035161952.1\|509244_510231_+	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_003615448.1\|510312_510927_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003615447.1\|510997_512008_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_003615446.1\|512171_512933_+	30S ribosomal protein S2	NA	NA	NA	NA
WP_003615444.1\|512995_514024_+	elongation factor Ts	NA	NA	NA	NA
WP_002876740.1\|514173_514899_+	UMP kinase	NA	NA	NA	NA
WP_003615442.1\|514898_515456_+	ribosome recycling factor	NA	NA	NA	NA
WP_035165022.1\|515458_516190_+	isoprenyl transferase	R9W0U9	Flavobacterium_phage	2.4e-17	38.2
WP_002876734.1\|516195_516993_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_013439810.1\|517002_518250_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_035165020.1\|518289_519987_+\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_072538200.1\|519999_524337_+	PolC-type DNA polymerase III	A0A0A7RWA3	Clostridium_phage	9.8e-18	31.6
WP_002876725.1\|524445_524922_+	ribosome maturation factor RimP	NA	NA	NA	NA
WP_035165016.1\|524941_526093_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_002876722.1\|526102_526402_+	YlxR family protein	NA	NA	NA	NA
WP_002876720.1\|526428_526713_+	ribosomal L7Ae/L30e/S12e/Gadd45 family protein	NA	NA	NA	NA
WP_013439807.1\|526717_529195_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	2.3e-19	23.9
WP_002876717.1\|529207_529570_+	ribosome-binding factor A	NA	NA	NA	NA
WP_003615423.1\|529620_530517_+\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_049768352.1\|531412_531826_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_035165013.1\|532072_532630_-	serine acetyltransferase	NA	NA	NA	NA
WP_003615419.1\|532595_533780_-	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
WP_035161940.1\|533801_534713_-	cysteine synthase family protein	A0A1W6JIM2	Lactococcus_phage	2.8e-60	41.8
WP_072538202.1\|535696_536875_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_076612173.1\|537773_539036_-\|transposase	IS3-like element ISL6 family transposase	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7
WP_013440320.1\|539247_540426_+\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
540488:540547	attL	NA	NA	NA	NA
WP_072538204.1\|540669_541893_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.0e-97	49.2
WP_052109142.1\|543545_543962_+	Arm DNA-binding domain-containing protein	A0A1B0T6A8	Bacillus_phage	3.1e-06	29.7
WP_072538334.1\|545469_546063_+\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	6.0e-35	39.6
WP_003615411.1\|546176_547118_+	riboflavin biosynthesis protein RibF	A0A1V0SJE1	Klosneuvirus	1.8e-09	35.1
WP_035161325.1\|547253_548297_+	heat-inducible transcriptional repressor HrcA	NA	NA	NA	NA
WP_035161323.1\|548308_548908_+	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_035165012.1\|548969_550814_+	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	1.0e-141	49.3
WP_003615404.1\|550896_552036_+	molecular chaperone DnaJ	A0A0P0YNN4	Yellowstone_lake_phycodnavirus	3.1e-16	25.9
WP_013439791.1\|552157_553996_+	elongation factor 4	E4ZFJ7	Streptococcus_phage	1.5e-20	25.5
WP_003615401.1\|553976_554678_+	class A sortase	NA	NA	NA	NA
WP_035165010.1\|554674_556951_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	4.7e-72	32.4
WP_035161317.1\|556940_557468_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	6.5e-25	41.8
WP_003615398.1\|557547_557850_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003615397.1\|557961_558849_+	cation transporter	NA	NA	NA	NA
WP_002876681.1\|559050_560076_+	branched-chain amino acid aminotransferase	NA	NA	NA	NA
WP_016396499.1\|560192_561326_+	AI-2E family transporter	NA	NA	NA	NA
WP_035165008.1\|561434_562382_-	LCP family protein	NA	NA	NA	NA
WP_035164407.1\|564381_565725_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.6e-48	29.9
WP_013439920.1\|565681_565915_-	hypothetical protein	NA	NA	NA	NA
WP_035160960.1\|565970_566318_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_035160962.1\|566310_566493_-	hypothetical protein	NA	NA	NA	NA
WP_003615387.1\|567162_568017_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003615385.1\|568064_569567_-	ABC transporter substrate-binding protein/permease	NA	NA	NA	NA
WP_172586620.1\|569587_570319_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.2e-29	38.9
WP_003615383.1\|570836_571445_+	DUF4230 domain-containing protein	NA	NA	NA	NA
WP_002879863.1\|571701_572979_-	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	9.3e-110	51.4
WP_035161302.1\|573286_574123_+	DegV family protein	A0A1X9I5J4	Streptococcus_phage	5.6e-47	39.7
WP_003615376.1\|574218_574806_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_035161299.1\|575078_575876_+	hypothetical protein	NA	NA	NA	NA
WP_003615372.1\|575946_576849_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_072538205.1\|577135_578170_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.1e-43	32.9
WP_035165003.1\|578482_580216_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.6e-38	26.6
WP_035161295.1\|580212_581985_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.3e-50	26.8
WP_003615366.1\|582461_582653_+	hypothetical protein	NA	NA	NA	NA
WP_035165502.1\|582751_583048_+	EAL domain-containing protein	NA	NA	NA	NA
WP_002880208.1\|583121_583367_+	hypothetical protein	NA	NA	NA	NA
WP_035165001.1\|583401_584301_-	YitT family protein	M1Q1P6	Streptococcus_phage	9.6e-53	40.5
WP_072538167.1\|584361_585729_-\|transposase	ISL3-like element ISLdl1 family transposase	A4PE56	Ralstonia_virus	4.2e-31	29.1
WP_035164999.1\|585888_587079_+\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	5.2e-46	33.6
WP_072538196.1\|587251_588505_+\|transposase	transposase	NA	NA	NA	NA
WP_072538195.1\|588627_589851_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	1.6e-95	48.0
WP_072538207.1\|590439_591489_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	4.0e-42	32.8
WP_072538208.1\|591602_592283_-	hemolysin III family protein	NA	NA	NA	NA
WP_002880203.1\|592418_593264_+	DegV family protein	A0A0N9SI50	Staphylococcus_phage	1.0e-19	45.0
WP_003613715.1\|593267_593498_+	YozE family protein	NA	NA	NA	NA
WP_003615353.1\|593572_594430_+	ribosome biogenesis GTPase YlqF	NA	NA	NA	NA
WP_035164995.1\|594419_595190_+	ribonuclease HII	E3T5H8	Cafeteria_roenbergensis_virus	2.0e-27	42.0
WP_003615351.1\|595280_596120_+	DNA-protecting protein DprA	NA	NA	NA	NA
WP_003615350.1\|596246_598421_+	type I DNA topoisomerase	A0A1V0SCS0	Indivirus	1.0e-92	34.9
WP_035164994.1\|598552_599872_+\|tRNA	methylenetetrahydrofolate--tRNA-(uracil(54)- C(5))-methyltransferase (FADH(2)-oxidizing) TrmFO	NA	NA	NA	NA
WP_072538209.1\|599871_600759_+	tyrosine recombinase XerC	A0A1P8DJJ6	Virus_Rctr41k	2.5e-21	31.5
WP_003613136.1\|600867_601401_+\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_003615348.1\|601403_602798_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A1B2IEP8	Erwinia_phage	4.0e-37	27.8
WP_035164992.1\|602883_603780_+	aldose 1-epimerase family protein	NA	NA	NA	NA
WP_130137519.1\|604344_604653_+	hypothetical protein	NA	NA	NA	NA
WP_035164985.1\|605244_605952_+	hypothetical protein	NA	NA	NA	NA
WP_072538204.1\|606361_607585_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.0e-97	49.2
WP_035164983.1\|608081_609131_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.1e-42	32.8
607708:609292	attR	NA	NA	NA	NA

DBSCAN-SWA_7

619745 : 692152

Vibrio_phage(13.33%)

tRNA,integrase,transposase

attL 655747:655806|attR 681784:681851

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003615321.1\|619745_620657_+\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
WP_035164978.1\|620649_622716_+\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_035161268.1\|622747_624586_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	2.3e-56	35.4
WP_003615317.1\|624557_625676_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.2e-36	34.8
WP_003613006.1\|625717_626839_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	5.8e-39	37.4
WP_035164975.1\|626874_628011_+	sigma-70 family RNA polymerase sigma factor	G8CLC7	Synechococcus_phage	3.9e-35	35.5
WP_035164409.1\|628168_628351_+	hypothetical protein	NA	NA	NA	NA
WP_035160960.1\|628343_628691_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_013439920.1\|628746_628980_+	hypothetical protein	NA	NA	NA	NA
WP_035164407.1\|628936_630280_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.6e-48	29.9
WP_013440320.1\|630403_631582_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_003612998.1\|631782_631905_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003617847.1\|631911_632157_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_143434649.1\|632367_633773_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.4e-42	40.7
WP_072538214.1\|635353_636544_+	glycosyltransferase	NA	NA	NA	NA
WP_155760731.1\|636567_636714_+	hypothetical protein	NA	NA	NA	NA
WP_035164970.1\|637406_638492_+	hypothetical protein	NA	NA	NA	NA
WP_035164969.1\|638425_638746_+	hypothetical protein	NA	NA	NA	NA
WP_035164968.1\|638972_640355_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	G3MB42	Bacillus_virus	8.1e-51	33.7
WP_035164983.1\|641258_642308_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.1e-42	32.8
WP_013440320.1\|645699_646878_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_011543955.1\|649015_649639_+	DUF4391 domain-containing protein	NA	NA	NA	NA
WP_013440320.1\|651281_652460_+\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_013440320.1\|654508_655687_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
655747:655806	attL	NA	NA	NA	NA
WP_003615282.1\|657541_657874_+	hypothetical protein	NA	NA	NA	NA
WP_035160962.1\|658191_658374_+	hypothetical protein	NA	NA	NA	NA
WP_035160960.1\|658366_658714_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_013439920.1\|658769_659003_+	hypothetical protein	NA	NA	NA	NA
WP_035164407.1\|658959_660303_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.6e-48	29.9
WP_072538218.1\|661314_661647_+	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	1.3e-15	44.2
WP_035164960.1\|661692_662499_-	M23 family metallopeptidase	NA	NA	NA	NA
WP_016396558.1\|662498_662939_-	8-oxo-dGTP diphosphatase	NA	NA	NA	NA
WP_002878610.1\|663084_663777_+	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_035164957.1\|663769_664567_+	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_035164956.1\|664610_665849_+	peptidase T	NA	NA	NA	NA
WP_002878604.1\|666235_666427_-	hypothetical protein	NA	NA	NA	NA
WP_003615265.1\|666496_667063_-	signal peptidase I	NA	NA	NA	NA
WP_035164955.1\|667106_667943_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_052109140.1\|668163_668475_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_035164953.1\|668543_669134_+	sugar O-acetyltransferase	NA	NA	NA	NA
WP_035164951.1\|670771_672655_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_035164949.1\|672658_675682_+	DUF4981 domain-containing protein	L0N6M2	Herpes_simplex_virus	2.8e-136	32.4
WP_051112117.1\|675724_676732_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	6.8e-15	26.2
WP_035164946.1\|676797_678096_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	2.1e-53	28.6
WP_016396563.1\|678171_679188_-	aspartate--ammonia ligase	NA	NA	NA	NA
WP_035161213.1\|679555_680170_-	DedA family protein	NA	NA	NA	NA
WP_035164945.1\|680603_681104_+	hypothetical protein	NA	NA	NA	NA
WP_035161211.1\|681184_681688_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_035164942.1\|681942_687672_+	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	6.4e-09	30.8
681784:681851	attR	NA	NA	NA	NA
WP_035164940.1\|687974_689147_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_072538219.1\|691045_692152_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.0e-88	46.0

DBSCAN-SWA_8

700279 : 759458

unidentified_phage(33.33%)

integrase,transposase,protease

attL 747295:747354|attR 758354:759595

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003615229.1\|700279_701032_-\|protease	PrsW family intramembrane metalloprotease	NA	NA	NA	NA
WP_003615228.1\|701110_701722_+	pyroglutamyl-peptidase I	NA	NA	NA	NA
WP_002880372.1\|701869_702067_+	hypothetical protein	NA	NA	NA	NA
WP_035164935.1\|702176_702917_+	hypothetical protein	NA	NA	NA	NA
WP_003615224.1\|702916_703891_+	hypothetical protein	NA	NA	NA	NA
WP_072538220.1\|703883_705308_+	RsmF rRNA methyltransferase first C-terminal domain-containing protein	NA	NA	NA	NA
WP_035164933.1\|705352_706201_+	LD-carboxypeptidase	NA	NA	NA	NA
WP_002880363.1\|706247_706442_+	hypothetical protein	NA	NA	NA	NA
WP_035164983.1\|711191_712241_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.1e-42	32.8
WP_035164931.1\|713044_713779_+	methylase	A0A126HHW9	Vibrio_phage	4.2e-06	36.3
WP_035164929.1\|714590_715364_+	YdcF family protein	NA	NA	NA	NA
WP_035164926.1\|715377_715881_+	DUF4256 domain-containing protein	NA	NA	NA	NA
WP_035164924.1\|715900_716569_+	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_072538195.1\|717028_718252_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	1.6e-95	48.0
WP_035164922.1\|718573_719014_+	LytTR family transcriptional regulator	NA	NA	NA	NA
WP_035164920.1\|719026_719461_+	DUF3021 domain-containing protein	NA	NA	NA	NA
WP_035164918.1\|719588_720920_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_016396592.1\|721282_721633_+	VWA domain containing CoxE-like protein	NA	NA	NA	NA
WP_016396593.1\|721641_722910_+	hypothetical protein	NA	NA	NA	NA
WP_072538223.1\|722956_723943_-	diaminopimelate epimerase	NA	NA	NA	NA
WP_035164916.1\|723944_725318_-	aspartate kinase	NA	NA	NA	NA
WP_003615201.1\|725830_726544_+	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase	NA	NA	NA	NA
WP_035164914.1\|726604_727759_+	N-acetyldiaminopimelate deacetylase	NA	NA	NA	NA
WP_072538224.1\|727782_728712_+	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_035164911.1\|728714_729494_+	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_035164909.1\|729530_730712_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_003614261.1\|730828_731416_+	peptidylprolyl isomerase	A0A1V0S9I2	Catovirus	9.1e-28	43.4
WP_035164907.1\|731447_731984_+	SLAP domain-containing protein	NA	NA	NA	NA
WP_003615189.1\|732209_732767_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_035164396.1\|732975_734025_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.2e-43	33.1
WP_002880312.1\|734714_734921_-	hypothetical protein	NA	NA	NA	NA
WP_165380480.1\|735211_735388_+	hypothetical protein	NA	NA	NA	NA
WP_003615178.1\|736285_737206_-	FAD-binding protein	NA	NA	NA	NA
WP_003615177.1\|737198_737744_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_076612173.1\|738425_739688_+\|transposase	IS3-like element ISL6 family transposase	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7
WP_035161164.1\|739753_741628_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_003615174.1\|741650_742403_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.3e-33	39.5
WP_016396605.1\|743105_743504_-	arsenate reductase ArsC	A0A2H4PQT9	Staphylococcus_phage	2.4e-11	35.9
WP_172822838.1\|743516_743927_-	hypothetical protein	NA	NA	NA	NA
WP_016396607.1\|744085_744550_-	DUF2798 domain-containing protein	NA	NA	NA	NA
WP_016396608.1\|744766_745627_-	ABC transporter permease	NA	NA	NA	NA
WP_035164903.1\|745623_746538_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	7.8e-26	34.8
WP_072538225.1\|746842_747319_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
747295:747354	attL	NA	NA	NA	NA
WP_035164396.1\|747349_748399_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.2e-43	33.1
WP_003615159.1\|748756_749398_-\|integrase	tyrosine-type recombinase/integrase	A3F636	Streptococcus_phage	2.3e-24	34.9
WP_016396610.1\|749720_750458_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_035165474.1\|750604_751894_+	MATE family efflux transporter	NA	NA	NA	NA
WP_035164899.1\|754007_757208_+	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_035164897.1\|757572_758322_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_035164396.1\|758408_759458_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.2e-43	33.1
758354:759595	attR	NA	NA	NA	NA

DBSCAN-SWA_9

765570 : 840646

Streptococcus_phage(25.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013440320.1\|765570_766749_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_013440320.1\|768377_769556_+\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_016396647.1\|771426_772626_-	tryptophan synthase subunit beta	NA	NA	NA	NA
WP_035164894.1\|773049_773709_+	DUF4163 domain-containing protein	NA	NA	NA	NA
WP_035164892.1\|773729_774395_+	hypothetical protein	NA	NA	NA	NA
WP_016396650.1\|774458_774779_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_072538226.1\|775141_776848_-\|transposase	transposase	NA	NA	NA	NA
WP_003614608.1\|776816_777485_-\|transposase	IS607 family transposase	A0A7Q0	Microcystis_virus	5.7e-50	49.8
WP_016396652.1\|778238_779549_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_003615103.1\|780740_781319_-	sel1 repeat family protein	NA	NA	NA	NA
WP_172822839.1\|781342_782512_-	DUF2325 domain-containing protein	NA	NA	NA	NA
WP_003615100.1\|782649_783798_-	glycerate kinase	W6LM47	Streptococcus_phage	1.7e-41	35.5
WP_035164889.1\|784020_785097_+	tyrosine recombinase XerS	A0A0E3XA96	Gordonia_phage	1.6e-06	29.6
WP_035164888.1\|785165_786449_-	dihydroorotase	NA	NA	NA	NA
WP_035161096.1\|786448_787459_-	aspartate carbamoyltransferase catalytic subunit	NA	NA	NA	NA
WP_035161094.1\|787863_788382_+	nitroreductase family protein	NA	NA	NA	NA
WP_003615092.1\|788571_788913_+	ABC transporter permease	NA	NA	NA	NA
WP_003615090.1\|788971_789595_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_035164983.1\|789793_790843_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.1e-42	32.8
WP_035164886.1\|791190_792273_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	2.2e-80	44.8
WP_035161091.1\|792291_793467_+	3-phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	1.6e-103	47.8
WP_003615080.1\|793667_794579_+	EamA family transporter	NA	NA	NA	NA
WP_072538167.1\|795656_797024_-\|transposase	ISL3-like element ISLdl1 family transposase	A4PE56	Ralstonia_virus	4.2e-31	29.1
WP_035161089.1\|798517_799930_-\|transposase	transposase	A0A2I7RKG5	Vibrio_phage	1.4e-10	34.0
WP_003611707.1\|799996_800458_+\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	4.8e-40	58.1
WP_002876831.1\|800610_802302_+	fibronectin/fibrinogen-binding protein	Q84500	Paramecium_bursaria_Chlorella_virus	1.9e-09	40.2
WP_002876840.1\|802368_803712_-	PFL family protein	NA	NA	NA	NA
WP_002876842.1\|803711_803993_-	ACT domain-containing protein	NA	NA	NA	NA
WP_072538227.1\|804086_807278_-	carbamoyl phosphate synthase large subunit	NA	NA	NA	NA
WP_002876844.1\|807277_808333_-	carbamoyl phosphate synthase small subunit	NA	NA	NA	NA
WP_016396669.1\|808334_809249_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_002876847.1\|809250_809703_-	signal peptidase II	NA	NA	NA	NA
WP_035164884.1\|809714_811394_-	formate--tetrahydrofolate ligase	NA	NA	NA	NA
WP_035164882.1\|811386_811743_-	hypothetical protein	NA	NA	NA	NA
WP_171031045.1\|811897_813124_-	metallophosphoesterase	NA	NA	NA	NA
WP_016396673.1\|813139_814264_-	class I SAM-dependent RNA methyltransferase	NA	NA	NA	NA
WP_003615059.1\|814781_815246_-	cell division regulator GpsB	NA	NA	NA	NA
WP_013439504.1\|815321_815882_-	DUF1273 domain-containing protein	NA	NA	NA	NA
WP_003615052.1\|816042_816675_+	Holliday junction resolvase RecU	A0A2H4J3A4	uncultured_Caudovirales_phage	9.5e-23	36.9
WP_035164880.1\|816661_818974_+	transglycosylase domain-containing protein	NA	NA	NA	NA
WP_016396676.1\|819120_821049_+	S9 family peptidase	NA	NA	NA	NA
WP_003613508.1\|821097_822099_+	D-2-hydroxyacid dehydrogenase	M1I4S0	Paramecium_bursaria_Chlorella_virus	2.3e-39	33.8
WP_003615044.1\|822259_822688_+	hypothetical protein	NA	NA	NA	NA
WP_120490347.1\|822681_823167_+	prolyl oligopeptidase family serine peptidase	NA	NA	NA	NA
WP_003615040.1\|823201_824005_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002878412.1\|824039_824669_-	endonuclease III	NA	NA	NA	NA
WP_002878410.1\|824690_825338_-	DnaD domain protein	NA	NA	NA	NA
WP_035164878.1\|825428_826727_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	2.1e-53	28.6
WP_002878598.1\|826788_827283_-	hypothetical protein	NA	NA	NA	NA
WP_035164877.1\|827275_830068_-	DEAD/DEAH box helicase	A0A1X9I5C8	Streptococcus_phage	7.1e-62	33.3
WP_035164875.1\|830096_833780_-	helicase-exonuclease AddAB subunit AddA	A7KV33	Bacillus_phage	6.4e-26	26.4
WP_072538229.1\|833806_837346_-	PD-(D/E)XK nuclease family protein	NA	NA	NA	NA
WP_035161077.1\|837479_838391_+	mevalonate kinase	NA	NA	NA	NA
WP_003615028.1\|838446_839406_+	diphosphomevalonate decarboxylase	NA	NA	NA	NA
WP_035164983.1\|839596_840646_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.1e-42	32.8

DBSCAN-SWA_10

850306 : 900644

Streptococcus_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072538230.1\|850306_852058_-\|transposase	transposase	NA	NA	NA	NA
WP_078256844.1\|852244_852526_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_072538232.1\|852999_853257_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_072538230.1\|853504_855256_+\|transposase	transposase	NA	NA	NA	NA
WP_016396090.1\|855227_855452_+	hypothetical protein	NA	NA	NA	NA
WP_003613446.1\|855617_856478_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_013440320.1\|857035_858214_+\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_003626333.1\|858613_859288_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_016396698.1\|859268_859928_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003613477.1\|860303_860711_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_003615002.1\|860703_860901_+	DUF2255 family protein	NA	NA	NA	NA
WP_078256824.1\|861198_861468_+\|transposase	transposase	NA	NA	NA	NA
WP_003614996.1\|861889_862426_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_003614994.1\|862437_863529_-	dihydropteroate synthase	NA	NA	NA	NA
WP_003614993.1\|863518_864856_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_003614992.1\|864839_865913_-	GTP cyclohydrolase I FolE	A0A2I7S8W4	Vibrio_phage	3.2e-34	40.7
WP_003614991.1\|865909_866260_-	dihydroneopterin aldolase	NA	NA	NA	NA
WP_072538235.1\|866952_868008_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.2e-43	32.8
WP_013440320.1\|868028_869207_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_072538236.1\|869948_871172_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	1.1e-96	49.0
WP_172822840.1\|872621_873254_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_072538166.1\|873535_874759_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	1.3e-97	49.2
WP_035172629.1\|875590_876412_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_003614986.1\|876511_877093_-	hypothetical protein	NA	NA	NA	NA
WP_003614984.1\|877099_878128_-	GGDEF domain-containing protein	NA	NA	NA	NA
WP_003614981.1\|879914_880529_+	membrane protein	NA	NA	NA	NA
WP_035164853.1\|880525_881302_+	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_035164851.1\|881280_882099_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.0e-12	31.3
WP_035164848.1\|882088_882856_+	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	3.3e-09	28.9
WP_035164846.1\|883102_884653_+	YfcC family protein	NA	NA	NA	NA
WP_016396711.1\|885013_885565_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_155760732.1\|885645_887069_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	5.1e-40	39.4
WP_155114309.1\|887158_887302_-	hypothetical protein	NA	NA	NA	NA
WP_003614970.1\|887378_888035_+	NUDIX hydrolase	NA	NA	NA	NA
WP_035164842.1\|888783_890442_-	GHKL domain-containing protein	W8CYF6	Bacillus_phage	2.3e-31	35.1
WP_002878532.1\|890441_891119_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.2e-32	38.2
WP_003614960.1\|891204_891843_-	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_002878529.1\|891861_892620_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.9e-18	33.5
WP_003614664.1\|892619_893495_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_003614665.1\|893497_894406_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_003614957.1\|894425_895310_-	phosphate ABC transporter substrate-binding protein	Q58MA7	Prochlorococcus_phage	1.8e-06	24.5
WP_035161066.1\|895816_896581_+	hypothetical protein	NA	NA	NA	NA
WP_003614953.1\|896660_896810_-	hypothetical protein	NA	NA	NA	NA
WP_172822844.1\|896747_897224_+	EAL domain-containing protein	NA	NA	NA	NA
WP_002878518.1\|897365_897608_-	hypothetical protein	NA	NA	NA	NA
WP_035164838.1\|897698_899312_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_013438997.1\|899360_900644_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.9e-58	33.3

DBSCAN-SWA_11

974510 : 1045264

Streptococcus_phage(12.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072538167.1\|974510_975878_+\|transposase	ISL3-like element ISLdl1 family transposase	A4PE56	Ralstonia_virus	4.2e-31	29.1
WP_035164983.1\|976022_977072_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.1e-42	32.8
WP_003617644.1\|977249_978503_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_002877566.1\|978619_978895_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	5.8e-25	69.7
WP_003617643.1\|979098_980406_-	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_003617641.1\|980482_981688_-	30S ribosomal protein S1	NA	NA	NA	NA
WP_003617639.1\|981776_982454_-	(d)CMP kinase	NA	NA	NA	NA
WP_035164793.1\|982506_982902_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_013439397.1\|983011_983716_-	ECF transporter S component	NA	NA	NA	NA
WP_002877577.1\|983937_984657_-	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_003617634.1\|984656_985259_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	4.8e-16	31.3
WP_035164791.1\|985248_985983_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	9.7e-11	24.4
WP_002877582.1\|985972_986326_-	hypothetical protein	NA	NA	NA	NA
WP_035162482.1\|986336_987242_-	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	1.5e-37	31.4
WP_003617625.1\|987225_988104_-	RNA-binding protein	NA	NA	NA	NA
WP_003617623.1\|988294_988717_+	acyltransferase family protein	NA	NA	NA	NA
WP_035162484.1\|989399_991169_-	pyruvate kinase	A0A2H4PQU5	Staphylococcus_phage	2.1e-11	35.7
WP_035164789.1\|991208_992168_-	6-phosphofructokinase	NA	NA	NA	NA
WP_052109134.1\|992376_995856_-	DNA polymerase III subunit alpha	A0A0K1Y8F0	Streptomyces_phage	1.2e-103	29.9
WP_003617612.1\|995990_996191_+	YjzD family protein	NA	NA	NA	NA
WP_002877611.1\|996308_997385_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	7.1e-127	66.4
WP_035162488.1\|997407_998655_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	4.6e-138	62.8
WP_002877626.1\|998669_999443_+	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	1.1e-76	56.4
WP_016396294.1\|999518_999917_-	UTRA domain-containing protein	NA	NA	NA	NA
WP_002879208.1\|1000012_1000576_-	TIGR01440 family protein	NA	NA	NA	NA
WP_003617602.1\|1000723_1000975_+	hypothetical protein	NA	NA	NA	NA
WP_003617601.1\|1001000_1001192_+	hypothetical protein	NA	NA	NA	NA
WP_016396297.1\|1001188_1003090_-	DEAD/DEAH box helicase	D2J050	Enterococcus_phage	2.2e-107	46.8
WP_016396298.1\|1003175_1004741_-	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_003614010.1\|1004808_1005000_-	50S ribosomal protein L32	NA	NA	NA	NA
WP_035164784.1\|1005114_1005909_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_035164782.1\|1005919_1006849_-	ribonuclease Z	NA	NA	NA	NA
WP_035164780.1\|1006885_1008820_-	acetyltransferase	A0A1R3Y5Q6	Salmonella_virus	1.1e-24	28.8
WP_003614004.1\|1008872_1010195_-	GTPase ObgE	NA	NA	NA	NA
WP_016396303.1\|1010263_1012066_-	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_003617587.1\|1012338_1013277_+	nucleoside hydrolase	NA	NA	NA	NA
WP_035162491.1\|1013333_1015103_-	DNA helicase RecQ	A0A1V0SBK0	Catovirus	4.3e-81	37.1
WP_035164778.1\|1015176_1016127_-	dihydrofolate reductase	A0A1V0SBV6	Catovirus	3.2e-30	30.3
WP_016396307.1\|1016128_1017103_-	amidohydrolase	NA	NA	NA	NA
WP_016396308.1\|1017231_1018431_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	3.6e-47	35.0
WP_002879191.1\|1018442_1018916_-	arginine repressor	NA	NA	NA	NA
WP_003617563.1\|1019135_1020833_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	2.0e-75	33.7
WP_002879186.1\|1021066_1021981_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_035164776.1\|1022104_1023310_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_052109133.1\|1023541_1023868_+	5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase	NA	NA	NA	NA
WP_016396311.1\|1030488_1031886_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	6.7e-53	31.9
WP_072538240.1\|1032074_1033124_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	32.8
WP_016396312.1\|1033307_1034021_-	ABC transporter permease	NA	NA	NA	NA
WP_035161910.1\|1034017_1035073_-	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.2e-27	35.0
WP_003617549.1\|1035109_1035970_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_035164772.1\|1036369_1038757_-	HAD-IC family P-type ATPase	A0A1J0FA34	Only_Syngen_Nebraska_virus	2.6e-36	24.6
WP_003617545.1\|1038790_1039279_-	dihydrofolate reductase	G3MBI7	Bacillus_virus	1.2e-25	40.9
WP_003617542.1\|1039292_1040249_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	2.0e-112	59.6
WP_016396315.1\|1040422_1041415_-	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	6.7e-39	34.7
WP_052109132.1\|1041675_1042368_+\|transposase	IS607 family transposase	A0A7Q0	Microcystis_virus	3.9e-46	48.7
WP_013440320.1\|1042762_1043941_+\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_072538242.1\|1044010_1045264_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_12

1177851 : 1244098

Streptococcus_phage(27.78%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002879996.1\|1177851_1178337_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_035164698.1\|1178347_1179337_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_003617311.1\|1179357_1180041_-	uracil-DNA glycosylase	S4VYQ4	Pandoravirus	1.4e-43	43.7
WP_003617309.1\|1180201_1181086_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_003617307.1\|1181082_1181652_+	hypothetical protein	NA	NA	NA	NA
WP_035164696.1\|1181608_1182175_-	N-acetyltransferase	NA	NA	NA	NA
WP_072538245.1\|1182348_1183398_+\|transposase	IS30-like element ISL7 family transposase	H7BWC8	unidentified_phage	3.6e-43	33.1
WP_002879988.1\|1183901_1184660_-	triose-phosphate isomerase	NA	NA	NA	NA
WP_002879986.1\|1184678_1185890_-	phosphoglycerate kinase	NA	NA	NA	NA
WP_035164695.1\|1185985_1187002_-	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_035165447.1\|1187039_1188083_-	sugar-binding domain-containing protein	NA	NA	NA	NA
WP_003614741.1\|1188534_1189299_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.8e-12	26.3
WP_002879980.1\|1189291_1190188_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_003617297.1\|1190206_1191187_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_035164693.1\|1191530_1193024_-	SH3-like domain-containing protein	NA	NA	NA	NA
WP_002879977.1\|1193207_1193792_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	2.2e-53	56.0
WP_035164691.1\|1193859_1194792_-	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	1.8e-46	34.2
WP_003617289.1\|1194799_1195819_-	YvcK family protein	A1IMD5	Streptococcus_phage	6.4e-85	50.5
WP_002879973.1\|1195828_1196707_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	1.3e-09	29.9
WP_003617280.1\|1198554_1199097_-	DUF308 domain-containing protein	NA	NA	NA	NA
WP_035164688.1\|1199193_1202052_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.3e-305	56.0
WP_035164686.1\|1202041_1204084_-	excinuclease ABC subunit UvrB	NA	NA	NA	NA
WP_002879964.1\|1204204_1205137_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	5.4e-75	46.1
WP_035164684.1\|1205208_1206225_-	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_003617271.1\|1206230_1207064_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_035165444.1\|1207063_1208023_-	HPr kinase/phosphorylase	NA	NA	NA	NA
WP_003617266.1\|1207997_1208300_-	hypothetical protein	NA	NA	NA	NA
WP_120490266.1\|1208310_1209427_-	peptide chain release factor 2	NA	NA	NA	NA
WP_035164681.1\|1209514_1211917_-	preprotein translocase subunit SecA	NA	NA	NA	NA
WP_002879957.1\|1212076_1212634_-	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_076612173.1\|1213050_1214313_+\|transposase	IS3-like element ISL6 family transposase	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7
WP_003617258.1\|1214858_1216136_-	DEAD/DEAH box helicase	A0A1X9I5S6	Streptococcus_phage	3.1e-81	43.1
WP_013439246.1\|1216179_1216839_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	2.0e-39	43.5
WP_003617254.1\|1216891_1218091_-	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
WP_003617251.1\|1218194_1219838_-	ribonuclease Y	NA	NA	NA	NA
WP_002877009.1\|1219986_1221096_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	5.6e-119	61.2
WP_002877019.1\|1221302_1221866_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_035164677.1\|1221910_1223053_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_035164676.1\|1223121_1223850_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_003617243.1\|1223846_1225100_-	insulinase family protein	NA	NA	NA	NA
WP_035164674.1\|1225096_1226320_-	insulinase family protein	NA	NA	NA	NA
WP_035164672.1\|1226325_1228692_-	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	1.1e-84	48.5
WP_002877037.1\|1228711_1229107_-	DUF1149 family protein	NA	NA	NA	NA
WP_002877038.1\|1229137_1229695_-\|tRNA	tRNA (cytidine(34)-2'-O)-methyltransferase	NA	NA	NA	NA
WP_003617232.1\|1229691_1230882_-	AI-2E family transporter	NA	NA	NA	NA
WP_003614100.1\|1230891_1231272_-	PTS glucitol/sorbitol transporter subunit IIA	NA	NA	NA	NA
WP_035164670.1\|1231436_1232447_+	lactonase family protein	NA	NA	NA	NA
WP_072538167.1\|1232553_1233921_+\|transposase	ISL3-like element ISLdl1 family transposase	A4PE56	Ralstonia_virus	4.2e-31	29.1
WP_035164668.1\|1234054_1234882_+	undecaprenyl-diphosphate phosphatase	NA	NA	NA	NA
WP_035164666.1\|1234953_1235142_+	hypothetical protein	NA	NA	NA	NA
WP_035164664.1\|1235227_1236121_-	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	7.7e-10	29.9
WP_035164662.1\|1236135_1236933_-	NAD kinase	NA	NA	NA	NA
WP_002877053.1\|1236929_1237562_-	GTP pyrophosphokinase family protein	NA	NA	NA	NA
WP_035161747.1\|1237665_1238268_+	CYTH domain-containing protein	NA	NA	NA	NA
WP_003617218.1\|1238348_1238993_+	DsbA family protein	NA	NA	NA	NA
WP_003617215.1\|1239005_1239866_-	competence protein	NA	NA	NA	NA
WP_072538247.1\|1240179_1241403_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	1.9e-96	48.5
WP_035162386.1\|1241625_1242375_-	adaptor protein MecA	NA	NA	NA	NA
WP_035164660.1\|1242477_1242882_-	transcriptional regulator Spx	NA	NA	NA	NA
WP_072538248.1\|1243048_1244098_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	8.1e-43	33.1

DBSCAN-SWA_13

1284109 : 1421082

104

unidentified_phage(17.86%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013440320.1\|1284109_1285288_+\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_072538250.1\|1285319_1286597_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	7.0e-57	32.9
WP_002877995.1\|1286709_1287432_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002877998.1\|1287440_1288376_-	nucleoside hydrolase	NA	NA	NA	NA
WP_076612173.1\|1288481_1289744_-\|transposase	IS3-like element ISL6 family transposase	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7
WP_003617150.1\|1289932_1290625_-	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_003617149.1\|1290637_1291288_-	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_035164637.1\|1291303_1292224_-	ribokinase	NA	NA	NA	NA
WP_035164635.1\|1292290_1292788_-	hypothetical protein	NA	NA	NA	NA
WP_003617143.1\|1292935_1293181_-	hypothetical protein	NA	NA	NA	NA
WP_003617141.1\|1293197_1293833_-	hypothetical protein	NA	NA	NA	NA
WP_072538342.1\|1293933_1295136_-\|transposase	transposase	NA	NA	NA	NA
WP_035164632.1\|1295579_1296497_-	DUF2974 domain-containing protein	NA	NA	NA	NA
WP_035164631.1\|1296493_1297891_-	DUF2252 domain-containing protein	NA	NA	NA	NA
WP_035164629.1\|1297899_1300065_-	RNA degradosome polyphosphate kinase	NA	NA	NA	NA
WP_003617134.1\|1300068_1301580_-	HD domain-containing protein	NA	NA	NA	NA
WP_035164628.1\|1301785_1302631_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_002878011.1\|1302672_1303341_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_002878013.1\|1303352_1303994_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003617129.1\|1303993_1304833_-	glutamate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003617127.1\|1304854_1305595_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-33	41.7
WP_003617126.1\|1306137_1306794_+	uridine kinase	A0A1V0SAA3	Catovirus	9.9e-39	39.7
WP_016395746.1\|1306793_1307420_+	uridine kinase	A0A1V0SAA3	Catovirus	7.2e-39	42.8
WP_016395747.1\|1307749_1308319_-	ECF transporter S component	NA	NA	NA	NA
WP_003617119.1\|1308526_1309612_-	M42 family peptidase	NA	NA	NA	NA
WP_035164622.1\|1309625_1311047_-	C69 family dipeptidase	NA	NA	NA	NA
WP_003617115.1\|1311124_1311910_-	glutamate racemase	NA	NA	NA	NA
WP_002878038.1\|1312176_1312890_+	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_035164620.1\|1313024_1314224_+	MFS transporter	NA	NA	NA	NA
WP_035162331.1\|1315987_1316353_+	hypothetical protein	NA	NA	NA	NA
WP_003617107.1\|1316514_1316637_+	hypothetical protein	NA	NA	NA	NA
WP_035164618.1\|1316696_1318319_-	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	3.2e-46	25.5
WP_035162383.1\|1318712_1321442_+	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
WP_003617099.1\|1321566_1322712_-	mannitol-1-phosphate 5-dehydrogenase	NA	NA	NA	NA
WP_003611502.1\|1322714_1323164_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_035164615.1\|1325218_1327273_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_035164614.1\|1327409_1329221_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	Q76DQ7	Chlorella_virus	6.0e-94	37.7
WP_003617090.1\|1329429_1329915_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_035164396.1\|1330117_1331167_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.2e-43	33.1
WP_003617088.1\|1331292_1331649_-	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_035162323.1\|1332397_1333726_-	HNH endonuclease	Q331Y3	Clostridium_botulinum_C_phage	4.6e-59	40.1
WP_003617081.1\|1335724_1336231_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_035164612.1\|1336274_1336946_-	DNA alkylation repair protein	NA	NA	NA	NA
WP_035164610.1\|1337091_1338432_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_003617074.1\|1338636_1339518_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	9.8e-50	39.4
WP_072538168.1\|1340698_1342450_+\|transposase	transposase	NA	NA	NA	NA
WP_003617067.1\|1342973_1344188_-	MFS transporter	NA	NA	NA	NA
WP_072538167.1\|1345139_1346507_+\|transposase	ISL3-like element ISLdl1 family transposase	A4PE56	Ralstonia_virus	4.2e-31	29.1
WP_035164983.1\|1349066_1350116_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.1e-42	32.8
WP_072538342.1\|1351628_1352831_-\|transposase	transposase	NA	NA	NA	NA
WP_013440320.1\|1352986_1354165_+\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_013438997.1\|1357274_1358558_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.9e-58	33.3
WP_003617057.1\|1358848_1359112_-	hypothetical protein	NA	NA	NA	NA
WP_025895527.1\|1359133_1359421_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_035162311.1\|1359536_1360304_+	hypothetical protein	NA	NA	NA	NA
WP_143434646.1\|1360366_1361772_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	3.7e-43	41.0
WP_003617051.1\|1361854_1362505_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_035161028.1\|1362529_1362811_-	hypothetical protein	NA	NA	NA	NA
WP_035161027.1\|1362861_1363089_-	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_035164601.1\|1363114_1365040_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.1e-93	34.0
WP_072538245.1\|1365278_1366328_+\|transposase	IS30-like element ISL7 family transposase	H7BWC8	unidentified_phage	3.6e-43	33.1
WP_035164600.1\|1366440_1367001_-	hypothetical protein	NA	NA	NA	NA
WP_072538257.1\|1369419_1370598_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_072538167.1\|1370708_1372076_-\|transposase	ISL3-like element ISLdl1 family transposase	A4PE56	Ralstonia_virus	4.2e-31	29.1
WP_035164983.1\|1373882_1374932_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.1e-42	32.8
WP_003617037.1\|1376534_1377170_-	carbonic anhydrase family protein	NA	NA	NA	NA
WP_035161025.1\|1377449_1378307_-	Mrr restriction system protein	NA	NA	NA	NA
WP_035164599.1\|1378489_1379845_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	F5CA72	Streptococcus_phi-m46.1-like_phage	8.4e-109	47.9
WP_035161007.1\|1379847_1380561_-	DUF1211 domain-containing protein	NA	NA	NA	NA
WP_035161060.1\|1380621_1381548_-	diacylglycerol kinase family lipid kinase	A0A1V0SBJ0	Catovirus	1.1e-14	25.9
WP_016395794.1\|1381583_1383014_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_072538259.1\|1383019_1384462_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_003617020.1\|1384461_1384767_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_035161006.1\|1384778_1385924_-	CamS family sex pheromone protein	NA	NA	NA	NA
WP_035164597.1\|1385920_1387936_-	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	1.6e-100	36.7
WP_035164595.1\|1387946_1390208_-	DNA helicase PcrA	A7KV33	Bacillus_phage	5.7e-126	41.1
WP_003617011.1\|1390297_1390951_-	glycoside hydrolase family 73 protein	S5M633	Brevibacillus_phage	1.2e-28	48.6
WP_002878090.1\|1390964_1391588_-	ECF transporter S component	NA	NA	NA	NA
WP_003614813.1\|1391821_1392283_-	SprT family protein	NA	NA	NA	NA
WP_035164593.1\|1392322_1392841_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	5.6e-13	35.6
WP_035161001.1\|1393885_1396552_-	calcium-translocating P-type ATPase, PMCA-type	A0A1J0FA34	Only_Syngen_Nebraska_virus	9.2e-75	28.8
WP_002878098.1\|1396757_1397588_-	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	5.2e-69	52.9
WP_003616998.1\|1397692_1398394_-	glycosyl transferase	A0A1V0SL98	Klosneuvirus	9.6e-08	29.2
WP_003616997.1\|1398390_1399491_-	glycosyltransferase	NA	NA	NA	NA
WP_002878101.1\|1399490_1400225_-	WecB/TagA/CpsF family glycosyltransferase	NA	NA	NA	NA
WP_002878102.1\|1400275_1401703_-	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_003616992.1\|1401706_1402846_-	CDP-glycerol--glycerophosphate glycerophosphotransferase	NA	NA	NA	NA
WP_035161000.1\|1403008_1403710_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_035164591.1\|1403776_1404844_-	hypothetical protein	NA	NA	NA	NA
WP_003616985.1\|1404858_1405971_-	hypothetical protein	NA	NA	NA	NA
WP_013440320.1\|1406087_1407266_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_035164589.1\|1407516_1409124_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003616980.1\|1409644_1410700_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_035164587.1\|1410686_1411868_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_003616978.1\|1412192_1412363_-	hypothetical protein	NA	NA	NA	NA
WP_035160995.1\|1412652_1413144_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_003616975.1\|1413246_1413723_+	MFS transporter	NA	NA	NA	NA
WP_072538260.1\|1413738_1414416_+	MFS transporter	NA	NA	NA	NA
WP_011678031.1\|1414475_1415099_-	NUDIX hydrolase	NA	NA	NA	NA
WP_003620886.1\|1415213_1415360_-	hypothetical protein	NA	NA	NA	NA
WP_072538240.1\|1417646_1418696_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	32.8
WP_002878121.1\|1419336_1419732_-	30S ribosomal protein S9	NA	NA	NA	NA
WP_002878124.1\|1419744_1420188_-	50S ribosomal protein L13	NA	NA	NA	NA
WP_003616967.1\|1420293_1421082_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA

DBSCAN-SWA_14

1570237 : 1643559

Enterococcus_phage(14.29%)

tRNA,integrase,transposase

attL 1572835:1572858|attR 1643591:1643614

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035164983.1\|1570237_1571287_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.1e-42	32.8
WP_072538167.1\|1571430_1572798_+\|transposase	ISL3-like element ISLdl1 family transposase	A4PE56	Ralstonia_virus	4.2e-31	29.1
1572835:1572858	attL	NA	NA	NA	NA
WP_003616729.1\|1574522_1575173_-	HD domain-containing protein	S4W232	Pandoravirus	1.2e-07	25.7
WP_072538271.1\|1575961_1577185_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	1.1e-96	48.5
WP_002877198.1\|1577391_1577574_-	zinc-ribbon domain-containing protein	NA	NA	NA	NA
WP_095582917.1\|1578073_1579276_+\|transposase	transposase	NA	NA	NA	NA
WP_002877898.1\|1579602_1580868_-\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	5.1e-84	41.9
WP_035164511.1\|1581125_1582187_-	acyltransferase family protein	NA	NA	NA	NA
WP_035164509.1\|1582265_1585268_-	LTA synthase family protein	NA	NA	NA	NA
WP_002877895.1\|1585346_1585964_-	glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003616714.1\|1585966_1587250_-	LCP family protein	NA	NA	NA	NA
WP_002877893.1\|1587501_1588191_-	2,3-diphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
WP_003616713.1\|1588354_1589104_+	hypothetical protein	NA	NA	NA	NA
WP_035164506.1\|1589149_1590115_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_016395914.1\|1590219_1592058_-	cation:proton antiporter	NA	NA	NA	NA
WP_035164501.1\|1592169_1593711_-	SLAP domain-containing protein	A0A0A7AQV3	Bacillus_phage	2.1e-23	38.4
WP_016395916.1\|1593732_1594935_-	SLAP domain-containing protein	Q9ZXE4	Bacillus_phage	3.6e-10	41.6
WP_013440320.1\|1595084_1596263_+\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_002877881.1\|1596580_1596817_-	DUF2922 domain-containing protein	NA	NA	NA	NA
WP_002877879.1\|1596876_1597086_-	hypothetical protein	NA	NA	NA	NA
WP_035164499.1\|1598172_1598433_-	hypothetical protein	NA	NA	NA	NA
WP_052109155.1\|1598626_1599232_-\|integrase	site-specific integrase	Q38608	Lactococcus_phage	5.7e-17	34.9
WP_013440320.1\|1599355_1600534_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_172822846.1\|1600648_1601017_-\|integrase	phage integrase SAM-like domain-containing protein	NA	NA	NA	NA
WP_013440320.1\|1602606_1603785_+\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_072538272.1\|1603845_1604424_-	hypothetical protein	NA	NA	NA	NA
WP_013440320.1\|1604538_1605717_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_035164495.1\|1605831_1609413_-	DEAD/DEAH box helicase	A0A2H4UTW8	Bodo_saltans_virus	1.0e-49	28.2
WP_052109126.1\|1610043_1611531_-	hypothetical protein	D2J048	Enterococcus_phage	3.8e-54	37.3
WP_035164493.1\|1611527_1612385_-	primase C-terminal domain-containing protein	A0A2H4JEH3	uncultured_Caudovirales_phage	6.9e-08	23.9
WP_035164491.1\|1612381_1612696_-	hypothetical protein	NA	NA	NA	NA
WP_078256813.1\|1612849_1613161_-	DNA-binding protein	NA	NA	NA	NA
WP_035164488.1\|1613160_1613355_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_052109125.1\|1613524_1614478_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_072538273.1\|1614719_1615862_+\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	1.5e-58	36.0
WP_035164487.1\|1616033_1616972_+	hypothetical protein	NA	NA	NA	NA
WP_051975836.1\|1617127_1617502_+	hypothetical protein	NA	NA	NA	NA
WP_072538274.1\|1617651_1619700_+	KUP/HAK/KT family potassium transporter	M1IAJ4	Acanthocystis_turfacea_Chlorella_virus	7.0e-67	34.1
WP_035164479.1\|1620005_1621958_-	peptidase M13	E3T4I7	Cafeteria_roenbergensis_virus	1.3e-70	29.8
WP_002877868.1\|1621982_1622321_-	hypothetical protein	NA	NA	NA	NA
WP_016395924.1\|1622407_1623628_-	MFS transporter	NA	NA	NA	NA
WP_035164477.1\|1623727_1625044_-	DUF438 domain-containing protein	NA	NA	NA	NA
WP_003616694.1\|1625043_1625601_-	DUF59 domain-containing protein	NA	NA	NA	NA
WP_035160921.1\|1625619_1626342_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	1.7e-47	54.6
WP_035164475.1\|1626413_1628624_-	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	8.8e-249	59.4
WP_035160919.1\|1628989_1630249_-	carboxylate--amine ligase	NA	NA	NA	NA
WP_003616687.1\|1630282_1632232_-	asparagine synthase (glutamine-hydrolyzing)	F2Y1H0	Organic_Lake_phycodnavirus	2.7e-15	36.9
WP_003616684.1\|1632328_1633729_-	metallophosphoesterase	A0A2P0ZKZ2	Lactobacillus_phage	6.6e-08	23.1
WP_003616682.1\|1633786_1634272_-	hypothetical protein	NA	NA	NA	NA
WP_076612173.1\|1634365_1635628_-\|transposase	IS3-like element ISL6 family transposase	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7
WP_003616681.1\|1635985_1637611_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003611688.1\|1637866_1638679_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_003616679.1\|1638678_1639479_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_002877846.1\|1639481_1640252_-	phosphonate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.3e-25	34.6
WP_003616675.1\|1640369_1641311_-	phosphate/phosphite/phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003611675.1\|1641731_1642205_-	universal stress protein	NA	NA	NA	NA
WP_035164396.1\|1642509_1643559_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.2e-43	33.1
1643591:1643614	attR	NA	NA	NA	NA

DBSCAN-SWA_15

1660079 : 1717980

unidentified_phage(20.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072538207.1\|1660079_1661129_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	4.0e-42	32.8
WP_072538275.1\|1661242_1662919_-	alpha-glucosidase	NA	NA	NA	NA
WP_035164461.1\|1664146_1665769_-	alpha-glucosidase	NA	NA	NA	NA
WP_035164460.1\|1665929_1666796_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_035160912.1\|1666761_1667556_-	YibE/F family protein	NA	NA	NA	NA
WP_035164458.1\|1667552_1668662_-	YibE/F family protein	NA	NA	NA	NA
WP_003616200.1\|1668795_1669431_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_016395952.1\|1669479_1670568_-	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_035164457.1\|1670715_1672035_+	CAP domain-containing protein	NA	NA	NA	NA
WP_003616206.1\|1672072_1672723_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_003616207.1\|1672762_1673596_-	hypothetical protein	NA	NA	NA	NA
WP_016395955.1\|1673606_1674287_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_171031037.1\|1674468_1675470_-	ribose-phosphate diphosphokinase	A0A1V0SHF7	Hokovirus	9.8e-38	31.9
WP_003616211.1\|1675563_1676223_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_052109124.1\|1676206_1677079_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_016395982.1\|1677212_1678169_+	DUF1002 domain-containing protein	NA	NA	NA	NA
WP_035164454.1\|1678256_1679024_-	viroplasmin family protein	A0A1L6Z550	Klebsiella_phage	1.1e-17	35.3
WP_076612173.1\|1679247_1680510_+\|transposase	IS3-like element ISL6 family transposase	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7
WP_013438965.1\|1680558_1681503_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_035164452.1\|1681504_1682968_+	cardiolipin synthase	NA	NA	NA	NA
WP_003611605.1\|1683019_1683499_-	hypothetical protein	NA	NA	NA	NA
WP_035164450.1\|1683609_1684308_+	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_003616220.1\|1684294_1684666_-	DUF488 family protein	NA	NA	NA	NA
WP_003611679.1\|1684748_1685375_+	DNA-3-methyladenine glycosylase	NA	NA	NA	NA
WP_035164448.1\|1685763_1687347_+	ABC transporter substrate-binding protein/permease	NA	NA	NA	NA
WP_035164446.1\|1687350_1688112_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.3e-28	37.2
WP_035164444.1\|1688817_1689936_-	LysM peptidoglycan-binding domain-containing protein	D2KRB9	Lactobacillus_phage	1.7e-19	45.0
WP_035164442.1\|1690165_1691077_-	HNH endonuclease	NA	NA	NA	NA
WP_072538165.1\|1691630_1692680_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	33.1
WP_052109123.1\|1693177_1694335_+	cation transporter	NA	NA	NA	NA
WP_003616234.1\|1694492_1695047_+	LemA family protein	A0A1X9IGG1	Lactococcus_phage	7.8e-13	32.0
WP_003621366.1\|1695063_1695963_+\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
WP_035164407.1\|1696094_1697438_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.6e-48	29.9
WP_013439920.1\|1697394_1697628_-	hypothetical protein	NA	NA	NA	NA
WP_035160960.1\|1697683_1698031_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_035160962.1\|1698023_1698206_-	hypothetical protein	NA	NA	NA	NA
WP_003616238.1\|1698809_1699424_+	hypothetical protein	NA	NA	NA	NA
WP_072538165.1\|1701474_1702524_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	33.1
WP_003611191.1\|1702859_1703507_+	deoxynucleoside kinase	Q5ULP7	Lactobacillus_virus	1.2e-49	49.8
WP_003611175.1\|1703528_1704227_+	deoxynucleoside kinase	Q5ULP7	Lactobacillus_virus	1.0e-54	49.8
WP_003616420.1\|1704470_1705928_+	ABC transporter substrate-binding protein/permease	NA	NA	NA	NA
WP_003616418.1\|1705947_1706694_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-27	37.1
WP_003616417.1\|1706912_1708223_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	2.0e-51	31.7
WP_035174920.1\|1710188_1710668_-	hypothetical protein	NA	NA	NA	NA
WP_013440320.1\|1711100_1712279_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_072538342.1\|1713028_1714231_+\|transposase	transposase	NA	NA	NA	NA
WP_072538277.1\|1714426_1715617_-	ATP-binding protein	NA	NA	NA	NA
WP_035164409.1\|1715868_1716051_+	hypothetical protein	NA	NA	NA	NA
WP_035160960.1\|1716043_1716391_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_013439920.1\|1716446_1716680_+	hypothetical protein	NA	NA	NA	NA
WP_035164407.1\|1716636_1717980_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.6e-48	29.9

DBSCAN-SWA_16

1723525 : 1784659

unidentified_phage(22.22%)

integrase,transposase

attL 1761333:1761392|attR 1789087:1790453

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_143434642.1\|1723525_1724930_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	5.4e-42	40.7
WP_003612438.1\|1725012_1725192_-	hypothetical protein	NA	NA	NA	NA
WP_003616281.1\|1725225_1725927_-	hypothetical protein	NA	NA	NA	NA
WP_003616283.1\|1726607_1727093_-	shikimate dehydrogenase	NA	NA	NA	NA
WP_003616285.1\|1727277_1728198_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_072538343.1\|1728341_1728497_-	fumarate reductase flavoprotein subunit	NA	NA	NA	NA
WP_035164431.1\|1728818_1730045_+	MFS transporter	NA	NA	NA	NA
WP_035164429.1\|1730764_1731688_+	L-lactate dehydrogenase	NA	NA	NA	NA
WP_002877686.1\|1731739_1732678_-	ROK family glucokinase	NA	NA	NA	NA
WP_035164427.1\|1732844_1733969_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	A0A218MNE0	uncultured_virus	6.4e-70	40.5
WP_035164426.1\|1734104_1735013_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.0e-05	43.3
WP_035164425.1\|1735252_1735954_+	hypothetical protein	NA	NA	NA	NA
WP_035164422.1\|1736034_1737942_+	DNA mismatch repair protein MutS	F2QAG1	Chrysochromulina_ericina_virus	4.3e-18	30.1
WP_035164420.1\|1738067_1739630_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	6.7e-09	23.5
WP_035160853.1\|1739626_1741204_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.2e-11	29.9
WP_035160850.1\|1741366_1742962_+	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_035165409.1\|1743423_1743546_+	hypothetical protein	NA	NA	NA	NA
WP_035164419.1\|1743868_1744348_+	S-ribosylhomocysteine lyase	NA	NA	NA	NA
WP_072538280.1\|1744337_1744763_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003616298.1\|1744807_1745239_-	peptide deformylase	NA	NA	NA	NA
WP_035164396.1\|1745430_1746480_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.2e-43	33.1
WP_002879587.1\|1746679_1748077_+	FAD-binding protein	NA	NA	NA	NA
WP_003616300.1\|1748365_1749367_+	D-2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	2.5e-49	35.2
WP_002879589.1\|1749624_1750188_-	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_003616303.1\|1750180_1750729_-	ECF transporter S component	NA	NA	NA	NA
WP_003616304.1\|1750730_1751180_-	DUF4430 domain-containing protein	NA	NA	NA	NA
WP_035160848.1\|1751244_1753464_-	ribonucleoside-triphosphate reductase, adenosylcobalamin-dependent	A0A068F3I8	Mycobacterium_phage	5.3e-84	34.2
WP_016396011.1\|1753759_1754617_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	6.6e-51	41.1
WP_002879651.1\|1754735_1755644_-	L-lactate dehydrogenase	NA	NA	NA	NA
WP_035164416.1\|1755832_1756375_-	hypothetical protein	NA	NA	NA	NA
WP_025895623.1\|1756454_1757282_-	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	4.1e-98	62.6
WP_013438900.1\|1757339_1757498_-	hypothetical protein	NA	NA	NA	NA
WP_002879656.1\|1757547_1758261_-	noncanonical pyrimidine nucleotidase, YjjG family	NA	NA	NA	NA
WP_035164414.1\|1758658_1759204_+	biotin transporter BioY	NA	NA	NA	NA
WP_072538240.1\|1759986_1761036_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	32.8
1761333:1761392	attL	NA	NA	NA	NA
WP_013440320.1\|1761458_1762637_+\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_035164411.1\|1762697_1762994_-	hypothetical protein	NA	NA	NA	NA
WP_035160836.1\|1763387_1763579_-	RRXRR domain-containing protein	NA	NA	NA	NA
WP_003616318.1\|1763938_1764766_-	hypothetical protein	NA	NA	NA	NA
WP_003616319.1\|1764841_1765495_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_035164403.1\|1765498_1766074_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_003616322.1\|1766335_1767169_-	DegV family protein	A0A1X9I5J4	Streptococcus_phage	4.6e-41	37.9
WP_003616324.1\|1767334_1767841_+	DUF1836 domain-containing protein	NA	NA	NA	NA
WP_003616326.1\|1769098_1770433_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_035164401.1\|1770830_1771163_-	hypothetical protein	NA	NA	NA	NA
WP_035160831.1\|1771155_1771941_-	ParA family protein	A0A0K2FLP4	Brevibacillus_phage	1.0e-10	26.6
WP_016396022.1\|1771962_1772610_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_035160830.1\|1772572_1772902_-\|integrase	phage integrase N-terminal SAM-like domain-containing protein	NA	NA	NA	NA
WP_003616334.1\|1773538_1774006_+	DNA starvation/stationary phase protection protein	A0A222Z0F3	Streptomyces_phage	6.0e-06	28.5
WP_013440320.1\|1774426_1775605_+\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_035164983.1\|1776271_1777321_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.1e-42	32.8
WP_013440320.1\|1777737_1778916_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_141305880.1\|1779187_1781476_-	hypothetical protein	A0A2H4J4H0	uncultured_Caudovirales_phage	1.3e-69	29.0
WP_003616342.1\|1781605_1781809_-	hypothetical protein	NA	NA	NA	NA
WP_035164396.1\|1783609_1784659_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.2e-43	33.1
1789087:1790453	attR	NA	NA	NA	NA

DBSCAN-SWA_17

1787709 : 1858760

uncultured_virus(12.5%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072538245.1\|1787709_1788759_-\|transposase	IS30-like element ISL7 family transposase	H7BWC8	unidentified_phage	3.6e-43	33.1
WP_013440320.1\|1789212_1790391_+\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_035164385.1\|1790631_1792074_-	sucrose phosphorylase	NA	NA	NA	NA
WP_035164383.1\|1792252_1793167_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_171030688.1\|1793329_1794052_+	aquaporin family protein	NA	NA	NA	NA
WP_035164381.1\|1794479_1794965_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_002880600.1\|1795015_1795798_-	hypothetical protein	NA	NA	NA	NA
WP_035164379.1\|1795794_1796559_-	hypothetical protein	NA	NA	NA	NA
WP_035164377.1\|1797117_1797996_-	ROK family protein	NA	NA	NA	NA
WP_035161029.1\|1798032_1798995_-	mannose-6-phosphate isomerase, class I	NA	NA	NA	NA
WP_013440320.1\|1799562_1800741_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_035164407.1\|1801115_1802459_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.6e-48	29.9
WP_013439920.1\|1802415_1802649_-	hypothetical protein	NA	NA	NA	NA
WP_035160960.1\|1802704_1803052_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_035160962.1\|1803044_1803227_-	hypothetical protein	NA	NA	NA	NA
WP_013440320.1\|1803529_1804708_+\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_003616356.1\|1810533_1811106_-	hypothetical protein	NA	NA	NA	NA
WP_002880537.1\|1811571_1811760_-	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_035164344.1\|1811839_1812685_-	NAD(P)H-binding protein	NA	NA	NA	NA
WP_003616360.1\|1812823_1813252_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003616361.1\|1813342_1813822_-	YcxB family protein	NA	NA	NA	NA
WP_003616362.1\|1813910_1814621_-	DUF975 family protein	NA	NA	NA	NA
WP_035164342.1\|1814769_1817535_+	DEAD/DEAH box helicase	Q5YA94	Bacillus_phage	1.4e-30	31.2
WP_035164340.1\|1818147_1818981_-	pyridoxamine kinase	NA	NA	NA	NA
WP_076612173.1\|1819443_1820706_+\|transposase	IS3-like element ISL6 family transposase	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7
WP_002880554.1\|1820841_1821363_-	GNAT family N-acetyltransferase	M1PSC3	Streptococcus_phage	2.3e-14	31.4
WP_072538287.1\|1821579_1822248_+\|transposase	IS607 family transposase	A0A7Q0	Microcystis_virus	5.7e-50	49.8
WP_013440320.1\|1824395_1825574_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_035164330.1\|1825805_1826960_+	SLAP domain-containing protein	Q38317	Lactobacillus_phage	2.3e-59	56.2
WP_003616368.1\|1827180_1827426_-	hypothetical protein	NA	NA	NA	NA
WP_002880561.1\|1827428_1828196_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_003616370.1\|1828192_1828831_-	ATP-binding cassette domain-containing protein	A0A1V0SE00	Indivirus	1.0e-19	31.6
WP_035164329.1\|1829124_1830063_-	ABC transporter ATP-binding protein	A0A076FI99	Aureococcus_anophage	1.4e-17	32.2
WP_035164328.1\|1831266_1832100_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013440320.1\|1833421_1834600_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_016396056.1\|1835152_1835857_+	MgtC/SapB family protein	NA	NA	NA	NA
WP_003616378.1\|1835967_1836192_-	hypothetical protein	NA	NA	NA	NA
WP_095582907.1\|1836554_1837256_+	helix-turn-helix domain-containing protein	C1KFS0	Lactobacillus_virus	8.4e-28	38.8
WP_072538290.1\|1837431_1837842_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	1.8e-14	37.9
WP_035164327.1\|1838113_1839271_+	DUF2974 domain-containing protein	NA	NA	NA	NA
WP_016396059.1\|1839319_1840690_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	3.6e-115	49.7
WP_013438865.1\|1840713_1841169_-	50S ribosomal protein L9	NA	NA	NA	NA
WP_035164326.1\|1841191_1843213_-	DHH family phosphoesterase	NA	NA	NA	NA
WP_002879432.1\|1843353_1843590_-	30S ribosomal protein S18	NA	NA	NA	NA
WP_003616385.1\|1843616_1844195_-	single-stranded DNA-binding protein	A0A218MNB4	uncultured_virus	9.3e-41	71.3
WP_003612647.1\|1844235_1844529_-	30S ribosomal protein S6	NA	NA	NA	NA
WP_002879428.1\|1844744_1847216_-	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	2.4e-109	34.5
WP_003616387.1\|1847228_1849190_-	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	9.2e-141	45.3
WP_003616388.1\|1849173_1850319_-	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_003623647.1\|1850318_1850549_-	S4 domain-containing protein YaaA	NA	NA	NA	NA
WP_003616390.1\|1850773_1851901_-	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	8.2e-25	27.4
WP_003616391.1\|1852081_1853446_-	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_002879421.1\|1853921_1854062_+	50S ribosomal protein L34	NA	NA	NA	NA
WP_002879420.1\|1854110_1854476_+	ribonuclease P protein component	NA	NA	NA	NA
WP_003616393.1\|1854475_1855345_+	membrane protein insertase YidC	NA	NA	NA	NA
WP_016396064.1\|1855452_1856838_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE	NA	NA	NA	NA
WP_035164325.1\|1856864_1858760_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA

DBSCAN-SWA_18

1864793 : 1920774

Bacillus_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013440320.1\|1864793_1865972_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_035160962.1\|1866968_1867151_+	hypothetical protein	NA	NA	NA	NA
WP_035160960.1\|1867143_1867491_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_013439920.1\|1867546_1867780_+	hypothetical protein	NA	NA	NA	NA
WP_072538230.1\|1868619_1870371_+\|transposase	transposase	NA	NA	NA	NA
WP_016396090.1\|1870342_1870567_+	hypothetical protein	NA	NA	NA	NA
WP_011544373.1\|1871359_1871773_-	hypothetical protein	NA	NA	NA	NA
WP_035165392.1\|1871830_1872499_-	hypothetical protein	NA	NA	NA	NA
WP_003616399.1\|1872528_1873311_-	hypothetical protein	NA	NA	NA	NA
WP_035165391.1\|1873323_1873737_-	hypothetical protein	NA	NA	NA	NA
WP_072538293.1\|1873760_1874270_-	hypothetical protein	NA	NA	NA	NA
WP_003613078.1\|1874259_1874889_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	3.5e-25	33.8
WP_003616402.1\|1874899_1875610_-	hypothetical protein	NA	NA	NA	NA
WP_035165388.1\|1875611_1876280_-	hypothetical protein	NA	NA	NA	NA
WP_035164396.1\|1876517_1877567_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.2e-43	33.1
WP_003616406.1\|1878699_1879017_-	hypothetical protein	NA	NA	NA	NA
WP_003616407.1\|1879216_1879900_+	hypothetical protein	NA	NA	NA	NA
WP_035165387.1\|1881888_1884366_+	protein kinase/lanthionine synthetase C family protein	NA	NA	NA	NA
WP_016396079.1\|1884376_1884532_+	hypothetical protein	NA	NA	NA	NA
WP_003616411.1\|1884818_1886174_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_035165386.1\|1886170_1886965_+	response regulator	NA	NA	NA	NA
WP_035162107.1\|1887042_1888581_+	ClC family H(+)/Cl(-) exchange transporter	NA	NA	NA	NA
WP_013440320.1\|1889792_1890971_+\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_035160868.1\|1891304_1891874_-	hypothetical protein	NA	NA	NA	NA
WP_003611906.1\|1891980_1892601_-	helix-turn-helix domain-containing protein	Q9G0C2	Lactococcus_phage	1.1e-31	38.6
WP_035160872.1\|1892767_1892962_+	hypothetical protein	NA	NA	NA	NA
WP_035160873.1\|1893122_1895252_+	DUF1906 domain-containing protein	NA	NA	NA	NA
WP_035160876.1\|1895274_1895853_-	hypothetical protein	NA	NA	NA	NA
WP_035165385.1\|1896572_1897901_+	HNH endonuclease	Q331Y3	Clostridium_botulinum_C_phage	2.1e-56	37.7
WP_035165384.1\|1898034_1898904_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_016395957.1\|1898967_1899792_-	glycosyl transferase 8 family protein	NA	NA	NA	NA
WP_016395958.1\|1899819_1900596_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003616262.1\|1900856_1901585_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.4e-40	38.5
WP_035165382.1\|1901631_1903527_+	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	4.6e-36	33.3
WP_051112105.1\|1903507_1905097_+	hypothetical protein	NA	NA	NA	NA
WP_003616258.1\|1905097_1905898_+	two-component system regulatory protein YycI	NA	NA	NA	NA
WP_002877724.1\|1905916_1906714_+	MBL fold metallo-hydrolase	A0A2I7SDH3	Paenibacillus_phage	2.5e-28	32.0
WP_035165381.1\|1906808_1908092_+	trypsin-like peptidase domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	2.0e-19	28.5
WP_003616256.1\|1908583_1909063_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_035165380.1\|1909176_1909992_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_035161041.1\|1910929_1911430_+	hypothetical protein	NA	NA	NA	NA
WP_013438946.1\|1911447_1911828_+	hypothetical protein	NA	NA	NA	NA
WP_035165379.1\|1911998_1912340_+	hypothetical protein	NA	NA	NA	NA
WP_002877735.1\|1912404_1912770_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_003611643.1\|1912904_1913573_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_035165378.1\|1913582_1914938_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.2e-10	24.7
WP_035165377.1\|1915240_1916725_+	MFS transporter	NA	NA	NA	NA
WP_003624103.1\|1916778_1917627_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013440320.1\|1918148_1919327_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_072538295.1\|1919550_1920774_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	7.4e-96	48.5

DBSCAN-SWA_19

1939087 : 1997441

Staphylococcus_phage(23.08%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003616451.1\|1939087_1939744_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_035165557.1\|1939829_1940990_-	cation:proton antiporter	NA	NA	NA	NA
WP_035162141.1\|1943126_1943597_-	CBS domain-containing protein	NA	NA	NA	NA
WP_013440320.1\|1944748_1945927_+\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_003613636.1\|1946813_1947116_+	hypothetical protein	NA	NA	NA	NA
WP_013440320.1\|1947183_1948362_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_003613642.1\|1948682_1948832_+	teichoic acid D-Ala incorporation-associated protein DltX	NA	NA	NA	NA
WP_035165370.1\|1948847_1950350_+	D-alanine--poly(phosphoribitol) ligase subunit DltA	A0A2K9KZV5	Tupanvirus	2.2e-41	28.3
WP_035165369.1\|1950346_1951579_+	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	2.4e-22	27.3
WP_002879627.1\|1951656_1951899_+	D-alanine--poly(phosphoribitol) ligase subunit DltC	NA	NA	NA	NA
WP_003613649.1\|1951888_1953175_+	D-alanyl-lipoteichoic acid biosynthesis protein DltD	NA	NA	NA	NA
WP_003613653.1\|1953349_1953574_-	hypothetical protein	NA	NA	NA	NA
WP_016396121.1\|1953733_1954123_+	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_035165368.1\|1954259_1956260_+	ABC transporter ATP-binding protein/permease	G9BWD6	Planktothrix_phage	4.4e-29	33.9
WP_035165367.1\|1956263_1956890_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_035164407.1\|1963187_1964531_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.6e-48	29.9
WP_013439920.1\|1964487_1964721_-	hypothetical protein	NA	NA	NA	NA
WP_035160960.1\|1964776_1965124_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_035160962.1\|1965116_1965299_-	hypothetical protein	NA	NA	NA	NA
WP_003616467.1\|1966713_1967328_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	4.6e-30	40.9
WP_035165365.1\|1967347_1968526_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.3e-97	46.9
WP_003616470.1\|1968540_1969005_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.5e-25	45.0
WP_016396126.1\|1969390_1969573_-	hypothetical protein	NA	NA	NA	NA
WP_169309614.1\|1969633_1969744_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_013440320.1\|1976017_1977196_+\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_013440303.1\|1977259_1978570_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_016396128.1\|1978562_1979438_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003613384.1\|1979502_1980312_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_035165361.1\|1982676_1982919_-	recombinase family protein	M4QQC6	Vibrio_phage	1.4e-06	55.8
WP_003616492.1\|1983453_1983651_-	cold-shock protein	Q9AZD3	Lactococcus_phage	9.8e-19	69.8
WP_035165360.1\|1983852_1984518_-	hypothetical protein	NA	NA	NA	NA
WP_035172677.1\|1984590_1984788_-	hypothetical protein	NA	NA	NA	NA
WP_072538195.1\|1986383_1987607_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	1.6e-95	48.0
WP_078256805.1\|1989305_1990019_-	diguanylate cyclase	NA	NA	NA	NA
WP_072538287.1\|1990193_1990862_+\|transposase	IS607 family transposase	A0A7Q0	Microcystis_virus	5.7e-50	49.8
WP_072538298.1\|1990830_1992537_+\|transposase	transposase	NA	NA	NA	NA
WP_035164407.1\|1993059_1994403_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.6e-48	29.9
WP_013439920.1\|1994359_1994593_-	hypothetical protein	NA	NA	NA	NA
WP_035160960.1\|1994648_1994996_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_035160962.1\|1994988_1995171_-	hypothetical protein	NA	NA	NA	NA
WP_035165359.1\|1995350_1997441_-\|protease	ATP-dependent Clp protease ATP-binding subunit	H6X3M6	Enterobacteria_phage	8.4e-124	39.2

DBSCAN-SWA_20

2011153 : 2073367

Streptococcus_phage(18.18%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072538196.1\|2011153_2012407_+\|transposase	transposase	NA	NA	NA	NA
WP_072538195.1\|2012529_2013753_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	1.6e-95	48.0
WP_035164407.1\|2014359_2015703_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.6e-48	29.9
WP_013439920.1\|2015659_2015893_-	hypothetical protein	NA	NA	NA	NA
WP_035160960.1\|2015948_2016296_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_035160962.1\|2016288_2016471_-	hypothetical protein	NA	NA	NA	NA
WP_013440320.1\|2016790_2017969_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_076612173.1\|2018155_2019418_+\|transposase	IS3-like element ISL6 family transposase	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7
WP_016396148.1\|2019531_2020320_-	hypothetical protein	A0A0E3XCL7	Enterococcus_phage	2.1e-19	67.1
WP_072538300.1\|2020782_2023314_+	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	6.9e-72	25.1
WP_035160962.1\|2023520_2023703_+	hypothetical protein	NA	NA	NA	NA
WP_035160960.1\|2023695_2024043_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_013439920.1\|2024098_2024332_+	hypothetical protein	NA	NA	NA	NA
WP_035164407.1\|2024288_2025632_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.6e-48	29.9
WP_072538195.1\|2026910_2028134_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	1.6e-95	48.0
WP_013440320.1\|2029157_2030336_+\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_072538302.1\|2031061_2033308_+	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	5.4e-60	30.3
WP_072538303.1\|2034342_2035710_+\|transposase	ISL3-like element ISLdl1 family transposase	A4PE56	Ralstonia_virus	6.0e-30	28.8
WP_013440320.1\|2036124_2037303_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_072538304.1\|2037468_2038503_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	7.5e-41	32.0
WP_078256840.1\|2038755_2040018_+\|transposase	IS3-like element ISL6 family transposase	A0A0C5AEA5	Paenibacillus_phage	6.1e-29	35.3
WP_035165352.1\|2040094_2041306_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_035165351.1\|2041399_2042035_-	hypothetical protein	NA	NA	NA	NA
WP_035165349.1\|2042099_2042837_+	peroxide stress protein YaaA	A0A1X9I5I0	Streptococcus_phage	1.9e-22	32.5
WP_035165348.1\|2043018_2044422_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_035165347.1\|2044742_2045249_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003616571.1\|2045291_2046350_+	ABC transporter permease	NA	NA	NA	NA
WP_002879538.1\|2046351_2047026_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-35	41.4
WP_052109150.1\|2047178_2047790_+	hypothetical protein	NA	NA	NA	NA
WP_035165346.1\|2047792_2048824_+	hypothetical protein	NA	NA	NA	NA
WP_011678650.1\|2048886_2049090_+	hypothetical protein	NA	NA	NA	NA
WP_035165345.1\|2049089_2050379_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_035165343.1\|2050387_2051194_+	response regulator transcription factor	A0A2H4J4Z6	uncultured_Caudovirales_phage	1.4e-07	24.0
WP_013440268.1\|2051300_2051798_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_035165342.1\|2051972_2052767_+	hypothetical protein	NA	NA	NA	NA
WP_035165341.1\|2052753_2053452_+	hypothetical protein	NA	NA	NA	NA
WP_072538305.1\|2053444_2054098_+	hypothetical protein	NA	NA	NA	NA
WP_035164983.1\|2054211_2055261_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.1e-42	32.8
WP_035165338.1\|2055344_2056007_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	2.4e-24	31.7
WP_016396167.1\|2056029_2056452_+	hypothetical protein	NA	NA	NA	NA
WP_035165337.1\|2056529_2057930_-	C69 family dipeptidase	NA	NA	NA	NA
WP_052109149.1\|2058205_2058754_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003616594.1\|2058881_2059421_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	9.3e-35	46.2
WP_002879530.1\|2059436_2059985_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	3.3e-32	44.6
WP_095582939.1\|2060316_2061519_+\|transposase	transposase	NA	NA	NA	NA
WP_002879529.1\|2061685_2062468_+	tyrosine-protein phosphatase	NA	NA	NA	NA
WP_035165335.1\|2062479_2063439_+	FAD:protein FMN transferase	NA	NA	NA	NA
WP_035165333.1\|2063662_2064187_-	CvpA family protein	NA	NA	NA	NA
WP_016396172.1\|2064358_2065078_+	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
WP_072538307.1\|2065096_2065921_+	nucleoid occlusion protein	S5WII0	Leptospira_phage	6.6e-16	41.8
WP_003616606.1\|2065922_2066702_+	ParA family protein	Q8JL10	Natrialba_phage	5.1e-26	30.4
WP_003613278.1\|2066679_2067570_+	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	9.0e-19	34.4
WP_002879522.1\|2067562_2067826_+	DUF951 domain-containing protein	NA	NA	NA	NA
WP_002879521.1\|2067902_2069003_+	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_002879518.1\|2069017_2069788_+	DUF1129 domain-containing protein	NA	NA	NA	NA
WP_016396175.1\|2069926_2071654_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.2e-44	27.5
WP_013440320.1\|2072188_2073367_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA

DBSCAN-SWA_21

2091694 : 2137507

Streptomyces_phage(13.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035165320.1\|2091694_2092993_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	C1KFS0	Lactobacillus_virus	2.5e-70	39.0
WP_035161504.1\|2093334_2094474_+	LCP family protein	NA	NA	NA	NA
WP_002879494.1\|2094592_2094970_+	hypothetical protein	NA	NA	NA	NA
WP_035165318.1\|2094984_2096529_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	2.0e-45	27.2
WP_035165317.1\|2096582_2097338_+	threonine/serine exporter family protein	NA	NA	NA	NA
WP_016396190.1\|2097340_2097832_+	threonine/serine exporter family protein	NA	NA	NA	NA
WP_035165316.1\|2098057_2098525_-	hypothetical protein	NA	NA	NA	NA
WP_002879488.1\|2098981_2099497_+	hypothetical protein	NA	NA	NA	NA
WP_035161515.1\|2099499_2100126_+	hypothetical protein	NA	NA	NA	NA
WP_035165314.1\|2100176_2101715_-	O-antigen ligase family protein	NA	NA	NA	NA
WP_002879482.1\|2101778_2102108_-	DUF2187 family protein	NA	NA	NA	NA
WP_002879481.1\|2102197_2102740_+	AAA family ATPase	A0A2R2ZH49	Clostridioides_phage	3.0e-09	28.0
WP_035165313.1\|2102864_2103350_+	C40 family peptidase	A0A2L1IW19	Streptomyces_phage	1.6e-14	39.7
WP_035165311.1\|2103634_2104681_+	lactate dehydrogenase	NA	NA	NA	NA
WP_003616168.1\|2104850_2105324_+	C40 family peptidase	A0A0A8WF62	Clostridium_phage	5.5e-15	38.5
WP_035165310.1\|2105511_2106294_+	C40 family peptidase	A0A2L1IW19	Streptomyces_phage	3.4e-14	42.7
WP_003614608.1\|2106701_2107370_+\|transposase	IS607 family transposase	A0A7Q0	Microcystis_virus	5.7e-50	49.8
WP_072538309.1\|2107338_2109045_+\|transposase	transposase	NA	NA	NA	NA
WP_035165308.1\|2110265_2111024_+	C40 family peptidase	A0A0A8WF62	Clostridium_phage	2.3e-15	40.2
WP_035165307.1\|2111069_2111849_+	C40 family peptidase	NA	NA	NA	NA
WP_035165306.1\|2111897_2113178_-	GTPase HflX	NA	NA	NA	NA
WP_013440320.1\|2113614_2114793_+\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_072538310.1\|2114946_2116395_+	flippase	NA	NA	NA	NA
WP_072538312.1\|2118275_2120027_+\|transposase	transposase	NA	NA	NA	NA
WP_011544347.1\|2119998_2120223_+	hypothetical protein	NA	NA	NA	NA
WP_016395838.1\|2120904_2122272_-\|transposase	ISL3-like element ISLdl1 family transposase	A4PE56	Ralstonia_virus	4.2e-31	29.1
WP_041812036.1\|2122510_2123734_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	1.7e-97	49.2
WP_072538313.1\|2124104_2124419_+	hypothetical protein	NA	NA	NA	NA
WP_072538347.1\|2124463_2125126_+	polysaccharide biosynthesis C-terminal domain-containing protein	NA	NA	NA	NA
WP_072538314.1\|2125235_2126231_+	dihydroxyacetone kinase subunit DhaK	NA	NA	NA	NA
WP_072538315.1\|2126244_2126826_+	dihydroxyacetone kinase subunit L	NA	NA	NA	NA
WP_013440194.1\|2126827_2127205_+	PTS-dependent dihydroxyacetone kinase phosphotransferase subunit DhaM	NA	NA	NA	NA
WP_072538316.1\|2127206_2127911_+	aquaporin family protein	NA	NA	NA	NA
WP_072538317.1\|2127922_2128447_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_070487999.1\|2128534_2129533_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.0e-87	48.0
WP_095582951.1\|2130455_2131064_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	7.2e-44	56.1
WP_002880229.1\|2131077_2132052_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	6.2e-29	37.2
WP_003612761.1\|2132903_2133329_+	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_072538319.1\|2133381_2133816_-	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
WP_078256804.1\|2134753_2136016_+\|transposase	IS3-like element ISL6 family transposase	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7
WP_035164407.1\|2136163_2137507_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.6e-48	29.9

DBSCAN-SWA_22

2144017 : 2188837

unidentified_phage(25.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013440320.1\|2144017_2145196_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_035165297.1\|2145401_2146316_+	hypothetical protein	NA	NA	NA	NA
WP_003614385.1\|2146437_2146578_-	hypothetical protein	NA	NA	NA	NA
WP_035165295.1\|2146592_2146904_-	hypothetical protein	NA	NA	NA	NA
WP_003616107.1\|2147754_2148768_+	NAD(P)-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_035165293.1\|2148902_2149271_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_035165536.1\|2149522_2149819_+	hypothetical protein	NA	NA	NA	NA
WP_035165292.1\|2150134_2151022_-	DNA/RNA non-specific endonuclease	NA	NA	NA	NA
WP_035165290.1\|2154783_2156013_+	LCP family protein	NA	NA	NA	NA
WP_035165289.1\|2156252_2157233_+	LCP family protein	NA	NA	NA	NA
WP_072538323.1\|2157562_2158597_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	4.0e-42	32.9
WP_035165287.1\|2158739_2159855_+	UDP-galactopyranose mutase	E4ZFQ1	Streptococcus_phage	2.0e-156	71.2
WP_013440320.1\|2160512_2161691_+\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_078256804.1\|2162915_2164178_+\|transposase	IS3-like element ISL6 family transposase	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7
WP_035165284.1\|2164185_2165307_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_035165282.1\|2165361_2166075_-	hypothetical protein	NA	NA	NA	NA
WP_013440320.1\|2166179_2167358_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_035165281.1\|2167682_2168522_+	DUF4422 domain-containing protein	NA	NA	NA	NA
WP_035165279.1\|2168524_2169511_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_035165277.1\|2169536_2170544_+	glycosyltransferase family 2 protein	A0A0F7L2F7	uncultured_marine_virus	4.9e-05	24.6
WP_013440320.1\|2171280_2172459_+\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
WP_035165276.1\|2173276_2174266_+	glycosyltransferase	NA	NA	NA	NA
WP_035165275.1\|2174296_2175286_+	Stealth CR1 domain-containing protein	NA	NA	NA	NA
WP_072538326.1\|2175467_2176457_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	4.3e-38	31.9
WP_008460463.1\|2177461_2177911_+	glycerol-3-phosphate cytidylyltransferase	A0A1V0SGE7	Hokovirus	2.0e-19	40.6
WP_035164407.1\|2178166_2179510_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.6e-48	29.9
WP_013439920.1\|2179466_2179700_-	hypothetical protein	NA	NA	NA	NA
WP_035160960.1\|2179755_2180103_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_035164409.1\|2180095_2180278_-	hypothetical protein	NA	NA	NA	NA
WP_035165272.1\|2180441_2180864_-	GtrA family protein	NA	NA	NA	NA
WP_035165271.1\|2181123_2181831_+	VanZ family protein	NA	NA	NA	NA
WP_035165270.1\|2181841_2183365_+	AAA family ATPase	NA	NA	NA	NA
WP_060611715.1\|2185591_2185879_+	hypothetical protein	NA	NA	NA	NA
WP_035165265.1\|2185898_2186402_+	hypothetical protein	NA	NA	NA	NA
WP_003616066.1\|2186708_2187401_-	glycerophosphoryl diester phosphodiesterase	A0A2H4PGQ5	Escherichia_phage	2.6e-13	23.6
WP_035165262.1\|2187506_2188160_-	phosphoglycerate mutase family protein	NA	NA	NA	NA
WP_003612123.1\|2188174_2188837_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP018215

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection