CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP018072	Enterococcus faecium strain VRE001 plasmid unnamed2, complete sequence	0 crisprs	NA	0	2
NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	1 crisprs	cas14j	2	1
NZ_CP018071	Enterococcus faecium strain VRE001, complete genome	1 crisprs	cas14j,cas3,csa3,DinG,RT,DEDDh,cas2	0	17
NZ_CP018070	Enterococcus faecium strain VRE001 plasmid unnamed1, complete sequence	0 crisprs	NA	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

17565 : 25513

Streptococcus_phage(87.5%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002354485.1\|17565_18252_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_002347171.1\|18307_18565_+	hypothetical protein	A0A1X9I765	Streptococcus_phage	9.1e-41	98.8
WP_001835296.1\|18656_18872_+	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	4.2e-31	97.1
WP_000301765.1\|18888_19161_+	antitoxin	A0A1X9I6E5	Streptococcus_phage	5.0e-05	100.0
WP_001284311.1\|19162_20026_+	toxin zeta	NA	NA	NA	NA
WP_023843711.1\|20203_20344_-	hypothetical protein	E4ZFP9	Streptococcus_phage	8.0e-15	93.0
WP_001038796.1\|20288_21026_-	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	2.4e-134	99.6
WP_031929417.1\|21150_21234_-	23S rRNA methyltransferase attenuator leader peptide ErmL	NA	NA	NA	NA
WP_001096887.1\|21775_22570_-	aminoglycoside O-phosphotransferase APH(3')-IIIa	E4ZFP6	Streptococcus_phage	2.3e-154	100.0
WP_086953915.1\|24173_25513_-\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-78	52.7

DBSCAN-SWA_2

36304 : 49545

Bacillus_phage(30.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_139896901.1\|36304_36990_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	3.5e-127	99.1
WP_002349227.1\|37192_37405_+	hypothetical protein	NA	NA	NA	NA
WP_000357244.1\|37566_38085_+	YfbU family protein	NA	NA	NA	NA
WP_000774078.1\|38091_38604_+	hypothetical protein	NA	NA	NA	NA
WP_002288897.1\|38874_39498_+	recombinase family protein	M9Q1K0	Clostridium_phage	1.8e-13	30.1
WP_002354485.1\|39587_40274_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_000599739.1\|40471_41077_+	cell filamentation protein	NA	NA	NA	NA
WP_002303206.1\|41092_41665_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	6.8e-36	46.0
WP_073120187.1\|42137_42710_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	5.0e-55	57.1
WP_086953888.1\|42810_43973_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_077828739.1\|44013_44397_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	1.6e-12	45.5
WP_000199136.1\|44378_44633_-\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	2.1e-13	47.6
WP_001196543.1\|44825_45101_-	hypothetical protein	NA	NA	NA	NA
WP_000429439.1\|45072_46026_-	ParA family protein	F0PIG8	Enterococcus_phage	7.7e-16	26.1
WP_000947691.1\|46637_48131_+	replication protein RepR	NA	NA	NA	NA
WP_073120189.1\|48265_48562_+	type III secretion system protein PrgN	NA	NA	NA	NA
WP_002287225.1\|48585_49545_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.4e-32	36.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP018073

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP018073_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018073_1

111347-111474

TypeV

Consensus_repeat	Method
TCAGAGGGTATGAAAATCATACC	CRISPRCasFinder

2 spacers

cas14j

The CRISPR arrays of NZ_CP018073_1

>merge|NZ_CP018073|1|111347-111474|CRISPRCasFinder
TCAGAGGGTATGAAAATCATACCCACCCTCGACGAAAAATCAGACGCTGAATCCCTTGGGGCTCAAGAGGGTATGAAAATCATACCGTGCCAAAACGTTGATAAATCAGAGGGTATGAAAATCATACC

>NZ_CP018073|1|1|111347-111474|CRISPRCasFinder
TCAGAGGGTATGAAAATCATACC	CACCCTCGACGAAAAATCAGACGCTGAATCCCTTGGGGCT
CAAGAGGGTATGAAAATCATACC	GTGCCAAAACGTTGATAAA
TCAGAGGGTATGAAAATCATACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018073.1\|WP_002287522.1\|107095_107500_+\|IS200/IS605-like-element-ISEfa4-family-transposase	unknown	unknown	gnl\|CDD\|376616
NZ_CP018073.1\|WP_002297404.1\|114310_115561_-\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376773
NZ_CP018073.1\|WP_002302440.1\|100212_101514_-\|ISL3-family-transposase	unknown	unknown	gnl\|CDD\|376574
NZ_CP018073.1\|WP_002295674.1\|113732_114074_+\|DUF5406-domain-containing-protein	unknown	unknown	gnl\|CDD\|379975
NZ_CP018073.1\|WP_002303208.1\|106482_106737_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274230
NZ_CP018073.1\|WP_002303486.1\|119883_121893_+\|DNA-topoisomerase-III	unknown	unknown	gnl\|CDD\|236078
NZ_CP018073.1\|WP_002303484.1\|122238_122835_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|379128
NZ_CP018073.1\|WP_002326174.1\|104622_105531_+\|IS982-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP018073.1\|WP_002305808.1\|123902_124235_+\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|180915
NZ_CP018073.1\|WP_002293041.1\|99908_100106_+\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197
NZ_CP018073.1\|WP_002323647.1\|112781_113114_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018073.1\|WP_002348857.1\|109371_109566_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018073.1\|WP_002301801.1\|123749_123881_+\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|180915
NZ_CP018073.1\|WP_002290394.1\|106164_106482_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|368240
NZ_CP018073.1\|WP_002305801.1\|115970_118343_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018073.1\|WP_002323589.1\|107516_108665_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	cas14j	-	gnl\|CDD\|223747
NZ_CP018073.1\|WP_002303603.1\|102728_103013_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|286689
NZ_CP018073.1\|WP_010729620.1\|98759_99713_+\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP018073.1\|WP_002303483.1\|122847_123747_+\|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein	unknown	unknown	gnl\|CDD\|378065
NZ_CP018073.1\|WP_002353594.1\|118403_119873_+\|DUF3991-domain-containing-protein	unknown	unknown	gnl\|CDD\|379044

Protein	Function_ID	Function_description	E-value
NZ_CP018073.1\|WP_002287522.1\|107095_107500_+\|IS200/IS605-like-element-ISEfa4-family-transposase	gnl\|CDD\|376616	pfam01797, Y1_Tnp, Transposase IS200 like. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS200 from E. coli.	2.76401e-48
NZ_CP018073.1\|WP_002297404.1\|114310_115561_-\|IS110-family-transposase	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	8.21771e-29
NZ_CP018073.1\|WP_002302440.1\|100212_101514_-\|ISL3-family-transposase	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	6.08883e-64
NZ_CP018073.1\|WP_002295674.1\|113732_114074_+\|DUF5406-domain-containing-protein	gnl\|CDD\|379975	pfam17400, DUF5406, Family of unknown function (DUF5406). This is a family of unknown function found in Bacteria.	2.01693e-48
NZ_CP018073.1\|WP_002303208.1\|106482_106737_-\|hypothetical-protein	gnl\|CDD\|274230	TIGR02609, hypothetical_protein_XAC1195, putative addiction module antidote. Members of this protein family are putative addiction module antidote proteins that appear recurringly in two-gene operons with members of the Doc (death-on-curing) family TIGR01550. Members of this family contain a SpoVT/AbrB-like domain (pfam04014). Note that the gene pairs with a member of this family tend to be found on bacterial chromosomes, not on plasmids. [Mobile and extrachromosomal element functions, Other].	3.2545e-07
NZ_CP018073.1\|WP_002303486.1\|119883_121893_+\|DNA-topoisomerase-III	gnl\|CDD\|236078	PRK07726, PRK07726, DNA topoisomerase 3.	0
NZ_CP018073.1\|WP_002303484.1\|122238_122835_+\|transcriptional-regulator	gnl\|CDD\|379128	pfam13338, AbiEi_4, Transcriptional regulator, AbiEi antitoxin. AbiEi_4 is the cognate antitoxin of the type IV toxin-antitoxin 'innate immunity' bacterial abortive infection (Abi) system that protects bacteria from the spread of a phage infection. The Abi system is activated upon infection with phage to abort the cell thus preventing the spread of phage through viral replication. There are some 20 or more Abis, and they are predominantly plasmid-encoded lactococcal systems. TA, toxin-antitoxin, systems on plasmids function by killing cells that lose the plasmid upon division. AbiE phage resistance systems function as novel Type IV TAs and are widespread in bacteria and archaea. The cognate antitoxin is pfam13338.	9.24436e-07
NZ_CP018073.1\|WP_002326174.1\|104622_105531_+\|IS982-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	7.3143e-18
NZ_CP018073.1\|WP_002293041.1\|99908_100106_+\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	3.69902e-32
NZ_CP018073.1\|WP_002301801.1\|123749_123881_+\|single-stranded-DNA-binding-protein	gnl\|CDD\|180915	PRK07275, PRK07275, single-stranded DNA-binding protein; Provisional.	6.82317e-18
NZ_CP018073.1\|WP_002290394.1\|106164_106482_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|368240	pfam05016, ParE_toxin, ParE toxin of type II toxin-antitoxin system, parDE. ParE is the toxin family of a type II toxin-antitoxin family. It is toxic towards DNA gyrase, but is neutralized by the antitoxin ParD. The family also encompasses RelE/ParE described in.	2.94793e-05
NZ_CP018073.1\|WP_002305808.1\|123902_124235_+\|single-stranded-DNA-binding-protein	gnl\|CDD\|180915	PRK07275, PRK07275, single-stranded DNA-binding protein; Provisional.	5.51081e-37
NZ_CP018073.1\|WP_002323589.1\|107516_108665_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.71026e-54
NZ_CP018073.1\|WP_002303603.1\|102728_103013_-\|hypothetical-protein	gnl\|CDD\|286689	pfam09639, YjcQ, YjcQ protein. YjcQ is a protein of approx. 100 residues containing four alpha helices and three beta strands. It is expressed in bacteria and also in viruses. It appears to be under the regulation of SigD RNA polymerase which is responsible for the expression of many genes encoding cell-surface proteins related to flagellar assembly, motility, chemotaxis and autolysis in the late exponential growth phase. The exact function of YjcQ is unknown. However, it is thought to be a prophage head protein in viruses.	0.00316107
NZ_CP018073.1\|WP_010729620.1\|98759_99713_+\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	4.00495e-54
NZ_CP018073.1\|WP_002303483.1\|122847_123747_+\|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein	gnl\|CDD\|378065	pfam08843, AbiEii, Nucleotidyl transferase AbiEii toxin, Type IV TA system. This family was recently identified as belonging to the nucleotidyltransferase superfamily. AbiEii is the cognate toxin of the type IV toxin-antitoxin 'innate immunity' bacterial abortive infection (Abi) system that protects bacteria from the spread of a phage infection. The Abi system is activated upon infection with phage to abort the cell thus preventing the spread of phage through viral replication. There are some 20 or more Abis, and they are predominantly plasmid-encoded lactococcal systems. TA, toxin-antitoxin, systems on plasmids function by killing cells that lose the plasmid upon division. AbiE phage resistance systems function as novel Type IV TAs and are widespread in bacteria and archaea. The cognate antitoxin is pfam13338.	2.23069e-32
NZ_CP018073.1\|WP_002353594.1\|118403_119873_+\|DUF3991-domain-containing-protein	gnl\|CDD\|379044	pfam13155, Toprim_2, Toprim-like. This is a family or Toprim-like proteins.	8.02341e-06

>NZ_CP018073.1|WP_002348857.1|109371_109566_-|hypothetical-protein
MMGFFLRFYIIELTGRLTVFFGNFAIKPFAEVTAHYICKWLDCKNKIKKVFHYISSSPCQIRPG
>NZ_CP018073.1|WP_002323589.1|107516_108665_+|IS200/IS605-family-element-transposase-accessory-protein-TnpB
MEQLKAYKFRIYPTEEQEIFFAKSFGCVRKVYNLMLDDRKKAYEEVKNDSSKKMTFPTPAKYKKEFPFLKEIDSLALANAQLNLDKAYKNFFRDKSVGFPRFKSKKNPVQSYTTNNQNGTIALIDSKFIKVPKLKSLVRIKLHRQPKGIIKSATISRHSSGKYYISLLCKEEIIELPKTNSTIGIDLGIMDFAILSDGQKIDNNKFTSKMEKKLKREQRKLSRRALLAKNKGTNLFEAKNYQKQKRKVARLHEKVMNQRTDFLNKLSTEMIKNHDIICIEDLNTKGMLRNHKLAKSISDVSWSKFVTKLQYKADWYGRKIIKVDKWFPSSQICSECGHKDGKKSLEIREWTCPVCHTHHDRDINASINILTEGLRLHSMGLA
>NZ_CP018073.1|WP_002287522.1|107095_107500_+|IS200/IS605-like-element-ISEfa4-family-transposase
MELDTNNHSVFLLYYHLVLVTKYRRQVIDDEISDYAKTTFERISESYHITLVEWNHDKDHVHIMFKAQPKTELTKFINAYKSASSRLIKRDFPRVKQFLWKEMFWSKSFCLLTTGGAPIDVIKKYIQNQGNNHK
>NZ_CP018073.1|WP_002303208.1|106482_106737_-|hypothetical-protein
MGKELKVRKIGNSVGVILPSSLGLKSGDIIQAKQEDNLFILDTTQIAKEHDRKLIEESFQDFEKGLTVSEIEMVKAFGKYGWSE
>NZ_CP018073.1|WP_002290394.1|106164_106482_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MKEYTLVYSKSFQTSLETIIEEWENELALSPASIKRFVGAIQKALELTKNFPTMHEEVSEIYGMDIPTYRIVIGKSYALFYRIDHEKKEILVGRIFQSKQMKLGF
>NZ_CP018073.1|WP_002326174.1|104622_105531_+|IS982-family-transposase
MRSSKYTEHYTDTFITFKEIMRTVSNIYHNCVPDKIKNRRNTDQLKQRDTVIIACVIWGIINGYTSQRATYRAVCSVLFLNGDFPSRSRFTRLSSNLAYTIKIIRYFFIKKLTKGELVGIIDSFPSQLCKPVRNRQAKLLNQIAKVGYNSTKKSYFYGLKIHMIVTKTGFPITYSITNPGVHDVKVLETLSEEANLPNILGDKGYISHKIHEKLALKGITISVPPRKNMDKSEKLDHSLLGKQRKTVETVFSSLEKLGCQNFNSRSVKGLESRFESILLAYSVLLSRAQRRFEGTLRYSLGY
>NZ_CP018073.1|WP_002303603.1|102728_103013_-|hypothetical-protein
MDKNKLRYAILKLRDEKKNPFIELKGQVPEEDILEQTKFLSRNGLLESMVWADNTVHIWGSVSLEGEKYLVENSGLAKAYALAKEVKNWIPFWG
>NZ_CP018073.1|WP_002302440.1|100212_101514_-|ISL3-family-transposase
MPDLHHIKLLLGIKDKNIFITNVESKSIKNIKSLVVSATLSKEIRRCPLCKQMNHEGMIVKNGKKKSLIQLNKCANQLTYLALAKQRYHCRGCHTYFTANTYIVDRNCFIAKQVRYKILEELTEKQAMTTIAKHCGVSWSTVSRTLASLIPMTKVKRNWLPRCLLMDEFRSLKNQVGPYSFSCMDGDTGKLLDILPSRKKKALVSYFMQFERRARLKVKVIVTDMNVSYASLIKECFPKAKLVVDRFHIVKHLIRKFEDIRVRIMKSFDRNDPTQAKYYRQLKALSRLLIKRQDKLVYDKWTKWRNFGWAYLTESEVVDRLLSISDELRIAYFYYQEILQAFHDKEADTFFKLVRTMPNSVPKELHSIKKAFINYESGIRLALELPYSNAKIENLHTHIKALKRVAYGFRSFRKMKTRIFLLNNLITYESKNI
>NZ_CP018073.1|WP_002293041.1|99908_100106_+|cold-shock-protein
MNNGTVKWFNSDKGFGFITGEDGNDVFAHFSAIQGEGFKSLDEGQAVTYDIEEGQRGPQAVNIVK
>NZ_CP018073.1|WP_010729620.1|98759_99713_+|IS30-family-transposase
MTYTHLTPNELVMIEAYFHQETPVAIVAKQLKRGRQTIYNVYNFLKCGGTALEYFEQYKENKRRCGRTEIIFPAEEKEYIAKRSTEGWTPDVIIGRAERTFSCSVSTLYRRFKTGEFNVLHLPMQGKRKPNGYKEKRGKQAFKRNISERKKDYVVFEEEFGHLEGDTIVGIHHKSAVITLVERLSKAIIALKPEGRKAVDIENSINEWLQSVPKNLFKSITFDCGKEFSNWKSISNTNDIDIYFADPGTPSQRGLNEHSNGLLRKDGLPKEMEFNQVNQGFISSVASKRNHIPRKSLNYQTPLEVFLNYVNGKFCLA
>NZ_CP018073.1|WP_002323647.1|112781_113114_+|hypothetical-protein
MSYTGILSLKDICHYGKRCTATEKITKKLSTGQSKTVVQCKKYIIQKDKVSEEMIYYIGKQKQIILKDPIPLKELYPTIKHVYDQNGVLIGRRKNGVLRCTAKGMGRLIG
>NZ_CP018073.1|WP_002295674.1|113732_114074_+|DUF5406-domain-containing-protein
MKNYDPNIRLGTHTIKVSFQRWDYKGFVTFRRGGNCKGLDVLALDEDDLYDQTLTDNPIGFGLLPEDDEGNEWFKMTLMNDNGDELSVEDTWSYLSDYIVSFEIIEFVADKEE
>NZ_CP018073.1|WP_002297404.1|114310_115561_-|IS110-family-transposase
MKLFVGIDVSSEKLDVCFLTDDNQLSILSEISVANDIEGASFIRETILEFNDSYHFDQIVIGMESTSMYSFHPSMFFHEDEKLKKLNTLVTIENPFRVKQFSRMFDENKTDRNDALRIADFLRIQRFTTSPIKEEKYMALQRLTRTRYQLIKQLIRTKQHFLENLTYKCNTLAREMRDESTSLFSATLISLMTEDFTLDELAELPLEAFCDLLQEKGKGRFKQPEKIAKAIQRAITMSYRLGALAQESINVVLSVLVREIRALEKNIKELDKAIEQVIVVIPEYQCLTSIPGVGKVYAAGLIAEIGQIERFEDQTKLAKYAGLSWKVNQSGNYQSQNTPLTKQGNRYFRYYLVEAANSVKNYLPEYKAFYQSKYKEVPKHQHKRALVLTARKFTRLVDTLLRKHQLYTPPRSVIEK
>NZ_CP018073.1|WP_002305801.1|115970_118343_+|hypothetical-protein
MAEEKEPLDNSRLGKSKRKLVRLQNELNEQIEKMFEHQRKTNGQPMNDKRNGHSWFRQQERLENKVHSLREEIKQQEKQVEKLERQEELKEMGYNKYGGLDMTIENIPRIKEEIERFEKGESTFSAATIRKYQRKLETLEQLKERSEKGKENLLPEVQAIIDSGRVTQWKKNPTIYFLKDYRKVALELNENGGFEESKKYQATSEEEKAAVRELLEEAAPTDSLKEKENDHFYRVEFNENDPEKGLKSYGGEIVTLELIDQLKTLDNQYAAEAGYYKFYFEEVKNGEVVDQIRMDLGDGVNSNQPIYLELAKLCEQVPEKEQKQTVKNEPVSKEQMQSKETKTKQKGYQKRTAEEIKQEVKSLSQQALDAVKKHTHSPEDVKELLNFMSRFPERSFRNQLLIEEQFPGATACLGRAALKKEGIYIKKGEQGNKIFVRKTVKGFYEKGRGFVRETEATPEDKKRIESGQIEVIKKPYYTIEKVFDITQTQLKPEDYPKIFPNRVFDFQLDKKGQSELQAGIQAVANNIGIQIRDMTESEVYQRELGQARGAYVRNEFTGEEEIVMNTRNTPTQHLATSIHELAHARMHKFSELDTATKELQAEMTSYIVCKHFGMDTSEKAIPYIAAWTKNGQTLDDKEAAERGKIMNDVSRVANEFIQTISNEINQYREREPEIQPAEVKQEHKNTVETAENKNIVPVGSLWIDKKDGKVMEEDTGRTLHLKDAAFIEDPQHNQVILKGKSYGKEIQTALPSEEFALGNPFRFSLETVSEVAKRKNEIYYEQQLSQKERV
>NZ_CP018073.1|WP_002353594.1|118403_119873_+|DUF3991-domain-containing-protein
MTEKKMSLIDRCKQIDIVDFARNNGMAVVNKGRDYRLEDHDSFVFDRRKQRFYWNSQNISGDIIELAKLFFIDKEIQDSKQQFKAATDFILKNEDKTERVENLHFETEKYKDHPVDYQPLTEKGRNYLKEERKLPEWLIDYAEKEGLIAELKPKHERQNFLVGDDRLDHAVAFLWKDPQTGETVGASYQGTIVDFNRFGKRGTYKHIDKNPTPNHGFNLKIGDPKHLKFFESSIDLLSYAALNREKLQDAWLVSMDGLKHHVISHYVEESISELRRKQTFPQSIEICVDNDRAGHIFYEKEQMKGIVDPFTNKKIRCERGIPNDWQVPKEYKATYEAVAKEMSVEPEAIMAIHKTETNLQLTNQLVSAHDVQSTFGKMLAKGEPVETIDLKEACTTVAKELKVCERADGTYNFDRFYSRKANIKDVNAGILLSYKAEQYYKGYKKHEHEFVPEVKKDWNDQLKHEIQQQEIRKQKRAMLFQQGRQQERE
>NZ_CP018073.1|WP_002303486.1|119883_121893_+|DNA-topoisomerase-III
MKTVILAEKPSQAKAYADSFSKATRKDGYFEIQDRLFTGETVITYGFGHLVELDSPDMYDEKWKQWALEHLPIFPNQYHYHVPKDKKKQFSVVKRQLQSADTIVIATDSDREGELIAWSIIQQAGANQGKTFKRLWINSLEKEAIYQGFQQLRDAEETYPKFEEVQARQIADWLIGMNGSPLYSLLLQQKGIPGSFSLGRVQTPTLYMIYQLQEKIRNFQKEPYFEGKAQVIAQNGAFDAKLDPNETQATQEAFEAYLKEKGVQLGKQPGTILQVETEKKSAASPRLFSLSSLQSKMNQLMKASAKDTLEAMQGLYEGKYLSYPRTDTPYITEGEYAYLLDHLDEYKHFLKAEAIPTPIHTPNSRYVNNKKVQEHYAIIPTKTVMTAAAFEQLSPLQQAIYEQVLKTTVAMFAEKYTYEETTILTQVQQLQLKAIEKVPLDLGWKKLFGKESDGKEKEEEPLLPKVTKGEMVTVDLQVLEKETKPPQPYTEGTLITAMKTAGKTVDSEEAQSILKEVEGIGTEATRANIIETLKQKEYIKVEKNKLVVTNKGILLCQAVEKEPLLTSAEMTAKWESYLLKIGERKGTQTTFLANIQKFVSHLLEVVPGQIQSTDFGSTLQEVKAASEKQEAARHLGICPKCQEQEVLLYQKVAACTSEACDFKRSEGFI
>NZ_CP018073.1|WP_002303484.1|122238_122835_+|transcriptional-regulator
MTKAMVYKLLEEFNGTLALKDAKKAGISPVTIKRMVDRGELDREYPGFFTLPGQFPDELFMAQKKYERGIISHITALDLYDLTDMIPRQIDLTVPYGYHVSEKGLKEFAVELHYTKAEWYELGKIEIKSRYGNPIIAYDPEKTLCDIWNPWYNVEDEIKVKAIKNYMESDRKNLRKLNEYRRILPTDKTMRSYIMALN
>NZ_CP018073.1|WP_002303483.1|122847_123747_+|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein
MTPTQLKAKVKNISREKEVDPQLVLRHFMMEKFLEKISESPYRENFVLKGGFLIGSKYGIENRTTKDIDTTLREMKVTKETLTTVLNDIFSTPTKEGIQFEIQGMKETREADYYPGFSLRVLAHLENMRPDFKVDVTTGDSIYPATITHSHKLMFEDRTIPLESYPTEQIIAEKLSATFDFLTDNSRGKDFYDLYTIPKMEKIDEKTLKDSVRNTFTRRGKTDPLKIYYEKDMDVLKNSHELKDTWKKYQKSNPYAASITYDETMDSISNLMEKVIHVEEKERKLAYQRHQQMNREMER
>NZ_CP018073.1|WP_002301801.1|123749_123881_+|single-stranded-DNA-binding-protein
MINNVTLVGRLTKDPDLRYTASGTAVATFTLAVNRNFTNQNGN
>NZ_CP018073.1|WP_002305808.1|123902_124235_+|single-stranded-DNA-binding-protein
MIWRKPAETMATLAKKGSLIGVVGRIQTRTYDNQQGQRVYVTEVVADNFQLLESKAATESRAHADQSSTSPSTATFEQRNTATPNNNGLNASQNPFGGQSIDISDDDLPF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221215-221254	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	452-491	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244126-244165	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27883-27922	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96547-96586	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	454-493	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	95091-95130	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358204-358243	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119936-119975	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111370-111409	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126934-126973	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153620-153659	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129211-129250	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71269-71308	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249117-249156	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107198-107237	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91401-91440	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102425-102464	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1397-1436	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60361-60400	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97676-97715	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52636-52675	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102650-102689	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200630-200669	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56542-56581	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65332-65371	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67328-67367	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14571-14610	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178898-178937	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33081-33120	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105709-105748	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39886-39925	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	35165-35204	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225612-225651	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92045-92084	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17088-17127	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86167-86206	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61653-61692	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5084-5123	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177278-177317	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244126-244165	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192112-192151	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	453-492	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168262-168301	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221173-221191	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP040906	Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence	51712-51730	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109405-109423	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358162-358180	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119894-119912	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153578-153596	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129169-129187	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249075-249093	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91359-91377	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102383-102401	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60319-60337	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97634-97652	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52594-52612	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102608-102626	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56500-56518	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65290-65308	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14529-14547	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33039-33057	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39844-39862	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92003-92021	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17046-17064	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47586-47604	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192070-192088	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168220-168238	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	515-533	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244189-244207	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27946-27964	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96610-96628	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	517-535	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111433-111451	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126997-127015	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71332-71350	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107261-107279	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1460-1478	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP045013	Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200693-200711	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67391-67409	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP040873	Enterococcus faecium strain DB-1 plasmid punnamed1	40046-40064	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP040876	Enterococcus faecium strain DB-1 plasmid punnamed2	2896-2914	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178961-178979	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105772-105790	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225675-225693	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86230-86248	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61716-61734	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5147-5165	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177341-177359	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244189-244207	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.2\|111433\|19\|NZ_CP018073\|CRISPRCasFinder	111433-111451	19	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	516-534	0	1.0
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109447-109486	1	0.975
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	453-492	1	0.975
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	453-492	1	0.975
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47628-47667	1	0.975
NZ_CP018073_1	1.1\|111370\|40\|NZ_CP018073\|CRISPRCasFinder	111370-111409	40	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	3358-3397	5	0.875

1. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

2. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

3. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

4. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

5. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

6. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

7. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

8. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

9. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

10. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

11. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

12. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

13. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

14. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

15. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

16. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

17. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

18. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

19. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

20. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

21. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

22. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

23. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

24. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

25. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

26. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

27. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

28. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

29. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

30. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

31. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

32. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

33. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

34. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

35. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

36. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

37. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

38. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

39. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

40. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

41. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

42. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

43. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

44. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

45. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

46. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

47. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

48. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

49. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

50. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

51. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

52. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

53. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

54. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

55. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

56. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

57. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

58. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

59. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

60. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

61. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

62. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

63. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

64. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

65. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

66. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

67. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

68. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

69. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

70. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

71. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

72. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

73. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

74. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

75. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

76. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

77. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

78. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

79. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

80. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

81. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

82. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

83. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

84. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

85. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

86. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

87. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

88. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

89. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

90. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

91. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

92. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

93. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

94. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

95. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

96. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

97. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

98. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

99. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

100. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

101. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

102. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

103. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

104. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

105. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

106. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

107. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

108. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

109. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

110. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

111. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

112. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

113. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
****************************************

114. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

115. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP040906 (Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

116. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

117. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

118. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

119. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

120. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

121. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

122. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

123. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

124. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

125. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

126. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

127. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

128. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

129. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

130. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

131. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

132. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

133. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

134. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

135. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

136. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

137. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

138. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

139. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

140. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

141. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

142. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

143. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

144. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

145. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

146. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

147. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

148. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

149. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

150. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

151. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

152. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

153. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

154. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

155. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

156. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

157. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

158. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

159. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

160. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

161. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

162. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

163. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

164. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

165. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

166. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

167. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

168. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

169. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

170. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

171. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

172. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

173. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

174. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

175. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

176. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

177. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

178. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

179. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

180. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

181. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

182. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

183. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

184. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

185. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

186. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

187. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

188. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

189. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

190. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

191. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

192. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

193. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

194. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP045013 (Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

195. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

196. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

197. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

198. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

199. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

200. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP040873 (Enterococcus faecium strain DB-1 plasmid punnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

201. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP040876 (Enterococcus faecium strain DB-1 plasmid punnamed2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

202. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

203. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

204. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

205. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

206. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

207. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

208. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

209. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

210. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

211. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

212. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

213. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

214. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

215. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

216. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

217. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

218. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

219. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

220. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

221. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

222. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

223. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

224. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

225. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

226. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

227. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

228. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

229. spacer 1.2|111433|19|NZ_CP018073|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgccaaaacgttgataaa	CRISPR spacer
gtgccaaaacgttgataaa	Protospacer
*******************

230. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

231. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

232. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcaggcgctgaatcccttggggct	Protospacer
********************.*******************

233. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 1, identity: 0.975

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
catcctcgacgaaaaatcagacgctgaatcccttggggct	Protospacer
**.*************************************

234. spacer 1.1|111370|40|NZ_CP018073|CRISPRCasFinder matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 5, identity: 0.875

caccctcgacgaaaaatcagacgctgaatcccttggggct	CRISPR spacer
caccctcgacgaaaaatcagacgctgaatccttggggctc	Protospacer
*******************************.* *** ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

5493 : 132608

119

Streptococcus_phage(27.91%)

bacteriocin,transposase,integrase,holin

attL 22719:22778|attR 131263:131508

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002302440.1\|5493_6795_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
WP_002301591.1\|9673_10759_+	tyrosine recombinase XerS	NA	NA	NA	NA
WP_000222572.1\|10866_11820_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.7e-34	35.8
WP_002301126.1\|11950_13201_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002298736.1\|13219_14146_-	PEP phosphonomutase	NA	NA	NA	NA
WP_002301128.1\|14224_15220_-	tagatose-bisphosphate aldolase	NA	NA	NA	NA
WP_002301130.1\|15235_16405_-	SIS domain-containing protein	NA	NA	NA	NA
WP_002301131.1\|16420_17155_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_087043335.1\|17925_19088_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.2e-79	51.3
WP_002301811.1\|19656_20949_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	6.1e-32	41.0
WP_002313174.1\|21222_21483_-	hypothetical protein	NA	NA	NA	NA
WP_002346943.1\|21733_22912_+\|transposase	IS256-like element ISEf1 family transposase	A0A220NQR7	Corynebacterium_phage	4.0e-30	25.3
22719:22778	attL	NA	NA	NA	NA
WP_000195429.1\|23087_24260_+\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
22719:22778	attL	NA	NA	NA	NA
WP_077828678.1\|24553_24892_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A0C5AEB1	Paenibacillus_phage	6.6e-23	57.1
WP_002287876.1\|25840_26236_-	aspartate 1-decarboxylase	NA	NA	NA	NA
WP_002287875.1\|26245_27094_-	pantoate--beta-alanine ligase	NA	NA	NA	NA
WP_002287874.1\|27108_27936_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	NA	NA	NA	NA
WP_002287872.1\|27947_28793_-	Rossmann-like and DUF2520 domain-containing protein	NA	NA	NA	NA
WP_002285758.1\|29006_29201_+	hypothetical protein	NA	NA	NA	NA
WP_002287659.1\|29190_29544_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	5.7e-17	38.7
WP_002296127.1\|29645_31193_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.7e-44	28.9
WP_002354485.1\|31986_32673_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_000195429.1\|33296_34469_+\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
WP_002303110.1\|36299_37337_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	7.1e-07	28.5
WP_002304895.1\|37333_37855_-\|transposase	transposase	NA	NA	NA	NA
WP_002304894.1\|37903_38170_-	hypothetical protein	NA	NA	NA	NA
WP_000202380.1\|38589_39909_+\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	4.8e-210	82.7
WP_002303113.1\|40528_41080_-	DUF334 domain-containing protein	NA	NA	NA	NA
WP_002319817.1\|41624_42305_+\|transposase	IS6-like element ISS1N family transposase	A0A1X9I6C6	Streptococcus_phage	2.5e-109	84.1
WP_002304893.1\|42332_42896_+	recombinase family protein	A0A1V0E035	Clostridioides_phage	2.2e-18	34.9
WP_000824191.1\|42940_43108_-	hypothetical protein	NA	NA	NA	NA
WP_000366408.1\|43141_43441_-	hypothetical protein	NA	NA	NA	NA
WP_073120208.1\|43481_44099_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	6.7e-13	33.1
WP_002304891.1\|44423_44819_-	hypothetical protein	NA	NA	NA	NA
WP_000344083.1\|44898_47250_-	DUF1906 domain-containing protein	NA	NA	NA	NA
WP_000718009.1\|47374_48064_-	hypothetical protein	NA	NA	NA	NA
WP_000751236.1\|48077_48530_-	hypothetical protein	NA	NA	NA	NA
WP_002325565.1\|48660_49341_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.3e-126	99.1
WP_002300494.1\|49442_50762_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_002285815.1\|50758_51412_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.0e-24	33.2
WP_002348630.1\|52121_52838_-	aminotransferase class V-fold PLP-dependent enzyme	Q2XUY6	environmental_halophage	4.5e-45	50.0
WP_002302256.1\|52887_53097_-	hypothetical protein	NA	NA	NA	NA
WP_002302261.1\|54753_55785_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.8e-26	34.6
WP_002313180.1\|55791_56622_-	ABC transporter permease	NA	NA	NA	NA
WP_002302265.1\|56618_57425_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_002302267.1\|57430_58255_-	type I phosphodiesterase/nucleotide pyrophosphatase	NA	NA	NA	NA
WP_002347701.1\|58244_59345_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_002302270.1\|59522_60308_+	histidinol phosphate phosphatase	NA	NA	NA	NA
WP_002330694.1\|60340_60724_+	hypothetical protein	NA	NA	NA	NA
WP_077828694.1\|60799_60931_+	hypothetical protein	NA	NA	NA	NA
WP_002322470.1\|60899_61136_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_002302275.1\|61213_62185_-	radical SAM protein	NA	NA	NA	NA
WP_002340465.1\|62836_64459_+\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	2.7e-122	47.5
WP_002301195.1\|64744_66121_-	ABC transporter permease	NA	NA	NA	NA
WP_002298083.1\|66120_66777_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-22	32.1
WP_002301194.1\|66786_68064_-	ABC transporter permease	NA	NA	NA	NA
WP_087121905.1\|68313_69475_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
WP_002330699.1\|69505_69955_-	TlpA family protein disulfide reductase	NA	NA	NA	NA
WP_010706480.1\|70110_70461_-	hypothetical protein	NA	NA	NA	NA
WP_099745858.1\|70926_72088_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.2e-79	53.8
WP_002349250.1\|72713_73238_-	hypothetical protein	NA	NA	NA	NA
72217:72449	attR	NA	NA	NA	NA
WP_002326839.1\|73262_74171_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
72217:72449	attR	NA	NA	NA	NA
WP_002301108.1\|74846_75401_-\|integrase	tyrosine-type recombinase/integrase	W8CYP1	Bacillus_phage	8.6e-36	46.1
WP_002307497.1\|77035_77848_-	hypothetical protein	NA	NA	NA	NA
WP_002316137.1\|78521_79694_+\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	1.1e-133	98.4
WP_002303163.1\|80973_81837_-	triphosphoribosyl-dephospho-CoA synthase CitG	NA	NA	NA	NA
WP_002305953.1\|81829_82387_-	citrate lyase holo-[acyl-carrier protein] synthase	NA	NA	NA	NA
WP_002303161.1\|82383_83943_-	citrate lyase subunit alpha	NA	NA	NA	NA
WP_002303160.1\|83935_84841_-	citrate (pro-3S)-lyase subunit beta	NA	NA	NA	NA
WP_002303159.1\|84845_85139_-	citrate lyase acyl carrier protein	NA	NA	NA	NA
WP_002303158.1\|85142_86156_-	[citrate (pro-3S)-lyase] ligase	NA	NA	NA	NA
WP_002303157.1\|86181_87486_-	2-hydroxycarboxylate transporter family protein	NA	NA	NA	NA
WP_002303156.1\|87466_88654_-	NADP-dependent malic enzyme	NA	NA	NA	NA
WP_002303155.1\|88841_89789_+	DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_002292681.1\|90085_90634_-	hypothetical protein	NA	NA	NA	NA
WP_002292680.1\|90634_91492_-	ParA family protein	F0PIG8	Enterococcus_phage	8.1e-33	30.7
WP_002300557.1\|91777_92065_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_002292678.1\|92054_92384_-	AbrB family transcriptional regulator	NA	NA	NA	NA
WP_002305108.1\|92460_92733_-	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
WP_002303154.1\|92732_92996_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_002303153.1\|93101_93518_-	hypothetical protein	NA	NA	NA	NA
WP_010729614.1\|93523_94204_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.6e-108	83.6
WP_002314359.1\|94744_95935_-\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-26	28.2
WP_073120210.1\|96675_97035_+	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_002303335.1\|97107_97926_-	HAD family hydrolase	NA	NA	NA	NA
WP_002324485.1\|98339_98690_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_010729620.1\|98759_99713_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	4.8e-34	35.8
WP_002293041.1\|99908_100106_+	cold-shock protein	Q9AZD3	Lactococcus_phage	3.9e-23	78.5
WP_002302440.1\|100212_101514_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
WP_002303603.1\|102728_103013_-	hypothetical protein	NA	NA	NA	NA
WP_002326174.1\|104622_105531_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_002290394.1\|106164_106482_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_002303208.1\|106482_106737_-	hypothetical protein	NA	NA	NA	NA
WP_002287522.1\|107095_107500_+\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
WP_002323589.1\|107516_108665_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	9.0e-205	93.7
WP_002348857.1\|109371_109566_-	hypothetical protein	NA	NA	NA	NA
WP_002303636.1\|110917_111958_+	replication protein RepA	NA	NA	NA	NA
WP_002323647.1\|112781_113114_+	hypothetical protein	NA	NA	NA	NA
WP_002295674.1\|113732_114074_+	DUF5406 domain-containing protein	F0PIH7	Enterococcus_phage	1.5e-35	62.5
WP_002297404.1\|114310_115561_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002305801.1\|115970_118343_+	hypothetical protein	B5SP25	Lactococcus_phage	3.4e-12	29.7
WP_002353594.1\|118403_119873_+	DUF3991 domain-containing protein	NA	NA	NA	NA
WP_002303486.1\|119883_121893_+	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	1.6e-111	52.6
WP_002303484.1\|122238_122835_+	transcriptional regulator	NA	NA	NA	NA
WP_002303483.1\|122847_123747_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_002301801.1\|123749_123881_+	single-stranded DNA-binding protein	A8ATZ7	Listeria_phage	1.3e-11	83.3
WP_002305808.1\|123902_124235_+	single-stranded DNA-binding protein	W6LM61	Streptococcus_phage	6.1e-21	53.2
WP_002303482.1\|124279_124513_+	hypothetical protein	NA	NA	NA	NA
WP_002295624.1\|124671_124794_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_002305809.1\|124983_125208_+	hypothetical protein	NA	NA	NA	NA
WP_002305810.1\|125650_125857_+	hypothetical protein	NA	NA	NA	NA
WP_002300797.1\|125856_126108_+	hypothetical protein	NA	NA	NA	NA
WP_002300801.1\|126288_126561_+	hypothetical protein	NA	NA	NA	NA
WP_002300804.1\|127005_127185_+	hypothetical protein	NA	NA	NA	NA
WP_002311569.1\|127243_127600_+	hypothetical protein	NA	NA	NA	NA
WP_000222572.1\|128568_129522_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.7e-34	35.8
WP_002300807.1\|129642_129906_+\|bacteriocin	circular bacteriocin, circularin A/uberolysin family	NA	NA	NA	NA
WP_000997695.1\|130277_131456_+\|transposase	IS256-like element ISEf1 family transposase	A0A220NQR7	Corynebacterium_phage	3.0e-30	25.6
WP_002326066.1\|131654_132608_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.1e-34	36.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP018071

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP018071_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018071_1

2890025-2890134

Orphan

Consensus_repeat	Method
TGATGAACAATACTGGTTGAGCAAAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP018071_1

>merge|NZ_CP018071|1|2890025-2890134|CRISPRCasFinder
TGATGAACAATACTGGTTGAGCAAAGCGAAAGGAGTTTCCTTTCGAGCAAAGCGAGTAGAATCACTATGAACGAAGTGAATAGGTGATGAATAATACTGGTTGAGCAAAG

>NZ_CP018071|1|1|2890025-2890134|CRISPRCasFinder
TGATGAACAATACTGGTTGAGCAAAG	CGAAAGGAGTTTCCTTTCGAGCAAAGCGAGTAGAATCACTATGAACGAAGTGAATAGG
TGATGAATAATACTGGTTGAGCAAAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018071.1\|WP_002294584.1\|2886685_2887558_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801
NZ_CP018071.1\|WP_002296327.1\|2891236_2891926_+\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
NZ_CP018071.1\|WP_002295743.1\|2893150_2894059_+\|IS982-like-element-ISEfm1-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP018071.1\|WP_002287793.1\|2900434_2902594_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	unknown	unknown	gnl\|CDD\|180921
NZ_CP018071.1\|WP_002294577.1\|2882640_2883285_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341358
NZ_CP018071.1\|WP_002294583.1\|2885575_2886595_+\|L-lactate-oxidase	unknown	unknown	gnl\|CDD\|240088
NZ_CP018071.1\|WP_002287787.1\|2896214_2896916_+\|glucosamine-6-phosphate-deaminase	unknown	unknown	gnl\|CDD\|238693
NZ_CP018071.1\|WP_002294581.1\|2884515_2885403_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|283645
NZ_CP018071.1\|WP_002287791.1\|2898191_2899331_+\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP018071.1\|WP_002294579.1\|2883622_2883793_+\|preprotein-translocase-subunit-SecE	unknown	unknown	gnl\|CDD\|376355
NZ_CP018071.1\|WP_002291634.1\|2890206_2890710_+\|50S-ribosomal-protein-L10	unknown	unknown	gnl\|CDD\|234632
NZ_CP018071.1\|WP_002294580.1\|2883893_2884439_+\|transcription-termination/antitermination-protein-NusG	unknown	unknown	gnl\|CDD\|180161
NZ_CP018071.1\|WP_002290558.1\|2894448_2895981_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP018071.1\|WP_002287792.1\|2899419_2900385_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|275027
NZ_CP018071.1\|WP_002294585.1\|2887570_2888239_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	unknown	unknown	gnl\|CDD\|224674
NZ_CP018071.1\|WP_002287788.1\|2897169_2897883_+\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP018071.1\|WP_002294587.1\|2889107_2889797_+\|50S-ribosomal-protein-L1	unknown	unknown	gnl\|CDD\|180071
NZ_CP018071.1\|WP_002294578.1\|2883446_2883599_+\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|234783
NZ_CP018071.1\|WP_002291638.1\|2888581_2889004_+\|50S-ribosomal-protein-L11	unknown	unknown	gnl\|CDD\|234661
NZ_CP018071.1\|WP_002294588.1\|2890762_2891131_+\|50S-ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|234671

Protein	Function_ID	Function_description	E-value
NZ_CP018071.1\|WP_002294584.1\|2886685_2887558_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	2.63238e-103
NZ_CP018071.1\|WP_002296327.1\|2891236_2891926_+\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	2.9371e-19
NZ_CP018071.1\|WP_002295743.1\|2893150_2894059_+\|IS982-like-element-ISEfm1-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.39418e-18
NZ_CP018071.1\|WP_002287793.1\|2900434_2902594_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	gnl\|CDD\|180921	PRK07306, PRK07306, ribonucleotide-diphosphate reductase subunit alpha; Validated.	0
NZ_CP018071.1\|WP_002294577.1\|2882640_2883285_-\|CBS-domain-containing-protein	gnl\|CDD\|341358	cd02205, CBS_pair_SF, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains superfamily. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	5.69774e-14
NZ_CP018071.1\|WP_002294583.1\|2885575_2886595_+\|L-lactate-oxidase	gnl\|CDD\|240088	cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain. LOX is a member of the family of FMN-containing alpha-hydroxyacid oxidases and catalyzes the oxidation of l-lactate using molecular oxygen to generate pyruvate and H2O2. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).	0
NZ_CP018071.1\|WP_002287787.1\|2896214_2896916_+\|glucosamine-6-phosphate-deaminase	gnl\|CDD\|238693	cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.	8.8122e-119
NZ_CP018071.1\|WP_002294581.1\|2884515_2885403_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|283645	pfam06028, DUF915, Alpha/beta hydrolase of unknown function (DUF915). This family consists of several bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.	4.81944e-80
NZ_CP018071.1\|WP_002287791.1\|2898191_2899331_+\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.06838e-61
NZ_CP018071.1\|WP_002294579.1\|2883622_2883793_+\|preprotein-translocase-subunit-SecE	gnl\|CDD\|376355	pfam00584, SecE, SecE/Sec61-gamma subunits of protein translocation complex. SecE is part of the SecYEG complex in bacteria which translocates proteins from the cytoplasm. In eukaryotes the complex, made from Sec61-gamma and Sec61-alpha translocates protein from the cytoplasm to the ER. Archaea have a similar complex.	1.48e-13
NZ_CP018071.1\|WP_002291634.1\|2890206_2890710_+\|50S-ribosomal-protein-L10	gnl\|CDD\|234632	PRK00099, rplJ, 50S ribosomal protein L10; Reviewed.	3.03735e-67
NZ_CP018071.1\|WP_002294580.1\|2883893_2884439_+\|transcription-termination/antitermination-protein-NusG	gnl\|CDD\|180161	PRK05609, nusG, transcription antitermination protein NusG; Validated.	1.97252e-86
NZ_CP018071.1\|WP_002290558.1\|2894448_2895981_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	5.56109e-170
NZ_CP018071.1\|WP_002287792.1\|2899419_2900385_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	gnl\|CDD\|275027	TIGR04171, ribonucleotide-diphosphate_reductase_subunit_beta, ribonucleoside-diphosphate reductase, class 1b, beta subunit. Members of this family are NrdF, the beta subunit of class 1b ribonucleotide reductase. This form uses a dimanganese moiety associated with a tyrosine radical to reduce the cellular requirement for iron. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
NZ_CP018071.1\|WP_002294585.1\|2887570_2888239_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	gnl\|CDD\|224674	COG1760, SdaA, L-serine deaminase [Amino acid transport and metabolism].	1.41351e-73
NZ_CP018071.1\|WP_002287788.1\|2897169_2897883_+\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	6.15701e-49
NZ_CP018071.1\|WP_002294587.1\|2889107_2889797_+\|50S-ribosomal-protein-L1	gnl\|CDD\|180071	PRK05424, rplA, 50S ribosomal protein L1; Validated.	1.66496e-146
NZ_CP018071.1\|WP_002294578.1\|2883446_2883599_+\|50S-ribosomal-protein-L33	gnl\|CDD\|234783	PRK00504, rpmG, 50S ribosomal protein L33; Validated.	3.12722e-17
NZ_CP018071.1\|WP_002291638.1\|2888581_2889004_+\|50S-ribosomal-protein-L11	gnl\|CDD\|234661	PRK00140, rplK, 50S ribosomal protein L11; Validated.	9.059e-96
NZ_CP018071.1\|WP_002294588.1\|2890762_2891131_+\|50S-ribosomal-protein-L7/L12	gnl\|CDD\|234671	PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed.	5.30333e-45

>NZ_CP018071.1|WP_002294587.1|2889107_2889797_+|50S-ribosomal-protein-L1
MAKKSKKMQDALKKVDSSKVYPVAEAVALAKETNIAKFDATVEVAYRLNVDPKKADQQIRGAVVLPNGTGKTQTVLVFAKGDKAKEAEAAGADFVGDDDMVQKIQNGWFDFDVVVATPDMMATVGRLGRVLGPKGLMPNPKTGTVTMDVTKAVNEVKAGKVTYRVDKAGNIHVPIGKVSFDDEKLVENFAAIHDVLLKAKPSAAKGQYMKNVTITTTFGPGIHVDQASF
>NZ_CP018071.1|WP_002291638.1|2888581_2889004_+|50S-ribosomal-protein-L11
MAKKVEKIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGLIIPVVISVYEDRSFTFVTKTPPAAVLLKKAAKIEKGSGEPNKNKVAKVSSDQVREIAELKMEDLNAANVEAAMRMVEGTARSMGITVE
>NZ_CP018071.1|WP_002294585.1|2887570_2888239_-|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta
MKDLRYRSVFDIIGPVMIGPSSSHTAGAARIGKIIRSIFGEQPDSVDIYLYESFAKTYRGHGTDIALVGGLLGMEPDDERLADSLKLAYEAGMEVLFVPKSEKAEHPNSVKMLLKKGTRKLSVTGISIGGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTSILSETNTNIGTMTVTRESKGENAIMIIEVDDPQVEETVKRLKQLPNIDSVNYFD
>NZ_CP018071.1|WP_002294584.1|2886685_2887558_-|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MFLSIEELVDQAKAYPSVAELMIAVEMEMSGRSRSHIIEIMEKNLSVMEQSINEGKEGVTSVTGITGGDAKKLDDYLNEADFLSGETILKAVRNAVAVNEVNAKMGLICATPTAGSAGVVPGVLMAVRDRLDLTHEQQLEFLFTAGAFGLVIANNASISGAEGGCQAEVGSASAMAAAALVCAKNGTPHQAAQAVAITLKNMMGLICDPVAGLVEVPCVKRNALGSSQAFISADMALAGIESVIPPDEVVAAMYQVGRQMPSIFKETAEGGLAVTPTAKRLAEEILNKRA
>NZ_CP018071.1|WP_002294583.1|2885575_2886595_+|L-lactate-oxidase
MEAGAFGYIRGGSEDEWTMKENTTSFNTKKIMPRILRGIDSADLHTSVFGIELDTPIIQAPSAAQGLAHEKGEADTAKGVAAAGSIFSISTYANTTIKDAADAAPGAPQFFQLYMSKDDRFNEFILNKAVEAGAKAIILTADSTLGGYREEDVINQFQFPLPMPNLAAYSEQSASGNGEGKGIAEIYAAAKQGLTPDDIKTIKEITHLPVIVKGIQSPEDAVIAISAGADGIWVSNHGGRQLDGGPASFEVLPKIAEVVNKRVPVIFDSGVRRGEHVFKALASGADLVAIGRPVIYGLNLGGAEGVTSVFEHLNKELSITMQLAGTKTIDEVKNTKLMD
>NZ_CP018071.1|WP_002294581.1|2884515_2885403_+|alpha/beta-fold-hydrolase
MTEPIKNLCKRATAAALVLISLFALSGCQTTKINTTEVSDKEKTAESSKVIEKTTIPTLFFHGYSGTENSFKGMLRRLEKNQQAVKELVLTVGTDGQIQATGDLSGKADNPMVQVLFEDNKNNEWNQAEWIKTCLLYLKENYGIDKVNIVGHSMGGVSALRYLGTYGQDTSLPQVQTLTAIGAPFNDFVDDSAQSLTDELAKGPAVVSNRYQDYQQMIGNIPITTRFFLIAGQLDETDLSDGTVPLNSALAVYALLKQRGNEIEEKVVTGENASHSMLHENQEVDQLVSRFIWKE
>NZ_CP018071.1|WP_002294580.1|2883893_2884439_+|transcription-termination/antitermination-protein-NusG
MESFEKNWYVLHTYSGYENKVKANIESRAQSMKMADFIFRVVVPEEKETEVKNGKEKEIVHKTFPGYVLVEMIMTDASWYVVRNTPGVTGFVGSHGAGSKPAPLLPEEVNHILRSIGMSLRQNDLEVEVGEVVKIIEGAFAGLEGQVTEVDGEKEKLKVNIDMFGRETSTELDFDQVDKID
>NZ_CP018071.1|WP_002294579.1|2883622_2883793_+|preprotein-translocase-subunit-SecE
MKFLKSVKDEIKQVTWPSRKQLRKDTLVVIETSIIFGLMFYVMDTAIQSLFGWILK
>NZ_CP018071.1|WP_002294578.1|2883446_2883599_+|50S-ribosomal-protein-L33
MAKKKAALACSVCGSRNYTKSVSEGKSGERLEINKFCKYCNQYTLHKETK
>NZ_CP018071.1|WP_002294577.1|2882640_2883285_-|CBS-domain-containing-protein
MLLKTLVYKKKDLTTVTETSTLEEALKILETSGYRCVPILDSSGNIFRGNIYKMHIYRHKANGGDMTLPVTHLLKNATKFIYLDTSFFKVFFTIKELPYIAVLDSENHFYGILTHSTLLNMLSQSWSVEQGSYVLTIASTGKQGDLAAIAKIISKHSSIASCITLDIEKDEYIRRTLITLPANTEAKVCETIVNHLEKKNYKVVEIENLQNQEA
>NZ_CP018071.1|WP_002291634.1|2890206_2890710_+|50S-ribosomal-protein-L10
MSEAIIAKKAAIVDEVSEKFTAAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAKKAGLEGMDEVFTGPTAVAFSNEDVVAPAKIMDEFAKEAKALEIKGGIIEGKVSSLEEITALAKLPNREGLLSMLLSVLQAPVRNVAYAVKAVADKEDGDAA
>NZ_CP018071.1|WP_002294588.1|2890762_2891131_+|50S-ribosomal-protein-L7/L12
MALNIENIVAELKEATILELNDLVKAIEEEFGVSAAAPVAVAAAGGAAAAEEQTEFTVELTAAGDQKVKVIKAVREATGLGLKEAKAVVDGAPAPVKEGVSKEEAEELKAKLEEVGASVTVK
>NZ_CP018071.1|WP_002296327.1|2891236_2891926_+|TVP38/TMEM64-family-protein
MKKKIIRLMLISLGIILILVVGYRLYLEYQTDIQLFLNPRASKAELLAHIRSHGTFASILLIVLTAVMCAVPGIPTSVVGVIAGLSFGPLTGAIINILGNALGNITAIFLMHRLKFLDKKTETNHWVQAIRQMKHPKIGVMLGYMIPVIPSSMVNFAADAMKLPLQQIILSIVIGVIPSSVLYACGGEALFHGYNKTAVTLVASVTVLVGLVVFIYKDRKKKQGKQKHK
>NZ_CP018071.1|WP_002295743.1|2893150_2894059_+|IS982-like-element-ISEfm1-family-transposase
MRSSKYTEHYTDTFITFKEIMRTVSNIYHNCVPDKIKNRRNTDQLKQRDTVIIACVIWGIINGYTSQRATYRAVCSVLFPNGDFPSRSRFTRLSSNLAYTIKIIRYFFIKKLTKGELVGIIDSFPSPLCKPVRNRQAKLLNQIAKVGYNSTKKSYFYGLKIHMIVTKTGFPITYSITNPGVHDVKVLETLSEEANLPNILGDKGYISHKIHEKLALKGITISVPPRKNMDKSEKLDHSLLGKQRKTVETVFSSLEKLGCQNFNSRSVKGLESRFESILLAYSVLLSRAQRRFEGTLRYSLGY
>NZ_CP018071.1|WP_002290558.1|2894448_2895981_-|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MSILTLNNITQQFGDKILYEGVDLQLNAGEHLGLIGQNGAGKSTLIKIITGEILPDDGQIHWQKNIHKGYLDQYVEVDETLTIEEFLKTAYAKEYEKEEKIAFLYQTYSETFDDSLLEKAGKLQTELDQGVFYQIDTLVAEMSSGLGIDVLGLDSLLKNLSGGQRSKVILAKLLLENPDVLILDEPTNHLDDQHIQWLTQFLQDFDGAYIVISHDQEFLDQITTHIADIEFGKITKYTGHLKQALKQKEQNRESYLRQYHAQQKQIEKTEAYIRKYKAGSRSTMAKSRQKQLDKIERLTPPASASKAVFDFPFSPIVTTLAVETTDLVIGYDRPLLAPINLTIRFGENIAIRGFNGIGKSTLLKTLIGEIEKISGDFHFPDNTKINYFSQDLYWENPLETPLQYLSSQFPKATIKELRRQLAKAGLVNQLASEPLTTLSGGEQTKVKLAQLTMNQGNLLILDEPTNHIDQETKESLQDGIQKFPGTVIIVSHEQEFYQDLVQRVIEIEPK
>NZ_CP018071.1|WP_002287787.1|2896214_2896916_+|glucosamine-6-phosphate-deaminase
MEIIRVKNAEEGGKKAFEIIKEGMNKGAKVLGLATGSTPVTLYKEMTSSDLDFSEMTSVNLDEYVGLGGSDEQSYRHFMDVQLFDKKPFKETFVPDGKAEDLEAACKKYDQIIDAHPIDIQILGIGQNGHIGFNEPGASFDGTTSVVDLTESTINANKRFFDKAEDVPTKAVSMGIGSIMKSKEIVLMAFGESKADAIKGMIEGPVTNHLPASVLQNHDNVVVIIDEEAASKL
>NZ_CP018071.1|WP_002287788.1|2897169_2897883_+|MgtC/SapB-family-protein
MNDMVLTIPEIILRLGIAMLFGGAIGFERQYKNRPAGMRTHILVCMGACIIALIQVEIASGALRDALEYPQLAGTIRSDEARLIAQVVSGVGFLGAGTIIVTKQSVTGLTTAASLWAIAGLGIAIGMGYYSIAIISFIGIAIALTVVKRVIHVPTTKKLEIQFIHRKETKDFLTDYFEEKNIVIEDVNFDVKFVDDYRVYKNIYTIDLPKGLTYADVIEELSVHKNITKLHLVSIAQ
>NZ_CP018071.1|WP_002287791.1|2898191_2899331_+|AI-2E-family-transporter
MQSRFKQSKLFFWTVELVLTIIGVYFILQMPNIFSPILKMLSAIFLPLLVAGFIYYMFDPIVVFLEKHRIPRVFGFLLTFLVVIILVVLTVMNVVPQLMEQTIQLTQSLPMYADETSKWLNELAQREEFKNFNLEEQLASANLSLSNLFNIILVSLSASVSKIISFMMQFFILLFTVPFILLFMFKDGHKFIDALSHFFPKAIRKELRQTVKELNETLSAYISSTILDALIIGVMSFLAMRIFDQPYSLLLAVICGITNIIPYVGPFIGAVPAIIVGLFISPFQALYMALSILVIQQLDGNLIKPLLFGKSMNIHPLTIILVLIGAGSVAGILGMLICIPVYAVIKTIILNIRKIYLLRRMEHVSEKLDSPKVLEETSE
>NZ_CP018071.1|WP_002287792.1|2899419_2900385_-|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta
MSETYYEAINWNEIEDIIDKSTWEKLTEQFWLDTRIPLSNDLDDWRTLSQLEKDTVGHVFGGLTLLDTVQSESGMDQLRKDVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFDWTNTNPYLQKKAERINEIYKHGTPLEKKIASVFLETFLFYSGFYTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEAEQETLKDWMYNLLYELYENEERYTEELYDPIGWTEEVKTFLRYNANKALMNLGMDPLFPDTANDVNPIVMNGISTGTSNHDFFSQVGNGYLLGHVEAMKDDDYLIGLE
>NZ_CP018071.1|WP_002287793.1|2900434_2902594_-|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha
MSLKNLQDVSYFKLNNEINRPVNGQIPLNKDKEALVAFFEENVKPNTMTFPSIMEKINYLIDQEYIEAEFIQLYSPSFIEKLYQFLDEQHFSFKSFMAAYKFYSQYALKTNDGSAYLETYEDRVAFNALYFANGDEELALALADEMIHQRYQPATPSFLNAGRKRRGELVSCFLTQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSAKKENADEKIRVKTLSLGVIVPDKFYELTRKNEDMYLFSPYSVEKEYGVPFSYVNITAEYDHLVANPNIRKQKIKARDLENEISKLQQESGYPYVINIDTANRENPIDGKIIMSNLCSEILQVQTPSVINGKQEYEVLGTDISCNLGSTNIVNLMQSPNFGQSVRTMTRALTFITDASDIDVVPPIQNGNKLNHTIGLGAMGLHTYLAKEQMEYGSEDSLDFTNIYFMLLNYWTLVESNNIARERKQVFHNFEKSAYADGTYFEKYVTGEFQPKSEKVKALFEGIFIPTAEDWNALKQAVMKDGLYHQNRLAVAPNGSISYINDTSASIHPITRMIEERQEKKIGKIYYPAPYLSNETIPYYTSAYDMDMRKVIDVYATAQQHVDQGMSLTLFMRSEIPEGIYEWKTTTKQTTRDLNILRHYAFHKGIKSIYYVRTFTDDAEEIGSNQCESCVI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

146236 : 206158

Enterococcus_phage(28.57%)

portal,transposase,terminase,tRNA,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287154.1\|146236_146752_+\|tRNA	tRNA adenosine(34) deaminase TadA	NA	NA	NA	NA
WP_002287155.1\|147068_148454_+	multifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'-nucleotidase/3'-nucleotidase	NA	NA	NA	NA
WP_002287156.1\|148490_149168_+	YutD family protein	NA	NA	NA	NA
WP_002287159.1\|149175_149940_+	TIGR01457 family HAD-type hydrolase	NA	NA	NA	NA
WP_002287161.1\|149941_150601_+	TIGR01906 family membrane protein	NA	NA	NA	NA
WP_002287163.1\|150630_151140_-	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	1.5e-39	56.1
WP_002287165.1\|151251_152250_-	NAD(P)/FAD-dependent oxidoreductase	Q9JRK7	Streptococcus_phage	2.6e-30	54.1
WP_002297404.1\|152574_153825_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002287167.1\|154233_154818_+	peptidylprolyl isomerase	A0A1V0S9I2	Catovirus	2.0e-27	43.4
WP_002296072.1\|154894_156070_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_002287231.1\|156151_156532_+	S1 RNA-binding domain-containing protein	NA	NA	NA	NA
WP_002287172.1\|156605_156968_+	hypothetical protein	NA	NA	NA	NA
WP_002296623.1\|157128_158424_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_086956687.1\|164652_165815_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002287966.1\|166023_166398_+	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_002287965.1\|166511_167141_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_002294080.1\|168230_169559_+	aminopeptidase C	R4TV59	Phaeocystis_globosa_virus	7.3e-73	38.1
WP_002287963.1\|169760_170594_+	phosphotransferase	NA	NA	NA	NA
WP_002287962.1\|170609_171347_+	acyl-ACP thioesterase	NA	NA	NA	NA
WP_002287961.1\|171501_172470_-	asparaginase	NA	NA	NA	NA
WP_002287960.1\|172701_173535_+	DUF72 domain-containing protein	NA	NA	NA	NA
WP_002287959.1\|173568_174408_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002287958.1\|174433_174994_+	haloacid dehalogenase	A0A0H3UZF4	Geobacillus_virus	2.3e-28	45.1
WP_002287957.1\|175192_176914_+	septation ring formation regulator EzrA	NA	NA	NA	NA
WP_002287956.1\|177078_178221_+	cysteine desulfurase	NA	NA	NA	NA
WP_002287955.1\|178236_179448_+\|tRNA	tRNA 4-thiouridine(8) synthase ThiI	NA	NA	NA	NA
WP_002287954.1\|180020_180668_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_002287953.1\|181060_183706_+\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	4.0e-163	42.9
WP_002294071.1\|184015_185329_+	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_002287951.1\|185318_185972_+	HAD family phosphatase	NA	NA	NA	NA
WP_002304462.1\|186026_186698_+	DNA repair protein RadC	NA	NA	NA	NA
WP_002303263.1\|186592_187945_-	recombinase family protein	D2IZV7	Enterococcus_phage	1.7e-133	55.3
WP_002303264.1\|188010_189300_-	DUF4041 domain-containing protein	M1NRY5	Streptococcus_phage	5.6e-46	74.0
WP_002303265.1\|189386_190091_-	LexA family transcriptional regulator	D7RWF2	Brochothrix_phage	6.2e-39	42.4
WP_002303266.1\|190290_190557_+	helix-turn-helix transcriptional regulator	A0A1W6JP54	Staphylococcus_phage	5.4e-12	52.7
WP_002304464.1\|190724_190955_-	DUF2188 domain-containing protein	E8ZD70	Streptococcus_phage	4.4e-10	49.3
WP_002299038.1\|191026_191182_+	hypothetical protein	NA	NA	NA	NA
WP_002304466.1\|191490_191730_-	DUF2188 domain-containing protein	E8ZD70	Streptococcus_phage	1.8e-27	81.1
WP_002303273.1\|191981_192317_+	hypothetical protein	NA	NA	NA	NA
WP_002303275.1\|192549_193491_+	endonuclease	D2IZK1	Enterococcus_phage	2.7e-146	78.9
WP_002303277.1\|193492_194383_+	hypothetical protein	D2IYT9	Enterococcus_phage	6.2e-137	84.5
WP_002303278.1\|194425_195226_+	hypothetical protein	B4XYS6	Lactobacillus_phage	8.9e-58	54.5
WP_002299339.1\|195240_196092_+	AAA family ATPase	A0A0P0I3L9	Lactobacillus_phage	2.3e-27	30.2
WP_002317474.1\|196088_196406_+	hypothetical protein	NA	NA	NA	NA
WP_002305847.1\|196398_196581_+	hypothetical protein	NA	NA	NA	NA
WP_002303279.1\|196582_197053_+	hypothetical protein	A0A0A7RWK2	Clostridium_phage	9.6e-12	33.8
WP_002303280.1\|197049_197592_+	DUF1642 domain-containing protein	Q8W5X2	Listeria_phage	3.9e-17	40.7
WP_002303281.1\|197588_197972_+	hypothetical protein	NA	NA	NA	NA
WP_002303282.1\|197968_198199_+	hypothetical protein	A0A0S2MYD2	Enterococcus_phage	1.6e-12	52.1
WP_002303283.1\|198205_198409_+	hypothetical protein	NA	NA	NA	NA
WP_002303285.1\|198405_198702_+	hypothetical protein	NA	NA	NA	NA
WP_002303286.1\|198778_199192_+	autolysin	C9E2P5	Enterococcus_phage	5.6e-56	81.0
WP_002303288.1\|199204_199591_+	hypothetical protein	O34053	Streptococcus_phage	1.6e-28	53.5
WP_002303289.1\|200540_200801_+	hypothetical protein	A0A0S2MYE7	Enterococcus_phage	7.9e-16	51.1
WP_002303291.1\|201405_202239_+\|terminase	small subunit of terminase	D2IYW0	Enterococcus_phage	1.5e-79	68.8
WP_002298064.1\|202231_203647_+	hypothetical protein	C9E2I7	Enterococcus_phage	1.0e-218	79.7
WP_002303292.1\|203658_205188_+\|portal	phage portal protein	A0A0S2MVB2	Bacillus_phage	1.3e-28	25.0
WP_002298060.1\|205279_206158_+\|head	phage head morphogenesis protein	NA	NA	NA	NA

DBSCAN-SWA_2

209861 : 269473

Lactococcus_phage(21.43%)

transposase,tRNA,tail,holin,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002303295.1\|209861_210470_+\|tail	tail protein	NA	NA	NA	NA
WP_002303297.1\|210469_210811_+	hypothetical protein	NA	NA	NA	NA
WP_002305859.1\|211052_213842_+	tape measure protein	D7RWD8	Brochothrix_phage	8.4e-71	40.2
WP_002303299.1\|213831_214572_+\|tail	tail protein	NA	NA	NA	NA
WP_002347081.1\|214568_217331_+	CHAP domain-containing protein	Q9AZX5	Lactococcus_phage	6.0e-138	39.1
WP_002347082.1\|217343_218252_+\|plate	phage baseplate upper protein	A0A1P8BLW0	Lactococcus_phage	7.8e-10	25.2
WP_002303306.1\|218251_218872_+	hypothetical protein	NA	NA	NA	NA
WP_002319918.1\|218875_219325_+	hypothetical protein	NA	NA	NA	NA
WP_002347378.1\|219324_219819_+	hypothetical protein	NA	NA	NA	NA
WP_002332774.1\|219832_220180_+	hypothetical protein	NA	NA	NA	NA
WP_002302750.1\|220172_220313_+	XkdX family protein	A0A2H4JD72	uncultured_Caudovirales_phage	1.1e-08	54.8
WP_002349260.1\|220412_220802_+\|holin	phage holin family protein	F0PIJ6	Enterococcus_phage	9.0e-40	69.7
WP_002302753.1\|220798_221809_+	N-acetylmuramoyl-L-alanine amidase	A0A1G5SA77	Enterococcus_phage	2.8e-61	66.1
WP_002302755.1\|221923_223132_+	hypothetical protein	NA	NA	NA	NA
WP_025477679.1\|224126_224429_-	hypothetical protein	NA	NA	NA	NA
WP_002347085.1\|224407_224815_+	hypothetical protein	NA	NA	NA	NA
WP_002305550.1\|224801_225254_+	hypothetical protein	NA	NA	NA	NA
WP_002347086.1\|225246_225645_+	hypothetical protein	NA	NA	NA	NA
WP_002294067.1\|226720_226921_+	cold-shock protein	Q9AZD3	Lactococcus_phage	3.7e-21	71.2
WP_002287948.1\|227174_228854_-	ribonuclease J	NA	NA	NA	NA
WP_002287947.1\|228855_229068_-	DNA-dependent RNA polymerase auxiliary subunit epsilon family protein	NA	NA	NA	NA
WP_002296290.1\|229460_231191_+	multidrug efflux ABC transporter subunit EfrA	W8CYL7	Bacillus_phage	2.1e-43	27.6
WP_002289400.1\|231187_232948_+	multidrug efflux ABC transporter subunit EfrB	W8CYL7	Bacillus_phage	2.5e-52	28.6
WP_002296291.1\|233042_233240_+	hypothetical protein	NA	NA	NA	NA
WP_002289401.1\|233392_233878_+	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_002289402.1\|233981_234575_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	8.9e-55	55.6
WP_002289403.1\|234754_235282_+	hypothetical protein	NA	NA	NA	NA
WP_002289404.1\|235372_236110_+	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	2.3e-12	40.0
WP_002289405.1\|236113_237031_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_002289406.1\|237032_238262_+	GTPase HflX	NA	NA	NA	NA
WP_000222572.1\|238295_239249_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002287759.1\|239899_241513_-	CoA-disulfide reductase	NA	NA	NA	NA
WP_002296511.1\|241653_242562_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002287757.1\|242744_243869_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_002287756.1\|243893_244073_+	hypothetical protein	NA	NA	NA	NA
WP_002287755.1\|244095_245013_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_002302991.1\|245005_245839_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002287753.1\|245921_247040_+	glycosyl hydrolase family 88	NA	NA	NA	NA
WP_073119935.1\|247033_248932_+	DUF2264 domain-containing protein	NA	NA	NA	NA
WP_002321414.1\|248925_250149_+	glucuronyl hydrolase	NA	NA	NA	NA
WP_002287747.1\|250234_252169_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	1.1e-58	31.9
WP_002287746.1\|252394_253051_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_002287745.1\|253124_253478_-	thioredoxin family protein	NA	NA	NA	NA
WP_002287744.1\|253669_254599_+	permease	NA	NA	NA	NA
WP_002287743.1\|254609_255446_+	TIGR03943 family protein	NA	NA	NA	NA
WP_002287742.1\|255693_256470_+	response regulator transcription factor	NA	NA	NA	NA
WP_002287741.1\|256645_257389_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.6e-29	30.9
WP_002296509.1\|257381_258962_+	ABC transporter	NA	NA	NA	NA
WP_002289868.1\|259212_259692_-	threonine/serine exporter	NA	NA	NA	NA
WP_002289867.1\|259707_260460_-	threonine/serine exporter family protein	NA	NA	NA	NA
WP_002290883.1\|261012_261738_+	DNA/RNA non-specific endonuclease	NA	NA	NA	NA
WP_002290885.1\|261991_262258_+	IreB family regulatory phosphoprotein	NA	NA	NA	NA
WP_002290886.1\|262254_262686_+	Holliday junction resolvase RuvX	NA	NA	NA	NA
WP_002295049.1\|262711_263014_+	DUF1292 domain-containing protein	NA	NA	NA	NA
WP_002302985.1\|263203_264040_+	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_002295053.1\|264103_264535_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002302984.1\|264596_265919_-	2-hydroxycarboxylate transporter family protein	NA	NA	NA	NA
WP_002302982.1\|266072_267713_-	NAD-dependent malic enzyme	NA	NA	NA	NA
WP_000202380.1\|268153_269473_-\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	4.8e-210	82.7

DBSCAN-SWA_3

451847 : 564458

100

Streptococcus_phage(42.86%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002303202.1\|451847_453395_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_002297185.1\|453659_454955_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002305661.1\|455122_456169_+	GDP-mannose 4,6-dehydratase	M4QRT5	Synechococcus_phage	1.8e-122	63.1
WP_002323224.1\|456248_457262_+	hypothetical protein	NA	NA	NA	NA
WP_002305663.1\|457298_458243_+	GDP-L-fucose synthase	A0A1D8KU05	Synechococcus_phage	1.5e-93	53.4
WP_002305664.1\|458310_459624_+	cupin domain-containing protein	A0A1V0SH58	Hokovirus	2.6e-38	26.9
WP_002323227.1\|459707_460610_+	hypothetical protein	NA	NA	NA	NA
WP_002305666.1\|460614_462267_+	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	2.6e-104	40.5
WP_002305667.1\|462290_463157_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002350942.1\|463198_463390_-	hypothetical protein	NA	NA	NA	NA
WP_073119958.1\|463419_463932_+	hypothetical protein	NA	NA	NA	NA
WP_002302440.1\|463962_465264_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
WP_002305669.1\|465587_465941_+	hypothetical protein	NA	NA	NA	NA
WP_002349152.1\|466883_467078_+	hypothetical protein	M1PSF2	Streptococcus_phage	1.1e-14	72.0
WP_002305671.1\|467382_467541_+	PTS sugar transporter	NA	NA	NA	NA
WP_002325884.1\|467795_468749_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002305672.1\|468911_469862_-	membrane protein insertase YidC	NA	NA	NA	NA
WP_002289551.1\|470577_470853_-	acylphosphatase	NA	NA	NA	NA
WP_002305673.1\|470959_471724_+	RNA methyltransferase	A0A2D1A6G0	Rhodococcus_phage	1.7e-05	26.1
WP_002289559.1\|471846_472350_+	HD domain-containing protein	NA	NA	NA	NA
WP_002305674.1\|472757_473405_+	elongation factor G-binding protein	NA	NA	NA	NA
WP_002305675.1\|473567_474836_+	voltage-gated chloride channel family protein	A0A1X9I5Z9	Streptococcus_phage	2.4e-41	31.1
WP_002323866.1\|474862_476062_-	YdcF family protein	NA	NA	NA	NA
WP_002305677.1\|476180_477488_-	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_002288760.1\|477958_479077_+	hypothetical protein	NA	NA	NA	NA
WP_002323868.1\|479377_479698_+	hypothetical protein	NA	NA	NA	NA
WP_002288762.1\|480149_480350_+	cold-shock protein	Q9AZD3	Lactococcus_phage	2.5e-22	74.2
WP_002305678.1\|480496_483286_+	DNA polymerase III subunit epsilon	A0A1X9I5C8	Streptococcus_phage	2.1e-90	31.0
WP_002321579.1\|483332_483860_+	peptidase	NA	NA	NA	NA
WP_002305679.1\|483880_485071_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_002305681.1\|485110_486409_+\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	1.2e-59	30.3
WP_002305683.1\|487203_487878_+	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_002323072.1\|487874_488216_+	hypothetical protein	NA	NA	NA	NA
WP_002288776.1\|488245_488605_+	YccF domain-containing protein	NA	NA	NA	NA
WP_002305684.1\|489128_491213_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	9.9e-117	35.7
WP_002288779.1\|491523_492990_+	amino acid permease	NA	NA	NA	NA
WP_002349135.1\|493299_493773_+	hypothetical protein	A0A097BYE2	Leuconostoc_phage	1.1e-10	28.8
WP_002294855.1\|493846_494287_+	CopY/TcrY family copper transport repressor	NA	NA	NA	NA
WP_002289040.1\|494299_494509_+	copper chaperone CopZ	NA	NA	NA	NA
WP_002349136.1\|494508_496695_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.4e-121	38.7
WP_002323053.1\|496714_498886_+	copper/silver-translocating P-type ATPase CopB	A0A218MNH6	uncultured_virus	2.9e-71	32.3
WP_002305688.1\|498997_501169_-	transglutaminase	NA	NA	NA	NA
WP_002323055.1\|501158_502232_-	DUF58 domain-containing protein	NA	NA	NA	NA
WP_010721082.1\|502245_503094_-	MoxR family ATPase	NA	NA	NA	NA
WP_002323057.1\|503447_504737_+	hypothetical protein	NA	NA	NA	NA
WP_002294835.1\|504810_505380_+	prevent-host-death protein	NA	NA	NA	NA
WP_094932120.1\|505753_506916_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	2.7e-79	51.3
WP_042959742.1\|506996_507572_+	hypothetical protein	Q9MCC6	Lactobacillus_phage	4.8e-13	35.9
WP_086953915.1\|507641_508980_+\|transposase	IS3-like element ISEnfa3 family transposase	A0A1B1P773	Bacillus_phage	2.6e-78	52.7
WP_008266934.1\|509259_509673_+	DUF4231 domain-containing protein	NA	NA	NA	NA
WP_002305694.1\|509904_510162_-	hypothetical protein	NA	NA	NA	NA
WP_002297404.1\|510447_511698_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002287105.1\|512107_513082_+	choloylglycine hydrolase family protein	M1HVK5	Paramecium_bursaria_Chlorella_virus	5.4e-25	31.8
WP_002322761.1\|513811_514129_+	hypothetical protein	NA	NA	NA	NA
WP_002289810.1\|514332_514698_-	hypothetical protein	NA	NA	NA	NA
WP_002305696.1\|514905_515388_+	hypothetical protein	NA	NA	NA	NA
WP_002289807.1\|515584_516475_+	phosphate ABC transporter substrate-binding protein PstS family protein	NA	NA	NA	NA
WP_002305697.1\|516799_519271_+	cation-translocating P-type ATPase	M1HBF8	Paramecium_bursaria_Chlorella_virus	3.1e-45	29.2
WP_002297195.1\|519373_521110_-	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	1.2e-27	34.1
WP_002293705.1\|521106_521811_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.4e-38	36.2
WP_002297194.1\|521941_522445_+	DUF523 domain-containing protein	NA	NA	NA	NA
WP_002293708.1\|522404_522743_+	putative DNA-binding protein	NA	NA	NA	NA
WP_002293709.1\|522763_524182_+	signal recognition particle protein	NA	NA	NA	NA
WP_002293710.1\|524293_524872_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_002297192.1\|524875_525397_+	dihydrofolate reductase	NA	NA	NA	NA
WP_002293714.1\|525475_526030_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	2.3e-12	29.3
WP_002290274.1\|526282_526558_+	30S ribosomal protein S16	NA	NA	NA	NA
WP_002290277.1\|526569_526821_+	KH domain-containing protein	NA	NA	NA	NA
WP_002297190.1\|526945_527737_+	hypothetical protein	NA	NA	NA	NA
WP_002293716.1\|527906_528428_+	ribosome maturation factor RimM	NA	NA	NA	NA
WP_002293717.1\|528417_529179_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_002286913.1\|529314_529662_+	50S ribosomal protein L19	NA	NA	NA	NA
WP_002286921.1\|530034_530697_+	hypothetical protein	NA	NA	NA	NA
WP_002305699.1\|530775_534003_+	fibrinogen-binding MSCRAMM adhesin Fss3	NA	NA	NA	NA
WP_002286925.1\|534116_534431_+	YdcP family protein	A0A1S5SF38	Streptococcus_phage	1.7e-25	53.4
WP_002286926.1\|534443_534818_+	YdcP family protein	A0A1S5SF96	Streptococcus_phage	1.1e-34	62.9
WP_002305701.1\|534818_535172_+	DNA-damage-inducible protein J	NA	NA	NA	NA
WP_002349191.1\|535242_536595_+	DUF87 domain-containing protein	A0A1S5SFB5	Streptococcus_phage	3.8e-162	64.4
WP_002286932.1\|536654_537797_+	DNA cytosine methyltransferase	A0A1S5SEK0	Streptococcus_phage	1.7e-126	62.1
WP_002286933.1\|537821_538076_+	hypothetical protein	NA	NA	NA	NA
WP_002286934.1\|538331_539516_+	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	1.9e-141	60.8
WP_002305703.1\|539512_539650_+	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_002286940.1\|540395_542306_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.1e-37	29.8
WP_033657400.1\|542409_542634_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	8.8e-24	83.8
WP_002288934.1\|542646_543147_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	7.0e-53	59.6
WP_002288935.1\|543243_545091_+	PHP domain-containing protein	NA	NA	NA	NA
WP_002305705.1\|545093_545990_+	AAA family ATPase	A0A1B1IUG5	uncultured_Mediterranean_phage	1.1e-16	29.7
WP_002288938.1\|546039_546429_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	1.4e-40	65.9
WP_002298631.1\|548662_550489_+	group II intron reverse transcriptase/maturase	H7BVW2	unidentified_phage	3.7e-11	26.8
WP_002296840.1\|551533_552721_+\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002305708.1\|553021_555151_+	FUSC family protein	A0A1S5SF30	Streptococcus_phage	1.8e-182	60.3
WP_002289057.1\|555147_556155_+	lipoprotein	A0A1S5SEZ8	Streptococcus_phage	4.8e-117	63.9
WP_002289055.1\|556171_557083_+	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	1.1e-59	42.2
WP_002289053.1\|557210_557939_-	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	5.1e-36	37.1
WP_002321361.1\|557935_559345_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_002305709.1\|559672_560794_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_077828749.1\|561213_561450_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002302055.1\|561402_562356_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002305710.1\|562694_563204_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_086956705.1\|563296_564458_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	53.5

DBSCAN-SWA_4

577803 : 633528

Streptococcus_phage(33.33%)

integrase,transposase,tRNA

attL 571978:571993|attR 589771:589786

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
571978:571993	attL	NA	NA	NA	NA
WP_086956687.1\|577803_578965_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002285758.1\|579096_579291_+	hypothetical protein	NA	NA	NA	NA
WP_002287659.1\|579280_579634_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_002299190.1\|579735_581283_+\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_002288962.1\|581434_581863_+	hypothetical protein	NA	NA	NA	NA
WP_002288964.1\|581849_582092_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002288966.1\|582391_582607_-	hypothetical protein	NA	NA	NA	NA
WP_002300928.1\|582713_583028_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002288969.1\|583131_584310_+\|integrase	site-specific integrase	S6C485	Thermus_phage	1.4e-30	31.1
WP_002288970.1\|584712_585006_+	DUF2087 domain-containing protein	NA	NA	NA	NA
WP_002302440.1\|585102_586404_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
WP_002305732.1\|587349_589677_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_080490133.1\|592789_593962_+	class C sortase	NA	NA	NA	NA
589771:589786	attR	NA	NA	NA	NA
WP_002288983.1\|594123_594618_-	hypothetical protein	NA	NA	NA	NA
WP_002321037.1\|594614_594809_-	hypothetical protein	NA	NA	NA	NA
WP_002288984.1\|595203_595626_+	HTH domain-containing protein	NA	NA	NA	NA
WP_002288985.1\|595791_596985_-	MFS transporter	NA	NA	NA	NA
WP_002288986.1\|597208_597586_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_002321036.1\|597573_597912_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_002288989.1\|598045_598489_+	LysR family transcriptional regulator substrate-binding protein	NA	NA	NA	NA
WP_002303949.1\|598750_599566_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002300930.1\|599575_600238_+	DUF624 domain-containing protein	NA	NA	NA	NA
WP_002289620.1\|600442_602107_+	acetolactate synthase AlsS	NA	NA	NA	NA
WP_002289619.1\|602119_602830_+	acetolactate decarboxylase	NA	NA	NA	NA
WP_002289618.1\|602959_603457_+	GAF domain-containing protein	NA	NA	NA	NA
WP_002289617.1\|603641_603902_+	hypothetical protein	NA	NA	NA	NA
WP_002321266.1\|604263_604503_-	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|604839_606018_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002323892.1\|606134_606449_+	hypothetical protein	NA	NA	NA	NA
WP_002302293.1\|607592_607895_-	hypothetical protein	NA	NA	NA	NA
WP_002297218.1\|608213_609509_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002288592.1\|610173_610947_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_002288595.1\|611090_611441_+	SdpI family protein	NA	NA	NA	NA
WP_002288590.1\|611421_612138_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.0e-33	35.7
WP_002288588.1\|612137_613586_+	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	1.7e-19	29.3
WP_002288586.1\|613655_614165_-	hypothetical protein	NA	NA	NA	NA
WP_002296838.1\|614154_614880_-	hypothetical protein	NA	NA	NA	NA
WP_002297185.1\|615107_616403_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002303943.1\|616624_618745_-	LTA synthase family protein	W6LM83	Streptococcus_phage	8.2e-220	58.0
WP_002288581.1\|618974_620153_+	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	3.9e-102	48.9
WP_002305727.1\|620168_620927_+	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	1.9e-25	36.4
WP_002288577.1\|620949_621435_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_002288576.1\|621505_622759_-	NAD(P)/FAD-dependent oxidoreductase	A0A2H4PQX1	Staphylococcus_phage	7.7e-24	55.3
WP_002288575.1\|622875_624225_+	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_002288574.1\|624336_625683_+	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_002288573.1\|625990_626377_-	YxeA family protein	NA	NA	NA	NA
WP_002326704.1\|626425_627334_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002311774.1\|627546_628506_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	7.5e-11	27.2
WP_002297633.1\|629369_629582_+	hypothetical protein	NA	NA	NA	NA
WP_002287775.1\|629859_631659_-	glycerophosphoryl diester phosphodiesterase	I6XE30	Staphylococcus_phage	5.3e-10	26.5
WP_002287776.1\|631782_632379_-	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	8.7e-34	41.7
WP_002301399.1\|632568_633528_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8

DBSCAN-SWA_5

641990 : 704666

Streptococcus_phage(28.57%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296623.1\|641990_643286_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_002296121.1\|643495_644014_+	dihydrofolate reductase	G3MBI7	Bacillus_virus	7.1e-24	39.1
WP_002293906.1\|644090_645047_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002293905.1\|645212_646019_+	ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	1.0e-13	32.1
WP_002293904.1\|646015_647005_+	iron ABC transporter permease	NA	NA	NA	NA
WP_002301321.1\|647001_648006_+	iron ABC transporter permease	NA	NA	NA	NA
WP_002289886.1\|648137_648680_+	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_002289885.1\|648699_649398_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_002293902.1\|649418_649631_+	YqgQ family protein	NA	NA	NA	NA
WP_002288462.1\|649630_650593_+	ROK family glucokinase	NA	NA	NA	NA
WP_002288461.1\|650610_651006_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_002288459.1\|651168_651534_+	DUF488 family protein	NA	NA	NA	NA
WP_010729586.1\|651530_653342_+	FAD/NAD(P)-binding protein	NA	NA	NA	NA
WP_002288457.1\|653403_653571_-	DUF3042 family protein	NA	NA	NA	NA
WP_002288452.1\|653818_654808_+	UDP-glucose 4-epimerase GalE	A0A1V0SG19	Hokovirus	2.1e-48	36.8
WP_002288451.1\|654819_656304_+	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_002288449.1\|656327_657308_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.8e-19	28.9
WP_002288447.1\|657396_658221_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_002288446.1\|658204_658747_+	ribosomal-protein-alanine N-acetyltransferase	NA	NA	NA	NA
WP_002288445.1\|658753_659218_+	ribosomal-protein-alanine N-acetyltransferase	NA	NA	NA	NA
WP_002301319.1\|659214_660231_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	5.4e-60	41.0
WP_002288442.1\|660839_661541_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_000202380.1\|661828_663148_-\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	4.8e-210	82.7
WP_002288439.1\|663685_664915_+	arginine deiminase	NA	NA	NA	NA
WP_002288437.1\|665005_666025_+	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_002288434.1\|666139_667087_+	carbamate kinase	NA	NA	NA	NA
WP_002302440.1\|667237_668539_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
WP_002288432.1\|669007_670699_+\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	2.9e-74	32.6
WP_002288430.1\|671152_671698_-	phosphonoacetaldehyde hydrolase	NA	NA	NA	NA
WP_002326699.1\|671701_671830_-	hypothetical protein	NA	NA	NA	NA
WP_002326698.1\|671822_672914_-	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
WP_002293881.1\|673130_673610_-	ArgR family transcriptional regulator	NA	NA	NA	NA
WP_002293880.1\|673968_674751_+	30S ribosomal protein S2	NA	NA	NA	NA
WP_002293878.1\|674849_675731_+	elongation factor Ts	NA	NA	NA	NA
WP_002293877.1\|675866_676589_+	UMP kinase	NA	NA	NA	NA
WP_002293875.1\|676591_677149_+	ribosome recycling factor	NA	NA	NA	NA
WP_010729587.1\|677467_678718_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	6.8e-113	62.1
WP_002294134.1\|679126_679939_+	isoprenyl transferase	R9W0U9	Flavobacterium_phage	2.0e-25	46.8
WP_002294135.1\|679935_680736_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_080490134.1\|680896_682165_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_002294137.1\|682232_683942_+\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_002288497.1\|684153_688512_+	PolC-type DNA polymerase III	A0A0K2SUJ2	Clostridium_phage	1.9e-21	40.8
WP_002288499.1\|688656_689130_+	ribosome maturation factor RimP	NA	NA	NA	NA
WP_002288500.1\|689152_690328_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_002288501.1\|690349_690643_+	YlxR family protein	NA	NA	NA	NA
WP_002288509.1\|690639_690951_+	YlxQ-related RNA-binding protein	NA	NA	NA	NA
WP_002288511.1\|690963_693270_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	3.6e-19	23.7
WP_002288513.1\|693296_693644_+	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_002297218.1\|693838_695134_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002288514.1\|695404_695578_-	hypothetical protein	NA	NA	NA	NA
WP_002288520.1\|698755_699679_+\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_002288521.1\|699682_700624_+	riboflavin biosynthesis protein RibF	NA	NA	NA	NA
WP_002288522.1\|700975_701761_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_002288523.1\|701773_702625_+	sugar transporter	NA	NA	NA	NA
WP_002296526.1\|702748_703201_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002294467.1\|703665_704034_-	hypothetical protein	NA	NA	NA	NA
WP_002294466.1\|704183_704666_+\|tRNA	prolyl-tRNA editing protein	NA	NA	NA	NA

DBSCAN-SWA_6

874263 : 892179

Bacillus_phage(16.67%)

integrase,protease,transposase

attL 866175:866193|attR 898911:898929

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
866175:866193	attL	NA	NA	NA	NA
WP_002353651.1\|874263_875406_+\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	2.0e-39	32.4
WP_002288357.1\|875625_876753_-\|integrase	site-specific integrase	A0A2I7SCV1	Paenibacillus_phage	1.8e-109	55.5
WP_000222572.1\|876809_877763_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_000997695.1\|877918_879097_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002321532.1\|879342_879633_-	hypothetical protein	NA	NA	NA	NA
WP_002322258.1\|879750_880011_-	hypothetical protein	NA	NA	NA	NA
WP_002289415.1\|880147_880561_-	Hsp20/alpha crystallin family protein	A0A1B2LRT2	Wolbachia_phage	2.1e-07	31.5
WP_002303864.1\|881016_881502_-	hypothetical protein	NA	NA	NA	NA
WP_002289418.1\|881640_881856_-	DUF378 domain-containing protein	NA	NA	NA	NA
WP_002289420.1\|882079_882880_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.6e-09	26.2
WP_002353507.1\|882898_884767_+	HTH domain-containing protein	NA	NA	NA	NA
WP_002289422.1\|884759_885251_+	DeoR family transcriptional regulator	NA	NA	NA	NA
WP_002289423.1\|885238_885793_+	PTS sorbitol transporter subunit IIC	NA	NA	NA	NA
WP_002289425.1\|885810_886806_+	PTS glucitol/sorbitol transporter subunit IIB	NA	NA	NA	NA
WP_002287107.1\|886947_888198_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002296624.1\|888606_889005_+	PTS glucitol/sorbitol transporter subunit IIA	NA	NA	NA	NA
WP_002311093.1\|888988_889684_+	fructose-6-phosphate aldolase	E3SKN5	Synechococcus_phage	1.0e-22	31.5
WP_002296627.1\|890267_891155_-	rotamase	NA	NA	NA	NA
WP_002296628.1\|891339_892179_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
898911:898929	attR	NA	NA	NA	NA

DBSCAN-SWA_7

1246344 : 1255405

Synechococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288010.1\|1246344_1246923_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-26	37.4
WP_002321731.1\|1246919_1247963_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	2.7e-62	43.7
WP_002288013.1\|1247994_1249434_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.3e-53	33.1
WP_002288015.1\|1249418_1251641_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.9e-150	41.3
WP_002288017.1\|1251641_1252313_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_002295474.1\|1252314_1252569_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_002288021.1\|1252568_1253297_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	4.6e-45	41.4
WP_002297115.1\|1253552_1253930_+	hypothetical protein	NA	NA	NA	NA
WP_002288023.1\|1254109_1255405_-	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	4.5e-19	33.1

DBSCAN-SWA_8

1493897 : 1531552

Streptococcus_phage(27.27%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287598.1\|1493897_1496132_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	5.1e-127	39.1
WP_002290825.1\|1496279_1496600_+	DUF1827 family protein	NA	NA	NA	NA
WP_002302440.1\|1496713_1498015_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
WP_002287661.1\|1498305_1498530_-	hypothetical protein	NA	NA	NA	NA
WP_002295394.1\|1498727_1500308_-	peptide chain release factor 3	A0A1B0RXH7	Streptococcus_phage	5.1e-33	28.4
WP_002295395.1\|1500708_1502085_-	HlyC/CorC family transporter	NA	NA	NA	NA
WP_002290821.1\|1502212_1503331_-	AI-2E family transporter	NA	NA	NA	NA
WP_002290819.1\|1503472_1503907_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002290817.1\|1503984_1504518_-	DUF402 domain-containing protein	NA	NA	NA	NA
WP_002296955.1\|1504611_1505790_-	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_002295398.1\|1505782_1506580_-	recombination regulator RecX	NA	NA	NA	NA
WP_002295399.1\|1506686_1508069_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	3.5e-86	37.4
WP_002292856.1\|1508242_1508821_-	chitin-binding protein	A0A0K1Y848	Apis_mellifera_filamentous_virus	9.7e-14	34.4
WP_002296956.1\|1509142_1509613_+	tryptophan-rich sensory protein	NA	NA	NA	NA
WP_002295400.1\|1509720_1510947_-	LytR family transcriptional regulator	NA	NA	NA	NA
WP_002297218.1\|1511769_1513065_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002292860.1\|1513222_1513423_-	cold-shock protein	Q9AZD3	Lactococcus_phage	7.6e-19	67.7
WP_002295401.1\|1513556_1514165_-	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	7.7e-70	60.1
WP_002292862.1\|1514249_1514720_-	GtrA family protein	NA	NA	NA	NA
WP_002317368.1\|1514767_1515682_-	cation transporter	A0A1V0SED0	Indivirus	2.1e-10	31.5
WP_002289147.1\|1515827_1516631_+	DUF1189 domain-containing protein	NA	NA	NA	NA
WP_002289148.1\|1516808_1517756_+	2-hydroxyacid dehydrogenase	NA	NA	NA	NA
WP_002302440.1\|1517839_1519141_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
WP_002303172.1\|1519324_1519618_-	iron-sulfur cluster biosynthesis protein	NA	NA	NA	NA
WP_002289151.1\|1519645_1520311_-	TrkA family potassium uptake protein	NA	NA	NA	NA
WP_002289153.1\|1520450_1521083_-	response regulator transcription factor	NA	NA	NA	NA
WP_002289154.1\|1521089_1522157_-	sensor histidine kinase	NA	NA	NA	NA
WP_002292871.1\|1522153_1522885_-	cell wall-active antibiotics response protein	NA	NA	NA	NA
WP_002289156.1\|1523053_1523533_-	transcription elongation factor GreA	NA	NA	NA	NA
WP_002289159.1\|1523668_1524844_-	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_002289161.1\|1525047_1526217_+	serine hydrolase	A0A2R4AS58	Mycobacterium_phage	1.6e-10	26.3
WP_002303174.1\|1526483_1528106_-	hypothetical protein	NA	NA	NA	NA
WP_000997695.1\|1528347_1529526_+\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002286097.1\|1530598_1531552_-\|transposase	IS30 family transposase	NA	NA	NA	NA

DBSCAN-SWA_9

1592406 : 1668453

Enterococcus_phage(31.25%)

portal,transposase,protease,terminase,tRNA,head,tail,holin,integrase,capsid

attL 1628479:1628514|attR 1667802:1667837

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286621.1\|1592406_1595205_-\|tRNA	isoleucine--tRNA ligase	A0A2H4UVG0	Bodo_saltans_virus	1.6e-74	26.4
WP_002286622.1\|1595466_1596174_-	DivIVA domain-containing protein	NA	NA	NA	NA
WP_073120016.1\|1596194_1596977_-	RNA-binding protein	NA	NA	NA	NA
WP_073120020.1\|1597025_1597313_-	YggT family protein	NA	NA	NA	NA
WP_002286627.1\|1597327_1597927_-	cell division protein SepF	NA	NA	NA	NA
WP_002286628.1\|1597940_1598618_-	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_002286629.1\|1598634_1599876_-	cell division protein FtsZ	NA	NA	NA	NA
WP_002286631.1\|1599898_1601224_-	cell division protein FtsA	NA	NA	NA	NA
WP_073120023.1\|1601379_1602600_-	FtsQ-type POTRA domain-containing protein	NA	NA	NA	NA
WP_002286637.1\|1602614_1603703_-	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_002286638.1\|1603728_1605090_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_002286639.1\|1605103_1606066_-	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
WP_002303009.1\|1606091_1608284_-	penicillin-binding protein	NA	NA	NA	NA
WP_002294542.1\|1608284_1608686_-	cell division protein FtsL	NA	NA	NA	NA
WP_002286642.1\|1608690_1609650_-	16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH	NA	NA	NA	NA
WP_002286645.1\|1609670_1610102_-	division/cell wall cluster transcriptional repressor MraZ	NA	NA	NA	NA
WP_002286647.1\|1610271_1610640_-	DUF3397 domain-containing protein	NA	NA	NA	NA
WP_002286649.1\|1610810_1611767_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_002291876.1\|1611839_1611956_+	DUF4044 domain-containing protein	NA	NA	NA	NA
WP_002286651.1\|1612010_1613693_-	DNA repair protein RecN	NA	NA	NA	NA
WP_002286653.1\|1613710_1614160_-	arginine repressor	NA	NA	NA	NA
WP_002286655.1\|1614266_1615085_-	TlyA family RNA methyltransferase	NA	NA	NA	NA
WP_002286656.1\|1615093_1615984_-	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_002286657.1\|1615985_1616210_-	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_002286658.1\|1616214_1617552_-	exodeoxyribonuclease VII large subunit	L7RDW5	Acanthamoeba_polyphaga_moumouvirus	6.7e-26	29.5
WP_002286660.1\|1617552_1618407_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	6.8e-40	38.7
WP_002286662.1\|1618503_1618953_-	transcription antitermination factor NusB	NA	NA	NA	NA
WP_002286664.1\|1618945_1619371_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_002286665.1\|1619616_1620681_-	aminopeptidase P family protein	NA	NA	NA	NA
WP_002286666.1\|1620852_1621098_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_002286668.1\|1621236_1621611_-	DUF956 family protein	NA	NA	NA	NA
WP_002286670.1\|1621693_1622608_-	PTS mannose/fructose/sorbose transporter family subunit IID	NA	NA	NA	NA
WP_002294546.1\|1622628_1623432_-	PTS mannose/fructose/sorbose transporter subunit IIC	NA	NA	NA	NA
WP_002289456.1\|1623464_1624454_-	PTS mannose transporter subunit IIAB	NA	NA	NA	NA
WP_002289455.1\|1624556_1625048_-	PTS fructose transporter subunit IIB	NA	NA	NA	NA
WP_002289453.1\|1625238_1628073_-	sigma-54-dependent transcriptional regulator	NA	NA	NA	NA
1628479:1628514	attL	NA	NA	NA	NA
WP_002305361.1\|1628691_1629486_+	DUF4428 domain-containing protein	A0A0F6N4L7	Staphylococcus_phage	4.3e-12	32.9
WP_002305364.1\|1629581_1629884_+	hypothetical protein	NA	NA	NA	NA
WP_002286473.1\|1629919_1630291_-	hypothetical protein	NA	NA	NA	NA
WP_002296902.1\|1630292_1630694_-	hypothetical protein	NA	NA	NA	NA
WP_002286474.1\|1630707_1631115_-	hypothetical protein	NA	NA	NA	NA
WP_087046766.1\|1632037_1633200_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
WP_002286484.1\|1634139_1635165_-	N-acetylmuramoyl-L-alanine amidase	A0A139ZVY1	Enterococcus_phage	2.1e-64	61.3
WP_002286683.1\|1635161_1635386_-\|holin	holin	NA	NA	NA	NA
WP_002286686.1\|1635382_1635676_-	hypothetical protein	NA	NA	NA	NA
WP_002296594.1\|1635713_1635851_-	XkdX family protein	NA	NA	NA	NA
WP_002286491.1\|1635852_1636299_-	hypothetical protein	NA	NA	NA	NA
WP_002305370.1\|1636461_1638552_-	hypothetical protein	A0A249XZH9	Enterococcus_phage	9.6e-88	49.6
WP_002305372.1\|1638575_1640867_-	hypothetical protein	A0A1D3SNL1	Enterococcus_phage	1.7e-90	30.2
WP_002305373.1\|1640876_1641614_-\|tail	phage tail protein	NA	NA	NA	NA
WP_002305374.1\|1641664_1645084_-\|tail	phage tail tape measure protein	A0A1D3SNL5	Enterococcus_phage	8.7e-78	41.5
WP_002305377.1\|1645100_1645283_-	hypothetical protein	NA	NA	NA	NA
WP_002286510.1\|1645285_1645648_-	hypothetical protein	NA	NA	NA	NA
WP_002305379.1\|1645667_1646273_-	hypothetical protein	Q8W5Z9	Listeria_phage	1.1e-33	41.6
WP_002297404.1\|1646681_1647932_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002286516.1\|1648067_1648472_-	hypothetical protein	R4IBU7	Listeria_phage	6.1e-07	29.5
WP_002296598.1\|1648464_1648866_-	hypothetical protein	A0A1B1P759	Bacillus_phage	1.1e-13	33.3
WP_002286522.1\|1648855_1649209_-\|head	phage head closure protein	NA	NA	NA	NA
WP_002286523.1\|1649198_1649510_-	hypothetical protein	A0A1B1P751	Bacillus_phage	6.3e-12	42.1
WP_002286524.1\|1649506_1650382_-	hypothetical protein	D2IYX3	Enterococcus_phage	5.6e-130	74.2
WP_002286525.1\|1650391_1651552_-\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	1.8e-99	50.1
WP_002286527.1\|1651551_1652238_-\|protease	Clp protease ClpP	A0A2I6PDD0	Staphylococcus_phage	1.0e-30	39.7
WP_002286530.1\|1652200_1653379_-\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	5.4e-80	40.4
WP_002286533.1\|1653398_1655093_-\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	3.0e-148	49.6
WP_002286538.1\|1655070_1655385_-\|terminase	terminase	A0A1S7FYW6	Listeria_phage	3.3e-08	37.9
WP_002296599.1\|1655487_1655769_-	hypothetical protein	NA	NA	NA	NA
WP_002305386.1\|1655773_1656118_-	HNH endonuclease	A0A1B1P757	Bacillus_phage	1.0e-26	58.1
WP_002305387.1\|1656377_1657025_-	hypothetical protein	NA	NA	NA	NA
WP_020944850.1\|1657246_1657426_+	YegP family protein	NA	NA	NA	NA
WP_002305389.1\|1657418_1657760_-	hypothetical protein	NA	NA	NA	NA
WP_002349267.1\|1657783_1658020_-	hypothetical protein	NA	NA	NA	NA
WP_002305391.1\|1658294_1658762_-	ArpU family transcriptional regulator	D7RWH7	Brochothrix_phage	2.4e-07	28.5
WP_002296604.1\|1658946_1659192_-	hypothetical protein	NA	NA	NA	NA
WP_002286550.1\|1659151_1659508_-	DUF1140 family protein	A0A2H4JAZ4	uncultured_Caudovirales_phage	3.1e-10	37.4
WP_002305393.1\|1659507_1659813_-	hypothetical protein	NA	NA	NA	NA
WP_002290675.1\|1659809_1659971_-	hypothetical protein	NA	NA	NA	NA
WP_002305394.1\|1659985_1660345_-	DUF1064 domain-containing protein	A0A1P8BKR1	Lactococcus_phage	3.1e-18	48.3
WP_002305396.1\|1660341_1661193_-	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	6.2e-25	28.7
WP_002305397.1\|1661209_1662040_-	replication protein	C9E2N2	Enterococcus_phage	1.5e-52	43.9
WP_002305398.1\|1662042_1662729_-	hypothetical protein	C9E2N1	Enterococcus_phage	2.6e-90	71.4
WP_002305399.1\|1662734_1662974_-	hypothetical protein	NA	NA	NA	NA
WP_002305400.1\|1663299_1663488_-	hypothetical protein	D2IZW5	Enterococcus_phage	7.4e-08	60.3
WP_002349273.1\|1663508_1663793_-	hypothetical protein	NA	NA	NA	NA
WP_002305401.1\|1663794_1663989_-	helix-turn-helix transcriptional regulator	D2IZW2	Enterococcus_phage	1.2e-08	50.9
WP_002305403.1\|1663985_1664762_-	hypothetical protein	B2ZYU5	Staphylococcus_phage	2.8e-72	54.8
WP_002349274.1\|1664888_1665110_-	hypothetical protein	NA	NA	NA	NA
WP_002305405.1\|1665410_1665755_+	helix-turn-helix transcriptional regulator	A0A126GGL0	Streptococcus_phage	1.2e-24	52.6
WP_002321996.1\|1665790_1666186_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_002305409.1\|1666238_1666550_+	hypothetical protein	NA	NA	NA	NA
WP_002301539.1\|1666561_1667710_+\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	3.0e-67	40.1
WP_002289452.1\|1667802_1668096_-	50S ribosomal protein L27	NA	NA	NA	NA
1667802:1667837	attR	NA	NA	NA	NA
WP_002289451.1\|1668108_1668453_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA

DBSCAN-SWA_10

1687538 : 1696010

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288083.1\|1687538_1689728_+	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.8e-286	66.6
WP_002288081.1\|1690042_1690645_+	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	1.7e-53	58.6
WP_002294035.1\|1690698_1691820_-	DNA polymerase IV	NA	NA	NA	NA
WP_002288078.1\|1691928_1692801_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.1e-88	60.4
WP_002288076.1\|1692869_1693217_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	5.1e-18	41.1
WP_002288073.1\|1693209_1694034_-	stage 0 sporulation family protein	NA	NA	NA	NA
WP_002288071.1\|1694069_1695008_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.3e-35	34.4
WP_002292340.1\|1695021_1695351_-	hypothetical protein	NA	NA	NA	NA
WP_002294039.1\|1695365_1696010_-	dTMP kinase	M1PSC7	Streptococcus_phage	4.2e-58	52.6

DBSCAN-SWA_11

2027513 : 2092337

Streptococcus_phage(18.18%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002346541.1\|2027513_2028833_+\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	6.3e-210	82.7
WP_154080572.1\|2029020_2029164_-	hypothetical protein	NA	NA	NA	NA
WP_025477414.1\|2029670_2031371_+	hypothetical protein	NA	NA	NA	NA
WP_002297417.1\|2031473_2032307_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_002286368.1\|2032610_2034776_-	PTS glucose transporter subunit IIABC	A0A2I7SAJ6	Vibrio_phage	1.9e-06	32.7
WP_002317159.1\|2035035_2037330_+	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_002286375.1\|2037322_2037988_+	beta-phosphoglucomutase	M1H9H9	Acanthocystis_turfacea_Chlorella_virus	2.7e-12	27.9
WP_002294627.1\|2037980_2038988_+	galactose mutarotase	NA	NA	NA	NA
WP_002294628.1\|2039009_2040029_+	LacI family transcriptional regulator	NA	NA	NA	NA
WP_002286385.1\|2040309_2041677_-	Na+/H+ antiporter NhaC	NA	NA	NA	NA
WP_002286392.1\|2041785_2043207_-	amino acid permease	NA	NA	NA	NA
WP_002286400.1\|2043449_2045327_-	tyrosine decarboxylase	NA	NA	NA	NA
WP_002297419.1\|2045617_2046874_-\|tRNA	tyrosine--tRNA ligase	A0A1L2CUL7	Pectobacterium_phage	3.1e-81	42.7
WP_080490136.1\|2047453_2048755_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_002317158.1\|2048823_2049423_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002328397.1\|2049848_2050802_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002317156.1\|2051637_2053248_+	tetronasin resistance protein	NA	NA	NA	NA
WP_002289290.1\|2053324_2053984_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_002289292.1\|2054266_2054932_-	hypothetical protein	NA	NA	NA	NA
WP_002317155.1\|2055078_2055684_-	dihydroxyacetone kinase subunit L	NA	NA	NA	NA
WP_002317154.1\|2055711_2056695_-	dihydroxyacetone kinase subunit DhaK	NA	NA	NA	NA
WP_002304157.1\|2056696_2057092_-	PTS-dependent dihydroxyacetone kinase phosphotransferase subunit DhaM	NA	NA	NA	NA
WP_002292575.1\|2057244_2057565_+	putative heavy metal-binding protein	NA	NA	NA	NA
WP_002319540.1\|2057676_2058546_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_002317152.1\|2058641_2059946_-	glycosyltransferase	NA	NA	NA	NA
WP_002317151.1\|2060104_2060452_-	hypothetical protein	NA	NA	NA	NA
WP_002317148.1\|2062843_2064499_-	CoA-disulfide reductase	NA	NA	NA	NA
WP_002294651.1\|2064500_2064815_-	rhodanese-like domain-containing protein	E4WM79	Ostreococcus_tauri_virus	3.4e-05	39.1
WP_002294653.1\|2064984_2065245_+	metal-sensitive transcriptional regulator	NA	NA	NA	NA
WP_002321527.1\|2065258_2065573_+	sulfur reduction protein DsrE	NA	NA	NA	NA
WP_002294657.1\|2066180_2066735_-	CDP-alcohol phosphatidyltransferase family protein	NA	NA	NA	NA
WP_002317147.1\|2066860_2068789_-	mannonate oxidoreductase	F2Y0V3	Organic_Lake_phycodnavirus	1.0e-19	27.0
WP_002292560.1\|2069094_2069811_-	aquaporin family protein	M1HVL5	Acanthocystis_turfacea_Chlorella_virus	1.6e-29	36.9
WP_002317146.1\|2069811_2071635_-	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_002294668.1\|2071648_2073145_-	glycerol kinase GlpK	NA	NA	NA	NA
WP_002296783.1\|2073280_2074741_-	transcriptional regulator	NA	NA	NA	NA
WP_002324354.1\|2074730_2076026_-	SidA/IucD/PvdA family monooxygenase	NA	NA	NA	NA
WP_002317143.1\|2076368_2077046_-	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
WP_002324353.1\|2077075_2078167_-	NADH-dependent flavin oxidoreductase	NA	NA	NA	NA
WP_002294674.1\|2078267_2078702_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002317141.1\|2078849_2080487_-	alpha-glucosidase	NA	NA	NA	NA
WP_002307889.1\|2080813_2082127_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	5.7e-46	32.1
WP_152138210.1\|2082422_2083895_-	hypothetical protein	NA	NA	NA	NA
WP_002297185.1\|2084039_2085335_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002296840.1\|2085456_2086644_+\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002317139.1\|2087112_2087337_-	hypothetical protein	NA	NA	NA	NA
WP_002317138.1\|2087356_2087725_-	glyoxalase	NA	NA	NA	NA
WP_070600817.1\|2087925_2088636_-	hypothetical protein	NA	NA	NA	NA
WP_002349822.1\|2088653_2089151_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002292540.1\|2089187_2089640_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_073120058.1\|2089832_2090786_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002346541.1\|2091017_2092337_-\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	6.3e-210	82.7

DBSCAN-SWA_12

2108093 : 2157142

Anoxybacillus_phage(33.33%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002325907.1\|2108093_2108837_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_010726130.1\|2109031_2111752_+	YfhO family protein	NA	NA	NA	NA
WP_002325911.1\|2112656_2113907_-	PTS ascorbate transporter subunit IIC	NA	NA	NA	NA
WP_024265259.1\|2114134_2115088_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002317135.1\|2115272_2115704_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002325913.1\|2115700_2117335_-	PRD domain-containing protein	NA	NA	NA	NA
WP_002317133.1\|2117556_2118192_-	DUF998 domain-containing protein	NA	NA	NA	NA
WP_002297446.1\|2118338_2119580_-	serine/threonine transporter SstT	NA	NA	NA	NA
WP_002317131.1\|2119777_2120815_+	hypothetical protein	NA	NA	NA	NA
WP_069972672.1\|2121956_2122910_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_010726126.1\|2122992_2123154_-	hypothetical protein	NA	NA	NA	NA
WP_002312639.1\|2123472_2124342_-	ROK family protein	NA	NA	NA	NA
WP_002317128.1\|2124361_2125483_-	DUF2961 domain-containing protein	NA	NA	NA	NA
WP_002312636.1\|2125484_2125880_-	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_002349742.1\|2125898_2126705_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002312633.1\|2126697_2127486_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002312631.1\|2127499_2127976_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002323457.1\|2128047_2130705_-	AAA family ATPase	NA	NA	NA	NA
WP_002317125.1\|2130723_2131128_-	restriction endonuclease subunit M	A0A2H4PQP4	Staphylococcus_phage	4.7e-15	41.4
WP_002313258.1\|2131360_2131618_-	GTP pyrophosphokinase	NA	NA	NA	NA
WP_024265257.1\|2131653_2132607_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002286103.1\|2132855_2133944_-	hypothetical protein	NA	NA	NA	NA
WP_002317124.1\|2134186_2135824_-	resolvase	A0A2P1JU08	Anoxybacillus_phage	3.1e-41	28.1
WP_002317123.1\|2135827_2137201_-	recombinase family protein	A0A2P1JU08	Anoxybacillus_phage	1.6e-14	22.8
WP_024265256.1\|2137216_2137456_-	hypothetical protein	NA	NA	NA	NA
WP_002317121.1\|2137634_2139281_-	DUF927 domain-containing protein	NA	NA	NA	NA
WP_002317120.1\|2139428_2140478_-	hypothetical protein	NA	NA	NA	NA
WP_024265255.1\|2141097_2141988_-	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_002304106.1\|2142062_2142359_-	peptidase	NA	NA	NA	NA
WP_002317118.1\|2142351_2142645_-	hypothetical protein	NA	NA	NA	NA
WP_000202380.1\|2142848_2144168_+\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	4.8e-210	82.7
WP_002296259.1\|2144474_2145026_-	DUF1643 domain-containing protein	NA	NA	NA	NA
WP_002317116.1\|2145199_2145499_-	hypothetical protein	NA	NA	NA	NA
WP_002317115.1\|2145525_2145834_-	DUF960 domain-containing protein	NA	NA	NA	NA
WP_002317441.1\|2147604_2148924_-\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	6.9e-209	82.5
WP_002317114.1\|2149101_2150274_-	MFS transporter	NA	NA	NA	NA
WP_002317113.1\|2150276_2152526_-	alpha-galactosidase	NA	NA	NA	NA
WP_002317112.1\|2152622_2153477_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_010778368.1\|2153563_2154472_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002317111.1\|2154639_2155770_-	hypothetical protein	NA	NA	NA	NA
WP_113787899.1\|2155980_2157142_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.6e-79	50.9

DBSCAN-SWA_13

2365721 : 2375414

Streptococcus_phage(77.78%)

integrase

attL 2362677:2362692|attR 2374294:2374309

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2362677:2362692	attL	NA	NA	NA	NA
WP_002298578.1\|2365721_2367287_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	3.5e-18	30.6
WP_000237797.1\|2367354_2368548_-\|integrase	site-specific integrase	A0A0S2MV79	Bacillus_phage	8.3e-44	34.2
WP_000633907.1\|2368574_2368775_-	DUF3173 domain-containing protein	NA	NA	NA	NA
WP_000845143.1\|2369272_2369503_-	helix-turn-helix domain-containing protein	A0A1S5SEX1	Streptococcus_phage	1.0e-27	78.9
WP_000675479.1\|2369499_2369982_-	sigma-70 family RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	8.5e-48	68.6
WP_010924747.1\|2370110_2370221_-	hypothetical protein	NA	NA	NA	NA
WP_001227350.1\|2370452_2370806_+	helix-turn-helix transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	2.2e-53	89.7
WP_001803271.1\|2370863_2371031_-	conjugal transfer protein	D0R0F6	Streptococcus_phage	2.3e-13	62.0
WP_073120086.1\|2371149_2373069_-	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	94.8
WP_011058339.1\|2373084_2373171_-	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_012972536.1\|2373445_2374384_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	1.1e-83	56.6
2374294:2374309	attR	NA	NA	NA	NA
WP_000768373.1\|2374391_2375414_-	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	2.4e-132	75.5

DBSCAN-SWA_14

2382549 : 2391877

Streptococcus_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000723887.1\|2382549_2382945_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	5.9e-47	72.6
WP_000248477.1\|2383016_2383655_-	hypothetical protein	NA	NA	NA	NA
WP_000425404.1\|2383710_2384211_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.7e-54	63.0
WP_000675717.1\|2384271_2385051_-	abortive infection family protein	NA	NA	NA	NA
WP_001009054.1\|2385092_2385314_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	3.1e-29	93.2
WP_000055376.1\|2385310_2385601_-	hypothetical protein	NA	NA	NA	NA
WP_000426689.1\|2385597_2386782_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	6.3e-161	68.1
WP_001130244.1\|2386963_2388367_-	DUF87 domain-containing protein	A0A1S5SFB5	Streptococcus_phage	2.2e-176	66.5
WP_000185761.1\|2388388_2389162_-	hypothetical protein	NA	NA	NA	NA
WP_001234191.1\|2389171_2389549_-	YdcP family protein	A0A1S5SF96	Streptococcus_phage	9.6e-47	76.4
WP_000421279.1\|2389569_2389884_-	YdcP family protein	A0A1S5SF38	Streptococcus_phage	1.2e-42	77.7
WP_000181735.1\|2390083_2391877_-	ATP-dependent helicase	E3T5J8	Cafeteria_roenbergensis_virus	6.9e-26	23.8

DBSCAN-SWA_15

2459594 : 2530705

Bacillus_phage(20.0%)

integrase,protease,transposase

attL 2476345:2476361|attR 2523836:2523852

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289035.1\|2459594_2462087_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A0A8J958	Klebsiella_phage	9.0e-125	38.3
WP_002289033.1\|2462307_2463231_+	U32 family peptidase	NA	NA	NA	NA
WP_021415055.1\|2463248_2464490_+	U32 family peptidase	Q6DW11	Phage_TP	1.2e-42	32.9
WP_002289031.1\|2464623_2465970_+	glutathione-disulfide reductase	NA	NA	NA	NA
WP_002304806.1\|2466904_2467858_-	1,4-dihydroxy-2-naphthoate polyprenyltransferase	NA	NA	NA	NA
WP_002294811.1\|2467870_2468974_-	FAD:protein FMN transferase	NA	NA	NA	NA
WP_002289025.1\|2469063_2469999_-	FMN-binding protein	NA	NA	NA	NA
WP_002289023.1\|2470300_2472235_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_002294810.1\|2472691_2473108_+	NusG domain II-containing protein	NA	NA	NA	NA
WP_002304808.1\|2473121_2473688_+	Gx transporter family protein	NA	NA	NA	NA
WP_002289380.1\|2473710_2474697_+	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_002289382.1\|2474851_2476834_-	collagen-binding MSCRAMM adhesin Scm	NA	NA	NA	NA
2476345:2476361	attL	NA	NA	NA	NA
WP_002289384.1\|2477120_2477645_+	DUF664 domain-containing protein	NA	NA	NA	NA
WP_002297289.1\|2477961_2478930_-	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
WP_002289388.1\|2479086_2479893_-	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.3e-08	25.1
WP_002289390.1\|2479889_2480795_-	ABC transporter permease	NA	NA	NA	NA
WP_002289394.1\|2480812_2481781_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002320801.1\|2482499_2486126_+	DNA-directed RNA polymerase subunit beta	A0A1B1ISA9	uncultured_Mediterranean_phage	1.5e-48	24.7
WP_002295965.1\|2486204_2489858_+	DNA-directed RNA polymerase subunit beta'	R4TQM7	Phaeocystis_globosa_virus	8.4e-63	24.9
WP_002288139.1\|2490452_2491478_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_002288137.1\|2491752_2493438_+	sucrose phosphorylase	NA	NA	NA	NA
WP_002288135.1\|2493451_2494735_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002288134.1\|2494804_2495674_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_002288133.1\|2495670_2496507_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002340552.1\|2496532_2497600_+	zinc-binding alcohol dehydrogenase	NA	NA	NA	NA
WP_002288129.1\|2497596_2498424_+	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_002288127.1\|2498468_2499494_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_002288124.1\|2499490_2501674_+	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_002288122.1\|2501673_2502804_+	glycerate kinase	W6LM47	Streptococcus_phage	1.6e-73	51.6
WP_002288121.1\|2502800_2503478_+	beta-phosphoglucomutase	A0A1D8KNV9	Synechococcus_phage	1.6e-07	23.2
WP_002288119.1\|2503561_2504089_+	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_002288144.1\|2504289_2504976_-	prepilin peptidase	NA	NA	NA	NA
WP_002288118.1\|2505055_2506594_+	gluconokinase	NA	NA	NA	NA
WP_002297290.1\|2506713_2507181_+	DNA starvation/stationary phase protection protein	NA	NA	NA	NA
WP_002295975.1\|2507699_2508143_+	50S ribosomal protein L13	NA	NA	NA	NA
WP_002287505.1\|2508158_2508551_+	30S ribosomal protein S9	NA	NA	NA	NA
WP_002297291.1\|2508639_2509866_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_002320809.1\|2509937_2510096_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002297292.1\|2510783_2511524_+	metal ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	5.7e-19	33.2
WP_002297293.1\|2511615_2512803_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	4.6e-26	28.7
WP_002297294.1\|2513124_2513967_+	metal ABC transporter permease	NA	NA	NA	NA
WP_002297295.1\|2513963_2514914_+	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002297302.1\|2514928_2515162_+	iron-dependent repressor	NA	NA	NA	NA
WP_071858995.1\|2515492_2516077_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002297304.1\|2516207_2516876_+	cobalt transporter	NA	NA	NA	NA
WP_002311663.1\|2516877_2518302_+	energy-coupling factor ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	5.9e-20	26.4
WP_002297308.1\|2518319_2518889_+	MptD family putative ECF transporter S component	NA	NA	NA	NA
WP_002297309.1\|2518998_2520753_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.3e-24	24.8
WP_002297310.1\|2520736_2522479_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.4e-30	29.1
WP_002296840.1\|2522787_2523975_-\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
2523836:2523852	attR	NA	NA	NA	NA
WP_002297316.1\|2524475_2524745_+	30S ribosomal protein S14	NA	NA	NA	NA
WP_002297318.1\|2524759_2524939_+	50S ribosomal protein L32	NA	NA	NA	NA
WP_002297319.1\|2524970_2525348_+	hypothetical protein	NA	NA	NA	NA
WP_002297320.1\|2525368_2525518_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_073120091.1\|2525541_2526525_+	GTP-binding protein	NA	NA	NA	NA
WP_002322279.1\|2526554_2526677_+	hypothetical protein	NA	NA	NA	NA
WP_002297324.1\|2526694_2528218_+	zinc ABC transporter substrate-binding protein AdcA	NA	NA	NA	NA
WP_002304820.1\|2528241_2528481_+	hypothetical protein	NA	NA	NA	NA
WP_000122610.1\|2528655_2529948_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.2e-57	38.9
WP_106913778.1\|2530180_2530705_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	8.8e-14	36.1

DBSCAN-SWA_16

2556060 : 2575668

Streptococcus_phage(86.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297345.1\|2556060_2556972_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	2.2e-65	44.0
WP_002297346.1\|2556990_2557995_-	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	5.6e-118	63.5
WP_002297347.1\|2557991_2560115_-	hypothetical protein	A0A1S5SF30	Streptococcus_phage	1.2e-181	59.7
WP_002297348.1\|2560119_2562567_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	76.0
WP_002297349.1\|2562553_2562943_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	3.9e-43	68.3
WP_002297350.1\|2563002_2563506_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	9.2e-53	59.9
WP_033658092.1\|2563518_2563743_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	1.2e-23	83.8
WP_002286940.1\|2563846_2565757_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.1e-37	29.8
WP_002317225.1\|2566502_2566640_-	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_002297353.1\|2566636_2567821_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.9e-142	61.6
WP_002297354.1\|2568079_2568370_-	hypothetical protein	NA	NA	NA	NA
WP_073120106.1\|2568359_2569502_-	DNA (cytosine-5-)-methyltransferase	A0A1S5SEK0	Streptococcus_phage	7.5e-127	61.5
WP_002297358.1\|2569734_2570409_-	AAA family ATPase	NA	NA	NA	NA
WP_002297360.1\|2570486_2570726_-	hypothetical protein	A0A1S5SFB5	Streptococcus_phage	2.1e-23	80.3
WP_002297361.1\|2570819_2572679_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.8e-30	26.0
WP_002343904.1\|2573393_2574539_-	DUF87 domain-containing protein	A0A1S5SFB5	Streptococcus_phage	6.0e-132	62.8
WP_002311649.1\|2574621_2574966_-	hypothetical protein	NA	NA	NA	NA
WP_002297365.1\|2574966_2575341_-	YdcP family protein	A0A1S5SF96	Streptococcus_phage	2.4e-34	66.1
WP_002297366.1\|2575353_2575668_-	YdcP family protein	A0A1S5SF38	Streptococcus_phage	1.0e-25	53.4

DBSCAN-SWA_17

2862545 : 2913390

Bacillus_virus(18.18%)

bacteriocin,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296623.1\|2862545_2863841_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_002289850.1\|2863930_2864608_-	DsbA family protein	NA	NA	NA	NA
WP_002289849.1\|2864725_2865301_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_002289848.1\|2865431_2866136_+	GTP pyrophosphokinase family protein	NA	NA	NA	NA
WP_002289847.1\|2866113_2866911_+	NAD kinase	NA	NA	NA	NA
WP_002294562.1\|2866912_2867812_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_002294561.1\|2867829_2869191_+	magnesium transporter	NA	NA	NA	NA
WP_002294560.1\|2869252_2869894_-	copper homeostasis protein CutC	NA	NA	NA	NA
WP_002294559.1\|2870002_2870869_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_002304784.1\|2871086_2871593_+\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
WP_002289593.1\|2871641_2872301_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_002289594.1\|2872320_2874909_+	ATP-dependent RecD-like DNA helicase	A0A218KCE8	Bacillus_phage	8.6e-62	29.2
WP_002289596.1\|2875011_2875239_+	hypothetical protein	NA	NA	NA	NA
WP_002289597.1\|2875348_2875978_-	response regulator transcription factor	NA	NA	NA	NA
WP_002289599.1\|2875974_2877054_-	GHKL domain-containing protein	NA	NA	NA	NA
WP_002324227.1\|2877170_2878103_+	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	5.9e-21	33.2
WP_002294551.1\|2878116_2879262_+	ABC transporter permease	NA	NA	NA	NA
WP_002296167.1\|2879248_2880421_+	ABC transporter permease	NA	NA	NA	NA
WP_002294549.1\|2880519_2881485_-	diacylglycerol kinase	NA	NA	NA	NA
WP_002294548.1\|2882081_2882585_+	QueT transporter family protein	E7DN70	Pneumococcus_phage	3.4e-07	34.3
WP_002294577.1\|2882640_2883285_-	CBS domain-containing protein	NA	NA	NA	NA
WP_002294578.1\|2883446_2883599_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_002294579.1\|2883622_2883793_+	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_002294580.1\|2883893_2884439_+	transcription termination/antitermination protein NusG	NA	NA	NA	NA
WP_002294581.1\|2884515_2885403_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_002294583.1\|2885575_2886595_+	L-lactate oxidase	NA	NA	NA	NA
WP_002294584.1\|2886685_2887558_-	L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha	NA	NA	NA	NA
WP_002294585.1\|2887570_2888239_-	L-serine ammonia-lyase, iron-sulfur-dependent, subunit beta	NA	NA	NA	NA
WP_002291638.1\|2888581_2889004_+	50S ribosomal protein L11	NA	NA	NA	NA
WP_002294587.1\|2889107_2889797_+	50S ribosomal protein L1	NA	NA	NA	NA
WP_002291634.1\|2890206_2890710_+	50S ribosomal protein L10	NA	NA	NA	NA
WP_002294588.1\|2890762_2891131_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_002296327.1\|2891236_2891926_+	TVP38/TMEM64 family protein	NA	NA	NA	NA
WP_002295743.1\|2893150_2894059_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002290558.1\|2894448_2895981_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	3.3e-45	28.0
WP_002287787.1\|2896214_2896916_+	glucosamine-6-phosphate deaminase	NA	NA	NA	NA
WP_002287788.1\|2897169_2897883_+	MgtC/SapB family protein	G3MA03	Bacillus_virus	6.5e-20	43.7
WP_002287791.1\|2898191_2899331_+	AI-2E family transporter	NA	NA	NA	NA
WP_002287792.1\|2899419_2900385_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	3.4e-128	70.4
WP_002287793.1\|2900434_2902594_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	3.8e-265	63.2
WP_002287795.1\|2902752_2902977_-	glutaredoxin-like protein NrdH	A0A0M7REK7	Lactobacillus_phage	1.7e-11	42.7
WP_002287797.1\|2903377_2903851_+	ferrous iron transport protein A	NA	NA	NA	NA
WP_002287799.1\|2903847_2905980_+	ferrous iron transport protein B	NA	NA	NA	NA
WP_002290587.1\|2905981_2906116_+	hypothetical protein	NA	NA	NA	NA
WP_002287801.1\|2906209_2906854_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002287805.1\|2907040_2908234_+	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-29	37.0
WP_002287807.1\|2908226_2909954_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_000195429.1\|2910392_2911565_+\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
WP_002304799.1\|2911679_2911877_+	enterocin	NA	NA	NA	NA
WP_002287810.1\|2911878_2912190_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_002321654.1\|2912293_2912440_+\|bacteriocin	EntF family bacteriocin induction factor	NA	NA	NA	NA
WP_000222572.1\|2912436_2913390_-\|transposase	IS30 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP018070

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

20674 : 69542

Streptococcus_phage(50.0%)

holin,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059355959.1\|20674_21853_+\|transposase	IS256-like element ISEf1 family transposase	A0A220NQR7	Corynebacterium_phage	3.0e-30	25.6
WP_000026576.1\|22057_22348_-	hypothetical protein	NA	NA	NA	NA
WP_002354485.1\|22719_23406_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_002347149.1\|23483_24299_+	replication initiation protein	NA	NA	NA	NA
WP_002347150.1\|24412_24781_+	hypothetical protein	NA	NA	NA	NA
WP_002303412.1\|24954_25263_+	hypothetical protein	NA	NA	NA	NA
WP_002349053.1\|25525_25846_+	hypothetical protein	NA	NA	NA	NA
WP_002303414.1\|25976_26186_+	hypothetical protein	NA	NA	NA	NA
WP_002303415.1\|26175_26448_+	hypothetical protein	NA	NA	NA	NA
WP_002347151.1\|26495_26714_+	hypothetical protein	NA	NA	NA	NA
WP_127821124.1\|26761_27448_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	5.0e-126	99.1
WP_002303114.1\|27504_27855_-	hypothetical protein	NA	NA	NA	NA
WP_002303115.1\|27847_29173_-	Y-family DNA polymerase	M1Q231	Streptococcus_phage	7.7e-99	43.4
WP_002299575.1\|29543_30128_-	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	5.9e-43	51.7
WP_002299573.1\|30338_30542_-	hypothetical protein	NA	NA	NA	NA
WP_002303116.1\|30551_30974_-	hypothetical protein	NA	NA	NA	NA
WP_001261742.1\|31211_31826_+	recombinase family protein	M9Q1K0	Clostridium_phage	3.8e-16	30.9
WP_001809248.1\|31990_32815_-	hypothetical protein	NA	NA	NA	NA
WP_000588503.1\|33452_33710_-	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
WP_000388479.1\|33702_33972_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_001120991.1\|34102_34282_-	hypothetical protein	NA	NA	NA	NA
WP_002303117.1\|34662_35370_-	hypothetical protein	NA	NA	NA	NA
WP_002300851.1\|35362_35800_-	hypothetical protein	NA	NA	NA	NA
WP_002296238.1\|35814_36066_-	hypothetical protein	NA	NA	NA	NA
WP_002347218.1\|36065_36272_-	hypothetical protein	NA	NA	NA	NA
WP_002295623.1\|36708_36969_-	hypothetical protein	A0A0S2MYI8	Enterococcus_phage	1.2e-11	51.4
WP_002316074.1\|37043_37247_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_002303313.1\|37387_37873_-	single-stranded DNA-binding protein	W6LM61	Streptococcus_phage	5.8e-44	59.3
WP_002303312.1\|37875_38775_-	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_073119917.1\|38787_39381_-	abortive infection protein	NA	NA	NA	NA
WP_002305772.1\|39621_41826_-	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	6.1e-117	50.7
WP_002347152.1\|41836_43297_-	hypothetical protein	NA	NA	NA	NA
WP_002305801.1\|43357_45730_-	hypothetical protein	B5SP25	Lactococcus_phage	3.4e-12	29.7
WP_002297404.1\|46139_47390_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002302840.1\|47525_47720_-	hypothetical protein	NA	NA	NA	NA
WP_002302842.1\|47865_48201_-	hypothetical protein	NA	NA	NA	NA
WP_033582318.1\|48221_49814_-	hypothetical protein	NA	NA	NA	NA
WP_002302844.1\|49833_50256_-	hypothetical protein	NA	NA	NA	NA
WP_002302849.1\|50297_50573_-	hypothetical protein	NA	NA	NA	NA
WP_002305788.1\|50848_51118_-	hypothetical protein	NA	NA	NA	NA
WP_033582323.1\|51161_52097_-	DUF4199 domain-containing protein	NA	NA	NA	NA
WP_002302851.1\|52507_53314_-	hypothetical protein	NA	NA	NA	NA
WP_002302852.1\|53324_53969_-	hypothetical protein	NA	NA	NA	NA
WP_002302853.1\|53984_55184_-	peptidoglycan DD-metalloendopeptidase family protein	Q6SEC2	Lactobacillus_prophage	2.5e-32	38.1
WP_002302854.1\|55183_57208_-	hypothetical protein	NA	NA	NA	NA
WP_002302855.1\|57229_57823_-	hypothetical protein	NA	NA	NA	NA
WP_002302856.1\|57823_58156_-	hypothetical protein	NA	NA	NA	NA
WP_002302857.1\|58233_58776_-	hypothetical protein	NA	NA	NA	NA
WP_002302858.1\|58836_61215_-	hypothetical protein	NA	NA	NA	NA
WP_002302859.1\|61211_63824_-	TraM recognition domain-containing protein	NA	NA	NA	NA
WP_073119920.1\|63823_65878_-	hypothetical protein	NA	NA	NA	NA
WP_002302862.1\|65946_66249_-	hypothetical protein	NA	NA	NA	NA
WP_002305782.1\|66266_66509_-	hypothetical protein	NA	NA	NA	NA
WP_002300032.1\|66505_66961_-	hypothetical protein	NA	NA	NA	NA
WP_002300033.1\|67148_67340_+	hypothetical protein	NA	NA	NA	NA
WP_002300034.1\|67484_69542_+\|protease	serine protease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP018072

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP018073

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP018071

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP018070

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection