CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP013127	Bradyrhizobium diazoefficiens strain USDA 122, complete genome	2 crisprs	RT,DEDDh,csa3,WYL,PD-DExK	0	2	10	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013127_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013127_1

2714023-2714123

Orphan

Consensus_repeat	Method
CCGCCGCAGGGACCGGTGATGTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013127_1

>merge|NZ_CP013127|1|2714023-2714123|CRISPRCasFinder
CCGCCGCAGGGACCGGTGATGTCACCGGATGATCCCCGTTATGGCCGTCCCGCCGGCGCTCCCGTCTACTCGGCTGCGCCGCCGCAGGGGCCGGTGATGTC

>NZ_CP013127|1|1|2714023-2714123|CRISPRCasFinder
CCGCCGCAGGGACCGGTGATGTC	ACCGGATGATCCCCGTTATGGCCGTCCCGCCGGCGCTCCCGTCTACTCGGCTGCG
CCGCCGCAGGGGCCGGTGATGTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013127.1\|WP_028176317.1\|2716878_2717841_-\|D-2-hydroxyacid-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|240646
NZ_CP013127.1\|WP_011089421.1\|2722819_2723092_+\|bacterioferritin	unknown	unknown	gnl\|CDD\|381078
NZ_CP013127.1\|WP_011089432.1\|2709907_2711083_+\|VWA-domain-containing-protein	unknown	unknown	gnl\|CDD\|226346
NZ_CP013127.1\|WP_074076653.1\|2712607_2713468_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236138
NZ_CP013127.1\|WP_011089425.1\|2718424_2720074_+\|energy-dependent-translational-throttle-protein-EttA	unknown	unknown	gnl\|CDD\|236992
NZ_CP013127.1\|WP_028174591.1\|2704253_2705180_+\|SMP-30/gluconolactonase/LRE-family-protein	unknown	unknown	gnl\|CDD\|369882
NZ_CP013127.1\|WP_028144467.1\|2715421_2716798_+\|group-II-intron-reverse-transcriptase/maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|275209
NZ_CP013127.1\|WP_028174593.1\|2705928_2707575_+\|choline-dehydrogenase	unknown	unknown	gnl\|CDD\|235000
NZ_CP013127.1\|WP_028176315.1\|2720081_2721308_+\|lytic-murein-transglycosylase	unknown	unknown	gnl\|CDD\|274067
NZ_CP013127.1\|WP_011089423.1\|2721391_2721673_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013127.1\|WP_011089420.1\|2723225_2723714_+\|bacterioferritin	unknown	unknown	gnl\|CDD\|153099
NZ_CP013127.1\|WP_028174594.1\|2709538_2709784_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NZ_CP013127.1\|WP_074076654.1\|2721884_2722274_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013127.1\|WP_028176313.1\|2722354_2722657_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227244
NZ_CP013127.1\|WP_028176316.1\|2717972_2718188_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013127.1\|WP_028174592.1\|2705320_2705914_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP013127.1\|WP_018641027.1\|2711214_2711628_+\|rhodanese-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|238724
NZ_CP013127.1\|WP_074076652.1\|2711603_2712605_+\|3-mercaptopyruvate-sulfurtransferase	unknown	unknown	gnl\|CDD\|225450
NZ_CP013127.1\|WP_028152332.1\|2708588_2709431_-\|MoxR-family-ATPase	unknown	unknown	gnl\|CDD\|223786
NZ_CP013127.1\|WP_097531935.1\|2707976_2708336_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP013127.1\|WP_028176317.1\|2716878_2717841_-\|D-2-hydroxyacid-dehydrogenase-family-protein	gnl\|CDD\|240646	cd12169, PGDH_like_1, Putative D-3-Phosphoglycerate Dehydrogenases. Phosphoglycerate dehydrogenases (PGDHs) catalyze the initial step in the biosynthesis of L-serine from D-3-phosphoglycerate. PGDHs come in 3 distinct structural forms, with this first group being related to 2-hydroxy acid dehydrogenases, sharing structural similarity to formate and glycerate dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily, which also include groups such as L-alanine dehydrogenase and S-adenosylhomocysteine hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. Many, not all, members of this family are dimeric.	5.91884e-169
NZ_CP013127.1\|WP_011089421.1\|2722819_2723092_+\|bacterioferritin	gnl\|CDD\|381078	cd19945, Fer2_BFD, bacterioferritin-associated ferredoxin (BFD) [2Fe-2S]-binding domain. This family includes Escherichia coli and Pseudomonas aeruginosa bacterioferritin-associated ferredoxin BFD which binds an [2Fe-2S] cluster and appears to interact with bacterioferritin (E. coli BFR/YheA and P. aeruginosa BfrB), a dynamic regulator of intracellular iron levels. It has been suggested that BFD and bacterioferritin form an electron transfer complex which may participate in the iron storage or iron immobilization functions of bacterioferritin. For Pseudomonas aeruginosa, it has been shown that mobilization of Fe3+ stored in BfrB requires interaction with BFD, which transfers electrons to reduce Fe3+ in the internal cavity of BfrB for subsequent release of Fe2+. The stability of BFD may be aided by an anion-binding site found within this domain. In addition to BFD, the BFD-like [2Fe-2S]-binding domain is found in a variety of proteins such as the large subunit of NADH-dependent nitrite reductase and the Cu+ chaperone CopZ. It comprises a helix-turn-helix fold, and binds an [2Fe-2S] cluster via 4 highly-conserved Cys residues, found in loops between the alpha-helices. For the class of proteins having a BFD-like [2Fe-2S]-binding domain, the Cys residues are organized in a unique C-X2-C-X31-35-C-X2-9-C-arrangement. [2Fe-2S] clusters are sulfide-linked diiron centers, a primary role for which is electron transport.	2.88076e-05
NZ_CP013127.1\|WP_011089432.1\|2709907_2711083_+\|VWA-domain-containing-protein	gnl\|CDD\|226346	COG3825, COG3825, Uncharacterized protein conserved in bacteria [Function unknown].	0
NZ_CP013127.1\|WP_074076653.1\|2712607_2713468_-\|hypothetical-protein	gnl\|CDD\|236138	PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated.	8.59966e-08
NZ_CP013127.1\|WP_011089425.1\|2718424_2720074_+\|energy-dependent-translational-throttle-protein-EttA	gnl\|CDD\|236992	PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed.	0
NZ_CP013127.1\|WP_028174591.1\|2704253_2705180_+\|SMP-30/gluconolactonase/LRE-family-protein	gnl\|CDD\|369882	pfam08450, SGL, SMP-30/Gluconolaconase/LRE-like region. This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species. These proteins include various enzymes, such as senescence marker protein 30 (SMP-30), gluconolactonase and luciferin-regenerating enzyme (LRE). SMP-30 is known to hydrolyze diisopropyl phosphorofluoridate in the liver, and has been noted as having sequence similarity, in the region described in this family, with PON1 and LRE.	5.45337e-62
NZ_CP013127.1\|WP_028144467.1\|2715421_2716798_+\|group-II-intron-reverse-transcriptase/maturase	gnl\|CDD\|275209	TIGR04416, hypothetical_protein, group II intron reverse transcriptase/maturase. Members of this protein family are multifunctional proteins encoded in most examples of bacterial group II introns. These group II introns are mobile selfish genetic elements, often with multiple highly identical copies per genome. Member proteins have an N-terminal reverse transcriptase (RNA-directed DNA polymerase) domain (pfam00078) followed by an RNA-binding maturase domain (pfam08388). Some members of this family may have an additional C-terminal DNA endonuclease domain that this model does not cover. A region of the group II intron ribozyme structure should be detectable nearby on the genome by Rfam model RF00029. [Mobile and extrachromosomal element functions, Other].	1.14804e-176
NZ_CP013127.1\|WP_028174593.1\|2705928_2707575_+\|choline-dehydrogenase	gnl\|CDD\|235000	PRK02106, PRK02106, choline dehydrogenase; Validated.	0
NZ_CP013127.1\|WP_028176315.1\|2720081_2721308_+\|lytic-murein-transglycosylase	gnl\|CDD\|274067	TIGR02283, Membrane-bound_lytic_murein_transglycosylase_B, lytic murein transglycosylase. Members of this family are closely related to the MltB family lytic murein transglycosylases described by TIGR02282 and are likewise all proteobacterial, although that family and this one form clearly distinct clades. Several species have one member of each family. Many members of this family (unlike the MltB family) contain an additional C-terminal domain, a putative peptidoglycan binding domain (pfam01471), not included in region described by this model. Many sequences appear to contain N-terminal lipoprotein attachment sites, as does E. coli MltB in TIGR02282. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	1.49725e-142
NZ_CP013127.1\|WP_011089420.1\|2723225_2723714_+\|bacterioferritin	gnl\|CDD\|153099	cd00907, Bacterioferritin, Bacterioferritin, ferritin-like diiron-binding domain. Bacterioferritins, also known as cytochrome b1, are members of a broad superfamily of ferritin-like diiron-carboxylate proteins. Similar to ferritin in architecture, Bfr forms an oligomer of 24 subunits that assembles to form a hollow sphere with 432 symmetry. Up to 12 heme cofactor groups (iron protoporphyrin IX or coproporphyrin III) are bound between dimer pairs. The role of the heme is unknown, although it may be involved in mediating iron-core reduction and iron release. Each subunit is composed of a four-helix bundle which carries a diiron ferroxidase center; it is here that initial oxidation of ferrous iron by molecular oxygen occurs, facilitating the detoxification of iron, protection against dioxygen and radical products, and storage of ferric-hydroxyphosphate at the core. Some bacterioferritins are composed of two subunit types, one conferring heme-binding ability (alpha) and the other (beta) bestowing ferroxidase activity.	1.63988e-75
NZ_CP013127.1\|WP_028174594.1\|2709538_2709784_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	9.16863e-10
NZ_CP013127.1\|WP_028176313.1\|2722354_2722657_+\|hypothetical-protein	gnl\|CDD\|227244	COG4907, COG4907, Predicted membrane protein [Function unknown].	0.00023871
NZ_CP013127.1\|WP_028174592.1\|2705320_2705914_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	6.60111e-22
NZ_CP013127.1\|WP_074076652.1\|2711603_2712605_+\|3-mercaptopyruvate-sulfurtransferase	gnl\|CDD\|225450	COG2897, SseA, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism].	4.40872e-107
NZ_CP013127.1\|WP_028152332.1\|2708588_2709431_-\|MoxR-family-ATPase	gnl\|CDD\|223786	COG0714, COG0714, MoxR-like ATPases [General function prediction only].	2.8811e-46
NZ_CP013127.1\|WP_018641027.1\|2711214_2711628_+\|rhodanese-like-domain-containing-protein	gnl\|CDD\|238724	cd01447, Polysulfide_ST, Polysulfide-sulfurtransferase - Rhodanese Homology Domain. This domain is believed to serve as a polysulfide binding and transferase domain in anaerobic gram-negative bacteria, functioning in oxidative phosphorylation with polysulfide-sulfur as a terminal electron acceptor. The active site contains the same conserved cysteine that is the catalytic residue in other Rhodanese Homology Domain proteins.	3.04149e-55

>NZ_CP013127.1|WP_074076653.1|2712607_2713468_-|hypothetical-protein
MANAATSTVTAFRWLIGPGHLAAGAEIRNPSMLPGFRFLLAAILLSTSILVFGLGAAALLRASHEQYVSNPSWRNGPQEQMFAQASEPAQPVLAALRAEPEPAEPTAPSLRDQVPTIALPVSEPEQVAAVTSEADAEPQVATPSAEAPAAEPAKTETTTEATAPAPTDTLTPADTTASIPEAPPVPTAGAPAPADPSLALESSALDAASARMAALNDPATTAWKDPPAKAKADSSAPDSKATKPRAKAKKRHRVVRRPPPQQLQQSLDPFGQPQQTFATTTTRARQ
>NZ_CP013127.1|WP_074076652.1|2711603_2712605_+|3-mercaptopyruvate-sulfurtransferase
MGAEEEGLDLSLRHSGARVARTRNPFIHHLCRAIDSGLALRAPRNDKERPMTPDPLVSTEWLAAHINDANLKVLDASFKLPGVLPLPKDDYLAAHLPGAVFFDVDAVSDHSNPLPHMYPSAEQFGRDVGNLGIGNADTVVIYDAGGWVAAPRAWWMFLAFGHGNVRILNGGLKKWRAEGRPVESGEVKPKPATFKASYDSKRVRSMQQLIANVESNKEQVIDARAADRFEGRAPEPRAGIRSGHIPGARNVPYNLLFDAATGTMKPLDDLRAAFTGAGVKLDAPIVTSCGSGVSAGVLTLALYRLGITDTALYDGSWSEWGQAGGPPVATGPA
>NZ_CP013127.1|WP_018641027.1|2711214_2711628_+|rhodanese-like-domain-containing-protein
MPQTITRGIKALIDEANAEIETLTAKDAIEISKNGDVVIVDIRDPREIERDGRIPGAFACTRGMLEFWIDPQSPYAKPIFQEDKKFVFHCAGGLRSALAAKTAQDMGLKPVAHIAGGYAAWRDAGGPTEQWEPKKKG
>NZ_CP013127.1|WP_011089432.1|2709907_2711083_+|VWA-domain-containing-protein
MFLQFFTSLRDAQVPVTLREYLTLMEALDADLADYTVENFYYLSRASLVKDERNLDKFDRVFGTVFKGLESLLEAMDKAEIPEEWLKKLAEKYLTEEEKKQIEAMGWDKLMETLKKRLEEQKGRHQGGSKWIGTAGTSPFGAHGYNPEGVRIGQEKNRNNRAVKVWDKREFKDLDGNVELGIRNIKVALRRLRKFARTGAPDELDLDTTIRETANHGYLDVHMRPERRNAVKLLVFFDIGGSMDSHIEQVEELFSAAKSEFKHMEYFYFHNCLYEGVWKQNKRRFTDRTPTWDVLHKYPHDYKVVFVGDASMSPYEIMVPGGSVEHVNEEPGSVWLDRIIRTYPHTVWLNPVAQKHWDYSESTTIIKRIFTNRMFPITIEGLEGAMKELTH
>NZ_CP013127.1|WP_028174594.1|2709538_2709784_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MGILAALIIGAIAGWLAGKIVHGAGFGLIGNIVVGIIGALVAGWVLPQLHIQLASGTVGAIVDATIGAVIVLVILSLIKRV
>NZ_CP013127.1|WP_028152332.1|2708588_2709431_-|MoxR-family-ATPase
MKFTGTKDYVATDDLKVAVNASIVLERPLLIKGEPGTGKTVLAEEVAKALNAPLLTWHIKSTTKAQQGLYEYDAVSRLRDSQLGDARVSDIRNYIKRGKLWEAFTAEQRPVLLIDEIDKADIEFPNDLLLELDRMEFHVYETGETIKAKQRPIMMITSNNEKELPDAFLRRCFFHYIKFPDADTMGRIVDVHFPGIKKRLVEEALRIFFEVREVPGLKKKPSTSELLDWLKLLLNEDMSVEQLRERDPRKLIPPLHGALLKNEQDVHLFERLAFLSRREV
>NZ_CP013127.1|WP_097531935.1|2707976_2708336_-|hypothetical-protein
MTEQGARASFSTSQLNRRHAFAASRRISPELCSLHHTVQERGRREGRVPAGTHGPPCEGTRRKTAQRHTGEAQHTAFPAQWSDGLCRALPGAEFVLASLVLAEFTDTAPVDATAASARA
>NZ_CP013127.1|WP_028174593.1|2705928_2707575_+|choline-dehydrogenase
MDRFDYVIVGAGSAGCVLANRLSEDPNVSVCVLEAGPSDWHPYIHLPAGFIKTFHMKSINWAYQQEPGPYTGGRSIYAPRGKTLGGSSSINGHIYNRGQRMDFDTWAQMGNRGWGYADVLPYFKRLEKRVGEGEDTYRGRDGNLIVTTMDWRDPLCEAFMEGAVSLGIPRNPDYNGAKQEGVSYCQRTINNGLRVSGSTAFLKPAMKRPNVHVHTHAHATGIIFEGKRAVGVRYTKGGRGGTPVEVRANKEVILSGGTYNSPQLLQLSGVGSPDLLGAHGIAVRHALPVGEGLQDHYAPRTVARVKDIKTINELRRGFSLWIEALKWATARRGLLSLSPTMVYCFWHSGESAESSDLQLTFTPASYKEGVQGQLEDEPGMTVASWQQRPESRGYVRIRSADPFAPPIIQTNYLDAELDRRVIVGGMKLARRLLKSAPLSPYYAYEDFPGPNINTDDEFLAAATERGTTTFHPGCTCRMGPADSTWAVVDDQLRVHGLEGLRVIDASVMPRMISANLNASTMMIADRASDLIRGKVPMEAARIPDAAVA
>NZ_CP013127.1|WP_028174592.1|2705320_2705914_+|GNAT-family-N-acetyltransferase
MPWPDPITLRGQHARLEPLSHQHIEGLTEAVKDGELSKLWYTAIPLPENMGKEIDRRLALQAAGSMLPFTVFDAGGNIVGMTTYMNIDATNRRVEIGSTWYGKSAQRGPLNTQCKLLLLRHAFETLNCIAVEFRTHFFNHQSRRAIERLGAKQDGILRSHQVAPNGTLRDTVVYSITAAEWPTVQAHLEFQLNDKPR
>NZ_CP013127.1|WP_028174591.1|2704253_2705180_+|SMP-30/gluconolactonase/LRE-family-protein
MSDVRVLATDLEFPEGPVVMPDGSVVLVEIRGQRLTRVHPDGRKEIVAKVPGGPNGAALGPDGKIYICNNGGFSWIPTGQMIMPGPQPDNYLGGSIQRVDLQSGKVETVVTKCGEHELRGPNDLVFDRHGGLWFSDLGKRRAREMDVGGMYYLKPGMKEVVEVVHGVLPANGIGLSPDENTVYIAETPTARLWAYELSAPGTLRPREVIYRGERGKPICGLGGYQMFDSLAVEANGNVCVATLVSGCISVIAPDGTLVEQVPTGDRVTTNIAFGGPGLKTAYITLSGKGELIAMDWPRGGLPLNFLNK
>NZ_CP013127.1|WP_028144467.1|2715421_2716798_+|group-II-intron-reverse-transcriptase/maturase
MRQKNQVELNLSPGAEGEARSAGAREPEARAAEVCLERPAVAGPSMEDVVESENLKAALAQVKRNKGAAGVDGMTVGELSAHLKEHWPAIRAQLLDGTYKPQPVRRVEIPKASGGLRPLGIPTVLDRLIQQAVMQVLQADWDRTFAETSFGFRPGRSAHRAVERAQAYIAAGHSIVVDIDLEKFFDRVNHDILMGLVAKRVADKRILKLIRAFLNAGVLEGGLVSPTEEGTPQGGPLSPLLSNLMLDVLDKELEKRGHRFVRYADDCNIYVRSQRAGERVLAGVERFLEKRLKLKINKAKSAVAKPSVRKFLGFSFTGGQEPRRRIAPQALARFKAKVRELTRRTRGRCLVQIAKELSTYLIGWHGYFGFCQTPSVLRVLDQWIRRRLRAVAWKQWKYGPARFAELRRRGVGRDLAAQTAGSPRGPWRLANSPALTIALPNGFFASLGLASVAARRPA
>NZ_CP013127.1|WP_028176317.1|2716878_2717841_-|D-2-hydroxyacid-dehydrogenase-family-protein
MTRLRCAILDDYFNIALDVADWPKLSDRIDVTVFSHPFTSEQAAASALADFEIVCAMRERTAFPKSLFDGLPKLKLLLTSGMRNASIDMEAAKAKGVAIGGTQYSRDPTAPLTMGLILELTRGIGRENARMHAGEPWQTFAGVEIEGLTLGIVGLGKLGSKMAGIAKAFGMNVIAWSPNLTPEKCKAAGVGYATKEELFAKADIVTIHVVLSERSRGLVGAADLARMKPTAFLVNTARGPIVDEQALLEALQQRKIAGAGLDVFSVEPLPVDHPFRKLDNLVLTPHLGYATEDGLRIHYGQMVEAIDAWTRGGELPRKLA
>NZ_CP013127.1|WP_028176316.1|2717972_2718188_-|hypothetical-protein
MALTETNSFPVPAEAGSTSALVAEIKGFWKGFFATAFNPYRPELHYMRGPGPAWRAKHGMDAPVRLKPRDP
>NZ_CP013127.1|WP_011089425.1|2718424_2720074_+|energy-dependent-translational-throttle-protein-EttA
MARQFIYFMQGLTKSYPTRKVLDNIHLSFYPDAKIGVLGVNGSGKSTLLKIMAGLDKEYNGEAWVAQGARVGYLEQEPQLDAKLSVRENVMLGVAKQKAILDRYNELAMNYSEETADEMTKLQDEIEAQGLWDLDSKVDQAMDALRCPPDDADVTKLSGGERRRVALCRLLLDQPELLLLDEPTNHLDAESVSWLEGHLRNYPGAILIVTHDRYFLDNVTSWILELDRGKGIPYEGNYSSWLVQKQKRLEQEGREDAAHQKTIAREQEWVASSPKARQAKSKARYQRYEELLKQASEKQTQTAQIIIPVAERLGANVVDFEGLSKGYGDRLLIDDLTFKLPPGGIVGVIGANGAGKTTLFKMITKQETPDKGTITVGETVHLGYVDQSRDALDGNKNVWEEISGGNELILLGKKEVNSRGYCSSFNFKGADQQKKVGALSGGERNRVHLAKMLKSGANVLLLDEPTNDLDVDTLRALEEALEDFAGCAVIISHDRWFLDRIATHILAFEGDSHVEWFEGNFQDYEKDKMRRLGQDSIIPHRVKYKKLTR
>NZ_CP013127.1|WP_028176315.1|2720081_2721308_+|lytic-murein-transglycosylase
MMRRALIAAVIVVTCGWSSARAADAAFTQFIASLWPEAQAAGVSRATFEQETRGLEPDYKLPDLILPGRPATGAPSQAEFVQVPADYVRDASIARLAGEGQRLLQKYRPALTEIEKSSGVPATVMLAIWGRETDYGRYTLPYDLVRVLATQAYVGRRKDTYRNEFILSLKILGEGMVTRKDMRSSWAGATGLTQFLPSEYYKHGVDFDRDGRIDIWHSVPDALASAAQQLVNKGWQSGVRWAYEVQAPAKVDCTTGVPEVTKPISQWLREGFVPVRGQKLSAAEQAQPASLLQPEGIYGPSFLTTKNYFVIKEYNFSDLYVLFVGHLSDRMTSPLPFATPWSASKQLRTRDVETMQRGLTRVGLYKDKIDGKAGMQTRAALGAYQKSAGLKVDCWPSEEVLRSIEAAR
>NZ_CP013127.1|WP_011089423.1|2721391_2721673_-|hypothetical-protein
MKKTLVAALTVATVAGSLVTAAPSAKAHDGVGAGIAAGLIGGAIVGGAIASSRPAYGGPVYVAEPPPPAPCYWQRQRYWDGYGWVIRPVRVCY
>NZ_CP013127.1|WP_074076654.1|2721884_2722274_-|hypothetical-protein
MELYPPKSSRVFVRKVKPMKKSLLAVAALTAVALTAGTPAHAQRGVAAGVAAGIIGGAIVGGALASPYYYGPGPGYAYGPGYGPGYYPPRYYAPGPGYVADDYYGGCVWQRQRFWDGYGWRVRRVRVCG
>NZ_CP013127.1|WP_028176313.1|2722354_2722657_+|hypothetical-protein
MMGNAMINALIAAGIVFAIGYGWITHLQNRGQRRSRAGAGSDGGGDSYSGTSDGFSLGSWFSSDSSGNSTDTGSCSSSDSGSSGGDCGGGGDGGGGGGGD
>NZ_CP013127.1|WP_011089421.1|2722819_2723092_+|bacterioferritin
MIVCSCNVLSDDDIRAAVAESDDAVRHAKQVYGCLGCSAECGRCARTIKTIIDEALGPCAKSCCSGCPHSHTVAANDETAESAQFALAAC
>NZ_CP013127.1|WP_011089420.1|2723225_2723714_+|bacterioferritin
MQGDAKVIDYLNKALRHELTAINQYWLHYRFLDNWGLLDMAKVWRKESIEEMEHADKLTARILFFDGFPNMQVLDPLRIGQNVKEIIECDLAAEMSARALYQEAATYCHGVKDYVTRDLFEKLMSDEEHHIDFLETQLDLIGRIGLELYTQKHVGGLEGEGH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013127_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013127_2

3984449-3984583

Orphan

Consensus_repeat	Method
ATGGCGGCTGGGGCCATGGCGGC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP013127_2

>merge|NZ_CP013127|2|3984449-3984583|CRISPRCasFinder
ATGGCGGCGCTGACCGTCGCGGCGGTCGGGCTCTCGGCGCCGCAGGCGGCCCAGGCGGGCGGCGGTTTTGGACATGGCGGCTGGGGCCATGGCGGCGGCTGGGGCCACGGTGGTGGCGGCTGGGGCCATGGCGGT

>NZ_CP013127|2|2|3984449-3984583|CRISPRCasFinder
ATGGCGGCGCTGACCGTCGCGGC	GGTCGGGCTCTCGGCGCCGCAGGCGGCCCAGGCGG
GCGGCGGTTTTGGACATGGCGGC	TGGGGCCATGGCGGCGGCTGGGGCCACGGTG
GTGGCGGCTGGGGCCATGGCGGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013127.1\|WP_074076814.1\|3977503_3978379_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|184875
NZ_CP013127.1\|WP_011088322.1\|3988290_3989604_-\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|270306
NZ_CP013127.1\|WP_028175410.1\|3976451_3977588_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013127.1\|WP_074076815.1\|3992052_3993567_+\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|238624
NZ_CP013127.1\|WP_011088320.1\|3990879_3991587_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP013127.1\|WP_028175407.1\|3980010_3980835_+\|serine-O-acetyltransferase	unknown	unknown	gnl\|CDD\|182987
NZ_CP013127.1\|WP_011088329.1\|3983288_3983819_+\|gamma-carbonic-anhydrase-family-protein	unknown	unknown	gnl\|CDD\|100051
NZ_CP013127.1\|WP_039184817.1\|3983982_3984213_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013127.1\|WP_028175406.1\|3981942_3982650_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013127.1\|WP_028175402.1\|3987326_3988286_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224097
NZ_CP013127.1\|WP_011088330.1\|3982872_3983202_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013127.1\|WP_007602543.1\|3975887_3976133_-\|zinc-finger-domain-containing-protein	unknown	unknown	gnl\|CDD\|226826
NZ_CP013127.1\|WP_028175400.1\|3989622_3990609_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226361
NZ_CP013127.1\|WP_028175404.1\|3985018_3985513_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377333
NZ_CP013127.1\|WP_028175403.1\|3985691_3986423_-\|Asp/Glu/hydantoin-racemase	unknown	unknown	gnl\|CDD\|226611
NZ_CP013127.1\|WP_074077685.1\|3978364_3979684_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013127.1\|WP_007602550.1\|3980960_3981179_+\|DUF3126-family-protein	unknown	unknown	gnl\|CDD\|371468
NZ_CP013127.1\|WP_011088324.1\|3986444_3987323_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224098
NZ_CP013127.1\|WP_011088319.1\|3991604_3991829_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013127.1\|WP_039183842.1\|3993813_3995157_+\|IS1380-like-element-ISBdi2-family-transposase	unknown	unknown	gnl\|CDD\|379340

Protein	Function_ID	Function_description	E-value
NZ_CP013127.1\|WP_074076814.1\|3977503_3978379_+\|alpha/beta-hydrolase	gnl\|CDD\|184875	PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional.	7.19921e-24
NZ_CP013127.1\|WP_028175400.1\|3989622_3990609_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	4.87852e-136
NZ_CP013127.1\|WP_007602550.1\|3980960_3981179_+\|DUF3126-family-protein	gnl\|CDD\|371468	pfam11324, DUF3126, Protein of unknown function (DUF3126). This family of proteins with unknown function appear to be restricted to Alphaproteobacteria.	7.99579e-31
NZ_CP013127.1\|WP_074076815.1\|3992052_3993567_+\|amidohydrolase-family-protein	gnl\|CDD\|238624	cd01299, Met_dep_hydrolase_A, Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a conserved metal binding site, involving four histidines and one aspartic acid residue. In the common reaction mechanism, the metal ion (or ions) deprotonate a water molecule for a nucleophilic attack on the substrate. The function of this subgroup is unknown.	1.35142e-124
NZ_CP013127.1\|WP_011088322.1\|3988290_3989604_-\|extracellular-solute-binding-protein	gnl\|CDD\|270306	cd13588, PBP2_polyamine_1, The periplasmic-binding component of an uncharacterized ABC transporter involved in uptake of polyamines; contains the type 2 periplasmic binding fold. This group represents the periplasmic binding domain that functions as the primary high-affinity receptor of an uncharactertized ABC-type polyamine transport system. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	9.02376e-28
NZ_CP013127.1\|WP_011088320.1\|3990879_3991587_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	1.39946e-43
NZ_CP013127.1\|WP_028175407.1\|3980010_3980835_+\|serine-O-acetyltransferase	gnl\|CDD\|182987	PRK11132, cysE, serine acetyltransferase; Provisional.	5.34714e-120
NZ_CP013127.1\|WP_011088329.1\|3983288_3983819_+\|gamma-carbonic-anhydrase-family-protein	gnl\|CDD\|100051	cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E. coli paaY protein, and similar proteins. CAs are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionary distinct groups - alpha, beta and gamma carbonic anhydrases - which show no significant sequence identity or structural similarity. Gamma CAs are trimeric enzymes with left-handed parallel beta helix (LbH) structural domain.	2.29785e-81
NZ_CP013127.1\|WP_028175402.1\|3987326_3988286_-\|ABC-transporter-permease	gnl\|CDD\|224097	COG1176, PotB, ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism].	5.58029e-68
NZ_CP013127.1\|WP_007602543.1\|3975887_3976133_-\|zinc-finger-domain-containing-protein	gnl\|CDD\|226826	COG4391, COG4391, Uncharacterized protein conserved in bacteria [Function unknown].	7.29991e-24
NZ_CP013127.1\|WP_028175404.1\|3985018_3985513_-\|hypothetical-protein	gnl\|CDD\|377333	pfam04375, HemX, HemX, putative uroporphyrinogen-III C-methyltransferase. This is a family of bacterial putative uroporphyrinogen-III C-methyltransferase proteins. It forms one of the members of a complex of proteins involved in the biogenesis of the inner membrane in E.coli. Uroporphorphyrin-III C-methyltransferase (HemX) is a single spanning inner membrane protein that regulates the activity of NAD(P)H:glutamyl-tRNA reductase (HemA) in the tetrapyrrole biosynthesis pathway.	0.00515461
NZ_CP013127.1\|WP_028175403.1\|3985691_3986423_-\|Asp/Glu/hydantoin-racemase	gnl\|CDD\|226611	COG4126, COG4126, Hydantoin racemase [Amino acid transport and metabolism].	3.68113e-73
NZ_CP013127.1\|WP_011088324.1\|3986444_3987323_-\|ABC-transporter-permease	gnl\|CDD\|224098	COG1177, PotC, ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism].	9.52492e-52
NZ_CP013127.1\|WP_039183842.1\|3993813_3995157_+\|IS1380-like-element-ISBdi2-family-transposase	gnl\|CDD\|379340	pfam13701, DDE_Tnp_1_4, Transposase DDE domain group 1. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	0

>NZ_CP013127.1|WP_039184817.1|3983982_3984213_-|hypothetical-protein
MRKLIAFDEDTFDKLKQLGRDRMATFQELADEAFADLLKKHGIPIDLRDALRKSARLGAEPDKPAARPKSGNAKSR
>NZ_CP013127.1|WP_011088329.1|3983288_3983819_+|gamma-carbonic-anhydrase-family-protein
MAIYELDGQAPDLPADGNYFIAETATVIGRVRLKPGASVWFGAVLRGDNEWIEIGEGANVQDGSTCHTDLGFPLVIGKNCTVGHNVILHGCTIEEGALIGMGSIVMNGAKIGRNSIVGAGSVITEGKEFPERSLIIGSPARVMRTLDDAQVQRMGSAAKFYVANGPRFTKGLKRIG
>NZ_CP013127.1|WP_011088330.1|3982872_3983202_+|hypothetical-protein
MTPEALNSFFSIGIGFALAGALVNGYQAVAQRPAGFGLLQDGVAPKTFAAVPFLVFAAPFIIMRNTLRGMRLESRRLEFVMMATVIAGFWSMMSGTFFLMTLRATGVLG
>NZ_CP013127.1|WP_028175406.1|3981942_3982650_-|hypothetical-protein
MTVFSAASPRSPRTRTRAHIVPIVLGGAAAVCAVALVAYLLWPTWGTSGANAPDKLPVSVGGTLFNLPTTAIRMKIQRHSGPQERIDLDFLYPSLEPPGTPKHVSADTVDASLLPIDRIFLSIAAHHDALSPEQRTATIYPRYLEPGATMPEDGLTMRMFRADTPYGSEDLYSAASPALTARCTRDAATPGMCLSERRVGGADLTFRFPRSWLSQWRDAAEAMEKLTAQLRGPKS
>NZ_CP013127.1|WP_007602550.1|3980960_3981179_+|DUF3126-family-protein
MDVKEVRKLDAYLKRVFGNPKIRVVPRPKKDDSAEVYIGEEFIGVLFVDDEDDDRSFQFQMAILEDDLVDQE
>NZ_CP013127.1|WP_028175407.1|3980010_3980835_+|serine-O-acetyltransferase
MAVHQVNPGGKLASLDPIWDRIRSEAEDIVHREPELATFIYSTVLHHSRLEDSVIHRLADRLDHSALSGDLVRQTYDEALRDDPDLGNAFRADLVAVYDRDPATSRFIDPLLYFKGFHAIQTHRLAHWLWLKGRKDFAYYLQSRASAVFQTDINPAARIGRGIFLDHATGFVCGETAVIEDDVSILHGVTLGGTGKENEDRHPKIRHGVLIGAGAKILGNIEIGHCARIAAGSVVVKPVPHNVTVAGVPAKIVGEAGCAEPSRTMDQMINAMGL
>NZ_CP013127.1|WP_074077685.1|3978364_3979684_-|hypothetical-protein
MRLAALALPLLMIAPAFWNGYPLLQWDTGGYLARWYEGYLVPSRSTVFGLYLHSGESFGFWINLAIQSLATLWLLQLSLRVLGLLQTFRFVAISLLLILSTALPWLASMLLTDIFAGLSVLSLFLLVVGAQRTSPHEKIALFVFTAFAAATHSATLGVLLGLCLAGWMARPFVGRRLPLAGLAQASMTIVAGGLMLVSANHALSGKWAWTPGGYGVAFGRMMQDGIVARYLNDHCPRESFKLCPYRNELPATADEFLWGKSVFNALGRFEGMNDEMSYIVVHSLADYPAWQAGAAMRAVGQQLLHVATGEGTSGWIPHTYGIIERYIPAQIAPMRAARQQQWDVNFDYVNWLHVPVALASMLALVGLLAHALARRRLDDLTLLAATVTLALLGNAFICAVISGPHDRYGARMVWVATFVVLMALARAFGDEEPKGSAAA
>NZ_CP013127.1|WP_074076814.1|3977503_3978379_+|alpha/beta-hydrolase
MRSQTGEAASPGAGRRRSRSGKCGRSGLESTLPLNTAEYLMPSFHNGAVEIAYLDEGEGDPIILVHGFASSKNVNWVYPTWVSELRKNGRRVIALDNRGHGESAKLYEPAQYSIPTMAGDVLALMDHLAIPQADIMGYSMGGRMTAWLSLNEPQRLRSAILGGIGIGGLIEGTGPGENVAKALEAPALDDVSDPVGRTFRAFADQTRSDRRALAACLRGTRDLMTRGEAARIDVPVLIAVGSTDDVAGSASALGAIIPGSEVLDIPGRDHMRAVGDKAYKTGVLDFLSRRG
>NZ_CP013127.1|WP_028175410.1|3976451_3977588_+|hypothetical-protein
MKWLRISTALTGIAACSFMLAQVAPHAREAGAILAARDDPAALSELKLDAVLRQNDRLVQDNIEAALAAGDADLADSFVALARDRNIAVPDDLLARVSDAVKEENSTSHFARRFATGLVTGSADDVASLSGTVVGDLFVIGDVRDVVREGKHLAMGEDTDRLVLGLAAAGLAVTAATYVSIGGAAPVRAGLTLVKDARKVGRLGEGLAAWAGRSAREVVDTPVLQNAVASGSVLRPGQTVSAIKAAFRAEKAGALVRLGKDVTRVAEKTSTRGAMDSLRIAEGPKDVARAARLAEAQGSKTRAIMKLLGRGALLLVGGAFDLALWLFGAALTLFGLLSSIKATTERLTQAWCDRRRARRLRRAQVAAEAALASAAGPA
>NZ_CP013127.1|WP_007602543.1|3975887_3976133_-|zinc-finger-domain-containing-protein
MSDHVVPHFHNDAGVPVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCSTLYRFAADLKAGEARPPECVLKDKVA
>NZ_CP013127.1|WP_028175404.1|3985018_3985513_-|hypothetical-protein
MIDLAQDTPSNPLLRLGAQPIALTAAALLLLIAGVTSIAIWRAYTGAAPEADRVVASRQLQARTAQASEQLVEKTKGLEATQQESIDQLQVVQDQLQTVKRLLAAQQADTKRLSEQVATLNESIDGLRQSFASARATEAETPSVTRRKPARHRVHASARKRSRG
>NZ_CP013127.1|WP_028175403.1|3985691_3986423_-|Asp/Glu/hydantoin-racemase
MRLHVVNPNTTASMTAKIAAAARSVALPGTEIDARQPTMGPVSIEGFYDEAFAVPGMLGCIRKADRDGADAHIIACFDDTGLDAARAVAKAPVIGIGEAGFHMASLIAARFAVVTTLGVSIVPIEHNLTKYGLAGRCARVRAAEVPVLALEERNADALAKISAEITAAIRDDRAEAVVLGCAGMADLAAELAATHGLPVVDGVAAAVTLAEALVRLGLKTSRLGPYAAPRLKTYSGPFSPFQP
>NZ_CP013127.1|WP_011088324.1|3986444_3987323_-|ABC-transporter-permease
MKEGRPRSFYVLAIFFAAYVLFLYGPMIAIYVLSFQGPQGGLTFPMNGVSTFWIAKLFQGTGIVDLGAAFRRSLLLGLIVMIVTVVLSVAAGMAFRRRFKAQSILFYSAIASLIVPSIITSLGISLEFRIIDDLIKAHWNENFETSMGLLTSGLGAHLTWTLPFGLLIMFAIFNRFDPRLEEAARDLGATPWQAFRHVVLPIILPSVIGIGLFGFTLSWDELARSSQAIGAVNTLPLDLQGLTTTVTNPDIYALGTVISAVSFTVITLALGTIHVLNKRQAAKGSDAGKGLV
>NZ_CP013127.1|WP_028175402.1|3987326_3988286_-|ABC-transporter-permease
MDTSEDILQQASPGLIPGSGTARAAKPTRLSPSFISWLQAGPMMLVFLAFFLIPLVFVVIVSFWDYNEYQLLPAFSGRGYTDTFEGCITQLPDLCTIGKTYLMTLKLCFLVWAITLFIGFWVAYFLAFHIKSKTWQMGLSLLCTIPFWTSNVIRMIAWIPLLGRNGLVNSGLVKTGLINQPLEWLLFSEFSVVLALVHLFTFFMVVPIFNSMVRIDKSLIEAAYDAGATGFQTLVNVVIPLAKPGIVIGSIFVITIVMGDFITIGVMGGQQIAAAGKIIETRVNALQFPAAAANAVILLAITFLIITMMSRIVDIKKEL
>NZ_CP013127.1|WP_011088322.1|3988290_3989604_-|extracellular-solute-binding-protein
MRNRGVTDMTETTRTKGVSRRTLLKGTAGLAGLAAGSGAITGFPYVKSADAKVLRYLGTAVNEGDDISKQCLKDTGIKIEYITATTDDVTKRVMTQPNSFDVLDTEYFSLKKLVPSGNILALDARKIKEFDNITPVFTKGQTPGGKKIGNQGTAPWKVLYLEGKDSKKFATSATEFVTLIPTVYNADTLGIRPDLIKRPISSWSELLNPEFKGKASILNIPSIGIMDAAMVVEATGKYKYADKGNMTKEEIDLTMKVMTEAKKAGQFRAFWKDFNESVNLMASGETVIQSMWSPAVTKVRSMGIPCTFQPLKEGYRSWASGFCVSKGVSGAKLEWAYEFVNWFLSGYAGAYLNRQGYYSAVLSTAKAHMEPYEWAYWMEGKPAEKDIKAPDGSLLEKAGAVRDGGSYEDRMGGVACWNAVMDENDYMVRKWNEFIAA
>NZ_CP013127.1|WP_028175400.1|3989622_3990609_-|ABC-transporter-ATP-binding-protein
MATPAALELVAVTKRYDTTLAVDDVNLKIPAGTYCCLLGPSGCGKTSTLRMIAGHEAVSEGDIILGAQNVTDLEPAKRGTAMMFQSYALFPHLTVLDNVAFALKMRGIDRATRHKRAGELLELVAMTPYAARLPAQLSGGQQQRVALARALITEPQILLLDEPLSALDPFLRVKMRGELKRLQRELGISFIQVTHGQEEAMALADHIVVMNHGKIEQQGTARDIFHHPRTEFVARFIGGHNVLSDAGKLIAVRADQLGIVPFADGAYGAPALLTQTEYQGSYIAVSLTLDDGTALFSHLPEAAFDVHPFRPGDRVLATWDPAKAQRLQ
>NZ_CP013127.1|WP_011088320.1|3990879_3991587_+|GntR-family-transcriptional-regulator
MAAKTRQKSDAPDASDRVSRIREGVTAAILEHRLLPGTKLGEDEIGEIYGASRTLVRTALQQLAHEGIVNIEKNRGAFVARPTPADAREVFEARRLIEPTIVDHACEAASPAWLERLGRHLTEEREAELRGDARASVRLSGEFHKLVAEMSGHSIYLGFLKELIARSSLIILLYRRHDTPACGTDHHAGIVAAIRKRDKQAARAQMLSHLNEIEAELFLKDPAADETRLADVLGT
>NZ_CP013127.1|WP_011088319.1|3991604_3991829_-|hypothetical-protein
MTRRNMVTQTSDGHVLLVKKLGGLFAIIIGCLLTAVGVTFESSGTTFVGVLFLVLGAGLLVLKIVRRNEGSSLP
>NZ_CP013127.1|WP_074076815.1|3992052_3993567_+|amidohydrolase-family-protein
MADLHNLLWLQIDSMRFAGINPQITSHTARLADFRSGNLRPELRSGVSAWRLDMRDLTTPAGLFRVAALLMSVGTSLCLSSQTRAQQDSAVLFRNVRIFDGKSGALSAASNVLVRNTKIEKISTANITADAQAIDGGGRVLMPGLIDAHWHAMLVRPTPAAALGDVGYNNLLAASEATATLMRGFTTVRDMGGPSFGLKRAIDEDLVAGPRIYPSGAIITITSGHGDFRQLSDLPRTIGGMLSRMEQVGGSMVADSPDEVRVRAREQLMQGASQVKLTAGGGVASPFSPLDVSTFTEPELRAAVEAADNWGTYVATHAYTPVAIQRSIAAGVRCIEHGHLMDEASAKLIAEKGIWLSTQPFLDMSMAAALGPAEQDKMRQVVTGTDRVYALAKKYGIKTAFGTDVLFSKALADRQGSMLAALTRWYTPAEALAMATSANAELLSLSGPRNPYPGKLGVVEEGALADLLLVDGNPLDNITLVEDPAKNFVVIMKGGKVYKNIVPR
>NZ_CP013127.1|WP_039183842.1|3993813_3995157_+|IS1380-like-element-ISBdi2-family-transposase
MTDDTIPPFSFPAIHAKKVTAAFDGGRLTSNGGVMLLAMAERRLGLADNLARVFPDRRDPTRVVHSLVDMFRARMFAICCGYEDADDLDHLRSDPAFKLACGRLPDTGRDLCSQPTLSRLENAPRLRDVIRLTYILVDAWMDSYPHEPASVTLDIDDTCDVVHGHQQLSLFNAHYDERCFLPIHVYDTEKSRPVAVVLRPGKTPGGVEVRAHLRRLVRHIRTRWHNTRITFRGDGHYARPEAMAWCETNGIDYIFGLSGTKPLARKVDEVADDIRTRRAIENLPVLRGYTETRHKAKSWDRERRTVARIEATMLGLDIRFVVTSLDVGSAEWIYDSLYCARGQAENLIKLHKTQLASDRTSCRSALANQVRLVLHTAAYWLMLTVRDAIPKARELATAEFATLRLRLLKLAARVVETTSRIRLAFAAACPEADLIRGLPGALLPLGP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP013127_2	2.2\|3984530\|31\|NZ_CP013127\|CRISPRCasFinder	3984530-3984560	31	NZ_CP029359	Azospirillum sp. CFH 70021 plasmid unnamed4	78661-78691	5	0.839
NZ_CP013127_2	2.2\|3984530\|31\|NZ_CP013127\|CRISPRCasFinder	3984530-3984560	31	NZ_CP011665	Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence	505686-505716	6	0.806
NZ_CP013127_2	2.2\|3984530\|31\|NZ_CP013127\|CRISPRCasFinder	3984530-3984560	31	NC_013852	Allochromatium vinosum DSM 180 plasmid pALVIN01, complete sequence	21518-21548	6	0.806
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	204183-204217	7	0.8
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	1999543-1999577	7	0.8
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	1646302-1646336	7	0.8
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	1646302-1646336	7	0.8
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	447462-447496	7	0.8
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	583611-583645	7	0.8
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	1042267-1042301	7	0.8
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	445920-445954	7	0.8
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	430264-430298	7	0.8
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	445920-445954	7	0.8
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	430264-430298	7	0.8
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	445920-445954	7	0.8
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	445924-445958	7	0.8
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	430264-430298	7	0.8
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	430264-430298	7	0.8
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	430264-430298	7	0.8
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	428775-428809	7	0.8
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	445920-445954	7	0.8
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	430266-430300	7	0.8
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP054022	Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence	893359-893393	8	0.771
NZ_CP013127_2	2.2\|3984530\|31\|NZ_CP013127\|CRISPRCasFinder	3984530-3984560	31	NZ_LN832560	Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence	41729-41759	8	0.742
NZ_CP013127_2	2.2\|3984530\|31\|NZ_CP013127\|CRISPRCasFinder	3984530-3984560	31	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1467783-1467813	8	0.742
NZ_CP013127_2	2.2\|3984530\|31\|NZ_CP013127\|CRISPRCasFinder	3984530-3984560	31	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	345285-345315	8	0.742
NZ_CP013127_2	2.2\|3984530\|31\|NZ_CP013127\|CRISPRCasFinder	3984530-3984560	31	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	98230-98260	8	0.742
NZ_CP013127_2	2.2\|3984530\|31\|NZ_CP013127\|CRISPRCasFinder	3984530-3984560	31	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	204150-204180	8	0.742
NZ_CP013127_2	2.2\|3984530\|31\|NZ_CP013127\|CRISPRCasFinder	3984530-3984560	31	NZ_CP026745	Nocardia cyriacigeorgica strain MDA3349 isolate MDA3349 ancestor plasmid p_unnamed, complete sequence	100326-100356	8	0.742
NZ_CP013127_2	2.2\|3984530\|31\|NZ_CP013127\|CRISPRCasFinder	3984530-3984560	31	NZ_CP018385	Burkholderia pseudomallei strain 2008724860 plasmid p1, complete sequence	158296-158326	8	0.742
NZ_CP013127_2	2.2\|3984530\|31\|NZ_CP013127\|CRISPRCasFinder	3984530-3984560	31	NZ_CP020446	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed6, complete sequence	7629-7659	8	0.742
NZ_CP013127_2	2.2\|3984530\|31\|NZ_CP013127\|CRISPRCasFinder	3984530-3984560	31	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	44479-44509	8	0.742
NZ_CP013127_2	2.2\|3984530\|31\|NZ_CP013127\|CRISPRCasFinder	3984530-3984560	31	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	66372-66402	8	0.742
NZ_CP013127_2	2.2\|3984530\|31\|NZ_CP013127\|CRISPRCasFinder	3984530-3984560	31	NC_006362	Nocardia farcinica IFM 10152 plasmid pNF1, complete sequence	163705-163735	8	0.742
NZ_CP013127_2	2.2\|3984530\|31\|NZ_CP013127\|CRISPRCasFinder	3984530-3984560	31	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	75883-75913	8	0.742
NZ_CP013127_2	2.2\|3984530\|31\|NZ_CP013127\|CRISPRCasFinder	3984530-3984560	31	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	56326-56356	8	0.742
NZ_CP013127_2	2.2\|3984530\|31\|NZ_CP013127\|CRISPRCasFinder	3984530-3984560	31	NZ_CP024428	Paracoccus yeei strain TT13 plasmid pTT13-6, complete sequence	3678-3708	8	0.742
NZ_CP013127_2	2.2\|3984530\|31\|NZ_CP013127\|CRISPRCasFinder	3984530-3984560	31	CP048299	Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL_SAL-A00527 plasmid pN1566-2, complete sequence	33633-33663	8	0.742
NZ_CP013127_2	2.2\|3984530\|31\|NZ_CP013127\|CRISPRCasFinder	3984530-3984560	31	CP048303	Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL-SAL-A00375 plasmid p28945-2, complete sequence	171999-172029	8	0.742
NZ_CP013127_2	2.2\|3984530\|31\|NZ_CP013127\|CRISPRCasFinder	3984530-3984560	31	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	194143-194173	8	0.742
NZ_CP013127_2	2.2\|3984530\|31\|NZ_CP013127\|CRISPRCasFinder	3984530-3984560	31	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	153463-153493	8	0.742
NZ_CP013127_2	2.2\|3984530\|31\|NZ_CP013127\|CRISPRCasFinder	3984530-3984560	31	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	105981-106011	8	0.742
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP031752	Rhodobacter sphaeroides strain EBL0706 plasmid p.A, complete sequence	60772-60806	9	0.743
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP050104	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence	1019599-1019633	9	0.743
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP025507	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence	826331-826365	9	0.743
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP050109	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence	1019598-1019632	9	0.743
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP022666	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence	247304-247338	9	0.743
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP050086	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence	1058410-1058444	9	0.743
NZ_CP013127_2	2.1\|3984472\|35\|NZ_CP013127\|CRISPRCasFinder	3984472-3984506	35	NZ_CP029362	Streptomyces globisporus strain TFH56 plasmid pTFSG1, complete sequence	48266-48300	10	0.714

1. spacer 2.2|3984530|31|NZ_CP013127|CRISPRCasFinder matches to NZ_CP029359 (Azospirillum sp. CFH 70021 plasmid unnamed4) position: , mismatch: 5, identity: 0.839

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gtcggccacggcggcggccggggccacggtg	Protospacer
   *****.*********.************

2. spacer 2.2|3984530|31|NZ_CP013127|CRISPRCasFinder matches to NZ_CP011665 (Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence) position: , mismatch: 6, identity: 0.806

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gggctgcacggcggcggctggggccaaggtg	Protospacer
 **   **.***************** ****

3. spacer 2.2|3984530|31|NZ_CP013127|CRISPRCasFinder matches to NC_013852 (Allochromatium vinosum DSM 180 plasmid pALVIN01, complete sequence) position: , mismatch: 6, identity: 0.806

tggggccatggcggcggctggggccacggtg-	CRISPR spacer
cgtgggcatgtcggcggctggggcca-gatgc	Protospacer
.* ** **** *************** *.**

4. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

5. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

6. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

7. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

8. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

9. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

10. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

11. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

12. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

13. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

14. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

15. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

16. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

17. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

18. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

19. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

20. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

21. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

22. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

23. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP054022 (Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence) position: , mismatch: 8, identity: 0.771

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
gaccgcgacatcggcgacccaggcggcccaggcgg	Protospacer
*..** * . ****** * ****************

24. spacer 2.2|3984530|31|NZ_CP013127|CRISPRCasFinder matches to NZ_LN832560 (Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
cagggccatggcggcgggtgcggccagccag	Protospacer
..*************** ** *****    *

25. spacer 2.2|3984530|31|NZ_CP013127|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
ccaggccatggcggcggccggggtcaccgcc	Protospacer
. .***************.****.*** *.

26. spacer 2.2|3984530|31|NZ_CP013127|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
ccaggccatggcggcggccggggtcaccgcc	Protospacer
. .***************.****.*** *.

27. spacer 2.2|3984530|31|NZ_CP013127|CRISPRCasFinder matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gcaggccatggcggcgtctggcgccaggatc	Protospacer
  .************* **** **** *.*

28. spacer 2.2|3984530|31|NZ_CP013127|CRISPRCasFinder matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gcaggccatggcggcgtctggcgccaggatc	Protospacer
  .************* **** **** *.*

29. spacer 2.2|3984530|31|NZ_CP013127|CRISPRCasFinder matches to NZ_CP026745 (Nocardia cyriacigeorgica strain MDA3349 isolate MDA3349 ancestor plasmid p_unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gtccgcgctggctgcggctggggcgacggtg	Protospacer
    **  **** *********** ******

30. spacer 2.2|3984530|31|NZ_CP013127|CRISPRCasFinder matches to NZ_CP018385 (Burkholderia pseudomallei strain 2008724860 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
caaggcgatggcggcggctgaggccagtgcg	Protospacer
...*** *************.*****  *.*

31. spacer 2.2|3984530|31|NZ_CP013127|CRISPRCasFinder matches to NZ_CP020446 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed6, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
ggcggccatggcggcggatgcggccagaaag	Protospacer
 * ************** ** ***** .. *

32. spacer 2.2|3984530|31|NZ_CP013127|CRISPRCasFinder matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gcaggccatggcggcgtctggcgccaggatc	Protospacer
  .************* **** **** *.*

33. spacer 2.2|3984530|31|NZ_CP013127|CRISPRCasFinder matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gcaggccatggcggcgtctggcgccaggatc	Protospacer
  .************* **** **** *.*

34. spacer 2.2|3984530|31|NZ_CP013127|CRISPRCasFinder matches to NC_006362 (Nocardia farcinica IFM 10152 plasmid pNF1, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gtccgcgctggctgcggctggggcgacggtg	Protospacer
    **  **** *********** ******

35. spacer 2.2|3984530|31|NZ_CP013127|CRISPRCasFinder matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gcaggccatggcggcgtctggcgccaggatc	Protospacer
  .************* **** **** *.*

36. spacer 2.2|3984530|31|NZ_CP013127|CRISPRCasFinder matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gcaggccatggcggcgtctggcgccaggatc	Protospacer
  .************* **** **** *.*

37. spacer 2.2|3984530|31|NZ_CP013127|CRISPRCasFinder matches to NZ_CP024428 (Paracoccus yeei strain TT13 plasmid pTT13-6, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
ggcggccatggcggcggatgcggccagaaag	Protospacer
 * ************** ** ***** .. *

38. spacer 2.2|3984530|31|NZ_CP013127|CRISPRCasFinder matches to CP048299 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL_SAL-A00527 plasmid pN1566-2, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gcaggccatggcggcgtctggcgccaggatc	Protospacer
  .************* **** **** *.*

39. spacer 2.2|3984530|31|NZ_CP013127|CRISPRCasFinder matches to CP048303 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL-SAL-A00375 plasmid p28945-2, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gcaggccatggcggcgtctggcgccaggatc	Protospacer
  .************* **** **** *.*

40. spacer 2.2|3984530|31|NZ_CP013127|CRISPRCasFinder matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gccgagcagggcggcggcaggggccacggag	Protospacer
   *. ** ********* ********** *

41. spacer 2.2|3984530|31|NZ_CP013127|CRISPRCasFinder matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gcaggccatggcggcgtctggcgccaggatc	Protospacer
  .************* **** **** *.*

42. spacer 2.2|3984530|31|NZ_CP013127|CRISPRCasFinder matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gcaggccatggcggcgtctggcgccaggatc	Protospacer
  .************* **** **** *.*

43. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP031752 (Rhodobacter sphaeroides strain EBL0706 plasmid p.A, complete sequence) position: , mismatch: 9, identity: 0.743

---ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
tgcgatca---cctcggcgctgcaggcggccaaggcga	Protospacer
   *.**.   .********.********** *****.

44. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP050104 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence) position: , mismatch: 9, identity: 0.743

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
gacggcgacatcggcgacccaggcggcccaggcgg	Protospacer
*.. * * . ****** * ****************

45. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP025507 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence) position: , mismatch: 9, identity: 0.743

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
gacggcgacatcggcgacccaggcggcccaggcgg	Protospacer
*.. * * . ****** * ****************

46. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP050109 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence) position: , mismatch: 9, identity: 0.743

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
gacggcgacatcggcgacccaggcggcccaggcgg	Protospacer
*.. * * . ****** * ****************

47. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP022666 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence) position: , mismatch: 9, identity: 0.743

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
gacggcgacatcggcgacccaggcggcccaggcgg	Protospacer
*.. * * . ****** * ****************

48. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP050086 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence) position: , mismatch: 9, identity: 0.743

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
gacggcgacatcggcgacccaggcggcccaggcgg	Protospacer
*.. * * . ****** * ****************

49. spacer 2.1|3984472|35|NZ_CP013127|CRISPRCasFinder matches to NZ_CP029362 (Streptomyces globisporus strain TFH56 plasmid pTFSG1, complete sequence) position: , mismatch: 10, identity: 0.714

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
ctccttgacctcggcgtcggaggcggcccaggcgc	Protospacer
  .*  * .*******.** **************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1476764 : 1483854

Salmonella_phage(16.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_028173594.1\|1476764_1477229_+	ribonuclease HI	J9Q745	Salmonella_phage	8.5e-45	58.3
WP_011084135.1\|1477348_1477834_-	peroxiredoxin	M1I839	Pelagibacter_phage	6.8e-21	45.8
WP_011084136.1\|1477942_1478497_-	DUF924 domain-containing protein	A0A1V0SIY0	Klosneuvirus	1.7e-15	31.8
WP_011084137.1\|1478512_1480198_-	long-chain fatty acid--CoA ligase	Q75ZG1	Hepacivirus	6.9e-44	26.9
WP_028173593.1\|1480391_1481855_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	3.3e-26	34.2
WP_028173592.1\|1482045_1483854_-	glucan ABC transporter ATP-binding protein/ permease	W8CYL7	Bacillus_phage	3.8e-32	25.0

DBSCAN-SWA_2

1980240 : 2023948

Mycobacterium_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_074076603.1\|1980240_1981548_-\|transposase	IS256 family transposase	A0A2P1JQX9	Mycobacterium_phage	3.6e-93	45.9
WP_011084589.1\|1981565_1982717_-	molybdenum ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_011084594.1\|1983886_1984246_+	hypothetical protein	NA	NA	NA	NA
WP_011084595.1\|1984720_1985023_-	hypothetical protein	NA	NA	NA	NA
WP_011084599.1\|1987591_1988311_-	hypothetical protein	NA	NA	NA	NA
WP_011084600.1\|1988365_1989115_-	hypothetical protein	A0A1X9SH03	Bradyrhizobium_phage	4.4e-43	43.6
WP_026312712.1\|1990374_1991094_-	insulinase family protein	NA	NA	NA	NA
WP_018647480.1\|1991093_1992440_-	insulinase family protein	A0A2P1EIE5	Megavirus	1.8e-18	22.2
WP_011084605.1\|1993127_1993580_-	hypothetical protein	NA	NA	NA	NA
WP_011084606.1\|1993554_1993977_-	hypothetical protein	NA	NA	NA	NA
WP_011084607.1\|1993997_1994420_-	hypothetical protein	NA	NA	NA	NA
WP_011084608.1\|1994544_1995135_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_011084609.1\|1995165_1997265_-	EscV/YscV/HrcV family type III secretion system export apparatus protein	NA	NA	NA	NA
WP_028176036.1\|1997274_1997703_-	hypothetical protein	NA	NA	NA	NA
WP_011084611.1\|1997705_1998242_-	hypothetical protein	NA	NA	NA	NA
WP_011084612.1\|1998275_1999169_-	hypothetical protein	NA	NA	NA	NA
WP_014497948.1\|1999285_1999477_-	hypothetical protein	NA	NA	NA	NA
WP_011084613.1\|1999519_1999828_-	hypothetical protein	NA	NA	NA	NA
WP_011084614.1\|1999925_2000444_-	hypothetical protein	NA	NA	NA	NA
WP_018647482.1\|2000736_2002191_+	DUF1521 domain-containing protein	NA	NA	NA	NA
WP_011084514.1\|2002345_2003410_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_011084616.1\|2003980_2004184_-	hypothetical protein	NA	NA	NA	NA
WP_011084617.1\|2004337_2004604_+	hypothetical protein	NA	NA	NA	NA
WP_011084618.1\|2004549_2005053_-	hypothetical protein	NA	NA	NA	NA
WP_011084619.1\|2005333_2006047_-	nodulation protein NolW	NA	NA	NA	NA
WP_011084620.1\|2006196_2006709_+	nodulation protein	NA	NA	NA	NA
WP_011084621.1\|2006717_2007581_+	EscJ/YscJ/HrcJ family type III secretion inner membrane ring protein	NA	NA	NA	NA
WP_011084622.1\|2007592_2008231_+	nodulation protein	NA	NA	NA	NA
WP_011084623.1\|2008227_2008848_+	HrpE/YscL family type III secretion apparatus protein	NA	NA	NA	NA
WP_011084624.1\|2008844_2010200_+	EscN/YscN/HrcN family type III secretion system ATPase	NA	NA	NA	NA
WP_011084625.1\|2010175_2010712_+	hypothetical protein	NA	NA	NA	NA
WP_011084626.1\|2010708_2011830_+	YscQ/HrcQ family type III secretion apparatus protein	NA	NA	NA	NA
WP_011084627.1\|2011822_2012488_+	EscR/YscR/HrcR family type III secretion system export apparatus protein	NA	NA	NA	NA
WP_011084628.1\|2012490_2012766_+	translocation protein	NA	NA	NA	NA
WP_011084629.1\|2012776_2013598_+	EscT/YscT/HrcT family type III secretion system export apparatus protein	NA	NA	NA	NA
WP_011084630.1\|2013594_2014632_+	EscU/YscU/HrcU family type III secretion system export apparatus switch protein	NA	NA	NA	NA
WP_144038027.1\|2014641_2015402_-\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	1.2e-08	35.5
WP_011084635.1\|2017177_2018266_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_011084636.1\|2018651_2018873_-	hypothetical protein	NA	NA	NA	NA
WP_011084514.1\|2018973_2020038_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_011084637.1\|2021041_2021443_+	hypothetical protein	NA	NA	NA	NA
WP_011084638.1\|2022277_2022484_+	hypothetical protein	NA	NA	NA	NA
WP_041960889.1\|2022613_2023948_-\|transposase	IS5-like element ISBj2_B family transposase	K4ICS3	Acidithiobacillus_phage	2.1e-40	41.6

DBSCAN-SWA_3

2049343 : 2115905

Paenibacillus_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011084661.1\|2049343_2050354_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-126	64.8
WP_011084662.1\|2050496_2050790_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_018648291.1\|2050867_2051140_-	hypothetical protein	NA	NA	NA	NA
WP_011084664.1\|2051373_2051757_-	hypothetical protein	NA	NA	NA	NA
WP_011084665.1\|2051864_2052410_+	hypothetical protein	NA	NA	NA	NA
WP_109866565.1\|2052639_2053768_+\|transposase	IS3-like element ISRj2 family transposase	U5P429	Shigella_phage	1.1e-18	33.7
WP_156902880.1\|2053804_2053954_-	hypothetical protein	NA	NA	NA	NA
WP_011084668.1\|2054916_2055459_-	hypothetical protein	NA	NA	NA	NA
WP_011084669.1\|2056012_2056219_+	hypothetical protein	NA	NA	NA	NA
WP_018642727.1\|2056608_2058000_-	MFS transporter	NA	NA	NA	NA
WP_011084674.1\|2059825_2060173_+	hypothetical protein	NA	NA	NA	NA
WP_018648617.1\|2061267_2061843_+	hypothetical protein	NA	NA	NA	NA
WP_011084676.1\|2062619_2062865_-	hypothetical protein	NA	NA	NA	NA
WP_011084677.1\|2063382_2063670_-	hypothetical protein	NA	NA	NA	NA
WP_011084678.1\|2063999_2065808_-	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_144038027.1\|2066190_2066950_+\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	1.2e-08	35.5
WP_011084680.1\|2067689_2068106_-	SET domain-containing protein	NA	NA	NA	NA
WP_011084681.1\|2068211_2068775_+	hypothetical protein	NA	NA	NA	NA
WP_011084682.1\|2068790_2070119_-	hypothetical protein	NA	NA	NA	NA
WP_011084683.1\|2070230_2070419_+	hypothetical protein	NA	NA	NA	NA
WP_011084684.1\|2071525_2072140_+	J domain-containing protein	NA	NA	NA	NA
WP_011084685.1\|2073264_2074026_+	transcriptional regulator	NA	NA	NA	NA
WP_011084687.1\|2075420_2075855_+	hypothetical protein	NA	NA	NA	NA
WP_011084688.1\|2076319_2077774_+	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_011084689.1\|2078458_2078734_-	hypothetical protein	NA	NA	NA	NA
WP_011084690.1\|2078761_2079040_+	hypothetical protein	NA	NA	NA	NA
WP_080668297.1\|2079071_2079263_+	hypothetical protein	NA	NA	NA	NA
WP_011084693.1\|2080480_2080912_+	hypothetical protein	NA	NA	NA	NA
WP_011084694.1\|2081257_2082643_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011084695.1\|2082712_2083675_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_011084696.1\|2083687_2084548_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_018645268.1\|2084544_2085486_+	ribokinase	NA	NA	NA	NA
WP_011084698.1\|2085482_2086253_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_028175941.1\|2086245_2087073_+	HAD family hydrolase	NA	NA	NA	NA
WP_018645265.1\|2087072_2088185_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	2.3e-24	36.0
WP_011084701.1\|2088138_2089998_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_011084702.1\|2090002_2090716_-	hypothetical protein	NA	NA	NA	NA
WP_018645263.1\|2091309_2092479_+	hypothetical protein	NA	NA	NA	NA
WP_035667160.1\|2092471_2093332_+	phosphoenolpyruvate hydrolase family protein	NA	NA	NA	NA
WP_018645261.1\|2093328_2095104_+	FAD-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	2.2e-24	26.6
WP_020607990.1\|2096228_2096423_+	hypothetical protein	NA	NA	NA	NA
WP_018645260.1\|2096914_2097778_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_018645259.1\|2097774_2098995_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_080668299.1\|2098994_2100071_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_018645257.1\|2100057_2100792_+	ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	4.8e-10	25.8
WP_018645256.1\|2100784_2101480_+	ABC transporter ATP-binding protein	A0A2K9L0W2	Tupanvirus	3.5e-10	27.0
WP_020607989.1\|2101535_2102813_+	amidohydrolase family protein	NA	NA	NA	NA
WP_131233137.1\|2105035_2105236_+	cold-shock protein	A0A1W6JNX5	Morganella_phage	1.1e-09	49.1
WP_018645230.1\|2107780_2108800_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_018645229.1\|2108928_2110485_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_074077663.1\|2111807_2112137_+	hypothetical protein	NA	NA	NA	NA
WP_011084718.1\|2112143_2113619_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.0e-27	35.5
WP_018642936.1\|2113742_2115101_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_152104176.1\|2115144_2115905_-\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	4.7e-08	35.5

DBSCAN-SWA_4

2279322 : 2344214

uncultured_virus(15.38%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011084854.1\|2279322_2280219_+\|protease	YopT-type cysteine protease domain-containing protein	NA	NA	NA	NA
WP_014497791.1\|2281458_2283099_-	chaperonin GroEL	A0A219YK78	uncultured_virus	6.0e-170	58.9
WP_014497790.1\|2283183_2283498_-	co-chaperone GroES	A0A221S4G8	uncultured_virus	5.6e-24	61.7
WP_011084858.1\|2284448_2285096_+	FkbM family methyltransferase	Q58M88	Prochlorococcus_phage	5.9e-12	26.9
WP_011084859.1\|2285918_2287115_-	flavin-dependent monooxygenase	NA	NA	NA	NA
WP_011084860.1\|2288336_2288615_-	hypothetical protein	NA	NA	NA	NA
WP_011084861.1\|2288981_2289737_-	carbonic anhydrase	NA	NA	NA	NA
WP_011084862.1\|2289733_2290522_-	thermonuclease family protein	NA	NA	NA	NA
WP_039183842.1\|2290822_2292166_-\|transposase	IS1380-like element ISBdi2 family transposase	NA	NA	NA	NA
WP_018646917.1\|2293207_2294035_-	hypothetical protein	NA	NA	NA	NA
WP_131234261.1\|2294278_2294569_-	hypothetical protein	NA	NA	NA	NA
WP_011084864.1\|2295223_2297569_+	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
WP_011084865.1\|2297676_2297994_+	hypothetical protein	NA	NA	NA	NA
WP_011084866.1\|2298064_2298193_-	hypothetical protein	NA	NA	NA	NA
WP_026312600.1\|2299598_2299805_+	hypothetical protein	NA	NA	NA	NA
WP_011084868.1\|2302181_2302433_+	hypothetical protein	NA	NA	NA	NA
WP_014497780.1\|2303541_2303727_+	hypothetical protein	A0A1X9SH55	Bradyrhizobium_phage	9.2e-11	63.8
WP_039187468.1\|2303884_2305384_+\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	6.0e-15	28.1
WP_039183785.1\|2305383_2306247_+\|transposase	transposase	A0A059NT77	Lactococcus_phage	1.1e-32	36.7
WP_122975537.1\|2309439_2309622_+	hypothetical protein	NA	NA	NA	NA
WP_011084884.1\|2309618_2310092_+	hypothetical protein	NA	NA	NA	NA
WP_080668312.1\|2310762_2311350_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	6.3e-45	44.7
WP_018646909.1\|2311355_2312765_-	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	4.0e-45	33.9
WP_018646908.1\|2312903_2313221_-	Dabb family protein	NA	NA	NA	NA
WP_018646907.1\|2313357_2313993_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_018646906.1\|2314107_2315103_+	biotin synthase BioB	NA	NA	NA	NA
WP_018646905.1\|2315153_2315507_+	aspartate 1-decarboxylase	NA	NA	NA	NA
WP_018646904.1\|2315582_2316737_+	8-amino-7-oxononanoate synthase	G9E4Q1	Emiliania_huxleyi_virus	1.9e-21	28.2
WP_011084893.1\|2316733_2317369_+	ATP-dependent dethiobiotin synthetase BioD	NA	NA	NA	NA
WP_018646903.1\|2317365_2318631_+	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	4.9e-10	28.6
WP_011084895.1\|2319525_2319843_+	hypothetical protein	NA	NA	NA	NA
WP_074076610.1\|2319859_2320756_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	6.7e-46	36.9
WP_011084897.1\|2320759_2321611_+	pantoate--beta-alanine ligase	NA	NA	NA	NA
WP_011084898.1\|2321623_2321983_+	hypothetical protein	NA	NA	NA	NA
WP_080668311.1\|2322648_2323056_-	hypothetical protein	NA	NA	NA	NA
WP_014497760.1\|2323197_2323401_-	hypothetical protein	NA	NA	NA	NA
WP_018648581.1\|2323797_2324076_+	hypothetical protein	NA	NA	NA	NA
WP_080668310.1\|2325320_2325683_-	hypothetical protein	NA	NA	NA	NA
WP_011084904.1\|2336777_2337572_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_018648598.1\|2337998_2338265_+	DUF3551 domain-containing protein	NA	NA	NA	NA
WP_014497753.1\|2338299_2338572_+	hypothetical protein	NA	NA	NA	NA
WP_011084906.1\|2338540_2338771_+	hypothetical protein	NA	NA	NA	NA
WP_011084907.1\|2338712_2338943_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_039183842.1\|2339306_2340650_-\|transposase	IS1380-like element ISBdi2 family transposase	NA	NA	NA	NA
WP_018648599.1\|2340882_2341368_+	hypothetical protein	NA	NA	NA	NA
WP_011084909.1\|2341364_2341685_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_011084910.1\|2341697_2342822_+	hypothetical protein	U5N3F3	Enterobacteria_phage	2.0e-71	39.7
WP_074076611.1\|2343086_2344214_-\|transposase	IS3-like element ISRj2 family transposase	U5P429	Shigella_phage	1.9e-18	33.7

DBSCAN-SWA_5

4374586 : 4382021

uncultured_Mediterranean_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049832391.1\|4374586_4375702_-\|protease	trypsin-like serine protease	A0A1B1IT49	uncultured_Mediterranean_phage	2.9e-22	26.4
WP_011087990.1\|4375774_4376275_-	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_011087989.1\|4376359_4376821_-	Hsp20 family protein	A0A1B1IW69	uncultured_Mediterranean_phage	3.7e-24	39.4
WP_011087988.1\|4376950_4377340_+	hypothetical protein	NA	NA	NA	NA
WP_028171491.1\|4377336_4378263_-	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	4.6e-34	34.1
WP_028171492.1\|4378428_4378887_-	Hsp20 family protein	E3SM62	Prochlorococcus_phage	1.5e-17	37.1
WP_011087985.1\|4379053_4379461_-	hypothetical protein	NA	NA	NA	NA
WP_011087984.1\|4379479_4379827_-	hypothetical protein	NA	NA	NA	NA
WP_011087983.1\|4380029_4381652_-	chaperonin GroEL	A0A240F779	uncultured_virus	6.8e-174	59.2
WP_011087982.1\|4381700_4382021_-	co-chaperone GroES	A0A221S4G8	uncultured_virus	1.7e-23	56.2

DBSCAN-SWA_6

4880229 : 4890417

uncultured_Mediterranean_phage(88.89%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_028171840.1\|4880229_4881258_+	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	1.2e-22	42.0
WP_011087521.1\|4881254_4882094_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.1e-31	37.1
WP_011087520.1\|4882094_4882868_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	4.1e-44	49.7
WP_011087519.1\|4883034_4883268_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	5.4e-08	63.6
WP_011087518.1\|4883357_4883885_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_011087517.1\|4883881_4884694_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	4.2e-55	48.4
WP_028171842.1\|4884910_4886242_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.5e-97	47.9
WP_028171843.1\|4886336_4886699_+	hypothetical protein	NA	NA	NA	NA
WP_011087514.1\|4886803_4887655_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	2.7e-36	37.6
WP_011087513.1\|4887658_4888030_-	response regulator	NA	NA	NA	NA
WP_011087512.1\|4888271_4888922_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.3e-27	50.0
WP_028171845.1\|4889031_4890417_+	LysM peptidoglycan-binding domain-containing M23 family metallopeptidase	Q8SBN9	Clostridium_phage	4.8e-19	42.7

DBSCAN-SWA_7

5201348 : 5235148

Mycobacterium_phage(15.0%)

tail,portal,capsid,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_028174104.1\|5201348_5201951_+	DNA ligase	A0A1X9SH33	Bradyrhizobium_phage	3.4e-70	66.3
WP_028174105.1\|5202035_5202302_-	hypothetical protein	A0A068C9A1	Rhizobium_phage	1.9e-12	47.6
WP_049832505.1\|5202353_5202713_-	hypothetical protein	Q5GQH9	Synechococcus_phage	1.7e-08	35.6
WP_028174106.1\|5202709_5203075_-	DUF1515 domain-containing protein	NA	NA	NA	NA
WP_028174107.1\|5203134_5203425_-	hypothetical protein	NA	NA	NA	NA
WP_028174108.1\|5203421_5203838_-	hypothetical protein	NA	NA	NA	NA
WP_028174109.1\|5203847_5204201_-	hypothetical protein	NA	NA	NA	NA
WP_049832506.1\|5204389_5205163_-	amidase	Q9ZX49	Mycobacterium_phage	7.6e-30	43.4
WP_080668168.1\|5205231_5206356_+	acyltransferase	Q6QI96	Burkholderia_phage	2.9e-06	26.5
WP_028174111.1\|5206349_5208947_-\|tail	tail fiber protein	A0A076GD25	Sinorhizobium_phage	1.5e-13	46.5
WP_080668171.1\|5208982_5210368_-	hypothetical protein	NA	NA	NA	NA
WP_028174113.1\|5210441_5214197_-\|tail	tail fiber protein	M4T544	Rhodobacter_phage	5.7e-99	32.4
WP_039184482.1\|5214199_5214601_-\|tail	tail assembly protein	NA	NA	NA	NA
WP_028174115.1\|5214597_5215101_-	DUF1833 domain-containing protein	A0A1B0T6D7	Thiobacimonas_phage	3.2e-21	37.8
WP_028174116.1\|5215097_5215457_-	hypothetical protein	NA	NA	NA	NA
WP_028174117.1\|5215456_5217535_-\|tail	phage tail tape measure protein	D6PGB3	uncultured_phage	1.5e-11	32.2
WP_028174118.1\|5217531_5217825_-	hypothetical protein	A0A1X9IAV0	Xanthomonas_phage	4.9e-06	37.7
WP_028174119.1\|5217890_5218340_-	branched-chain amino acid ABC transporter	NA	NA	NA	NA
WP_028174120.1\|5218384_5219611_-	hypothetical protein	NA	NA	NA	NA
WP_028174121.1\|5219626_5220082_-	hypothetical protein	NA	NA	NA	NA
WP_028174122.1\|5220081_5220555_-	hypothetical protein	NA	NA	NA	NA
WP_028174123.1\|5220556_5220871_-	hypothetical protein	NA	NA	NA	NA
WP_028174124.1\|5220870_5221251_-	hypothetical protein	NA	NA	NA	NA
WP_028174125.1\|5221247_5221631_-	hypothetical protein	NA	NA	NA	NA
WP_028174126.1\|5221671_5221983_-	hypothetical protein	A0A0M4RBJ6	Mycobacterium_phage	2.3e-06	35.3
WP_028174127.1\|5221982_5222603_-	hypothetical protein	NA	NA	NA	NA
WP_028174128.1\|5222666_5223101_-	hypothetical protein	NA	NA	NA	NA
WP_039184473.1\|5223239_5224556_-\|capsid	phage major capsid protein	NA	NA	NA	NA
WP_028174130.1\|5224657_5225518_-	S49 family peptidase	H6WYH0	Enterobacter_phage	2.0e-23	34.7
WP_028174131.1\|5225501_5226827_-\|portal	phage portal protein	Q6UAX8	Klebsiella_phage	9.9e-46	32.5
WP_028174132.1\|5226826_5228542_-\|terminase	terminase large subunit	I3ULZ6	Rhodobacter_phage	5.4e-113	41.1
WP_028174133.1\|5228542_5228965_-	hypothetical protein	I3ULZ5	Rhodobacter_phage	1.4e-14	40.9
WP_131234214.1\|5229117_5229450_-	hypothetical protein	A0A1J0GUW4	Halomonas_phage	2.1e-21	47.0
WP_028174135.1\|5229461_5229737_-	HNH endonuclease	A8B112	Xanthomonas_virus	8.6e-13	46.9
WP_028174136.1\|5229985_5230651_-	hypothetical protein	NA	NA	NA	NA
WP_131234215.1\|5230647_5231799_-	helix-turn-helix domain-containing protein	A0A291AUK7	Sinorhizobium_phage	5.4e-24	31.4
WP_028174138.1\|5231869_5232148_-	hypothetical protein	NA	NA	NA	NA
WP_049832507.1\|5232140_5232647_-	SANT/Myb domain-containing protein	NA	NA	NA	NA
WP_028174139.1\|5232643_5232856_-	hypothetical protein	NA	NA	NA	NA
WP_028174140.1\|5232852_5234436_-	DNA methyltransferase	A0A076G9A5	Mycobacterium_phage	1.3e-39	28.0
WP_039184466.1\|5234432_5234630_-	hypothetical protein	NA	NA	NA	NA
WP_028174141.1\|5234626_5235148_-	hypothetical protein	A0A291AUJ5	Sinorhizobium_phage	3.8e-17	50.0

DBSCAN-SWA_8

6897818 : 6907408

Escherichia_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_074077141.1\|6897818_6900122_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.6e-13	39.1
WP_028172386.1\|6900190_6901882_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.1e-12	30.0
WP_028172387.1\|6902052_6903327_-	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	1.8e-73	42.0
WP_028172388.1\|6903323_6904106_-	hydroxypyruvate isomerase family protein	NA	NA	NA	NA
WP_028172389.1\|6904122_6905040_-	NAD-binding protein	A0A077SLF7	Escherichia_phage	1.4e-67	48.6
WP_028172390.1\|6905131_6905827_+	aldolase	A0A077SK32	Escherichia_phage	6.1e-47	49.3
WP_028172391.1\|6905988_6906693_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.8e-12	25.2
WP_011085709.1\|6906676_6907408_-	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	3.9e-12	28.6

DBSCAN-SWA_9

7869083 : 7904503

Escherichia_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039187468.1\|7869083_7870583_+\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	6.0e-15	28.1
WP_039183785.1\|7870582_7871446_+\|transposase	transposase	A0A059NT77	Lactococcus_phage	1.1e-32	36.7
WP_074077756.1\|7871676_7872771_+\|transposase	IS110-like element ISBj4 family transposase	NA	NA	NA	NA
WP_131234271.1\|7873121_7873355_+	hypothetical protein	NA	NA	NA	NA
WP_028176073.1\|7873519_7874908_+	hypothetical protein	NA	NA	NA	NA
WP_011090410.1\|7876083_7876284_+	hypothetical protein	NA	NA	NA	NA
WP_083635962.1\|7876674_7876986_+	hypothetical protein	NA	NA	NA	NA
WP_074077349.1\|7877006_7877321_+	PilZ domain-containing protein	NA	NA	NA	NA
WP_109866565.1\|7877617_7878747_-\|transposase	IS3-like element ISRj2 family transposase	U5P429	Shigella_phage	1.1e-18	33.7
WP_039187448.1\|7879564_7879936_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_074077351.1\|7879932_7880391_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	1.9e-33	63.6
WP_074077353.1\|7880400_7880691_-	hypothetical protein	NA	NA	NA	NA
WP_131234270.1\|7881235_7881739_-	hypothetical protein	NA	NA	NA	NA
WP_074077354.1\|7881845_7882028_-	hypothetical protein	NA	NA	NA	NA
WP_074077356.1\|7882198_7882426_-	DUF3606 domain-containing protein	NA	NA	NA	NA
WP_122975538.1\|7883071_7883311_-	hypothetical protein	NA	NA	NA	NA
WP_083635965.1\|7883274_7883712_+	hypothetical protein	NA	NA	NA	NA
WP_011090416.1\|7884008_7885808_-	monooxygenase	NA	NA	NA	NA
WP_011090417.1\|7885889_7886135_-	hypothetical protein	NA	NA	NA	NA
WP_028176057.1\|7886122_7887463_-	adenylate/guanylate cyclase domain-containing protein	W5S556	Pithovirus	1.5e-09	27.3
WP_028176056.1\|7888139_7889339_-	transglycosylase SLT domain-containing protein	NA	NA	NA	NA
WP_074076799.1\|7889579_7890782_+	L,D-transpeptidase	NA	NA	NA	NA
WP_011090422.1\|7891681_7892548_+	porin family protein	NA	NA	NA	NA
WP_039185326.1\|7892719_7893352_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011090425.1\|7897615_7897927_+	hypothetical protein	NA	NA	NA	NA
WP_011090426.1\|7898144_7898336_+	hypothetical protein	NA	NA	NA	NA
WP_011090427.1\|7898420_7898633_+	hypothetical protein	NA	NA	NA	NA
WP_053815160.1\|7898648_7899005_-	hypothetical protein	NA	NA	NA	NA
WP_083635967.1\|7899431_7900454_-	hypothetical protein	NA	NA	NA	NA
WP_063789848.1\|7900637_7901090_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_156902900.1\|7901322_7901796_-	hypothetical protein	NA	NA	NA	NA
WP_074077363.1\|7901958_7902138_-	hypothetical protein	NA	NA	NA	NA
WP_039183785.1\|7902140_7903004_-\|transposase	transposase	A0A059NT77	Lactococcus_phage	1.1e-32	36.7
WP_039187468.1\|7903003_7904503_-\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	6.0e-15	28.1

DBSCAN-SWA_10

9051011 : 9076250

Klebsiella_phage(16.67%)

integrase,transposase

attL 9041355:9041371|attR 9055608:9055624

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
9041355:9041371	attL	NA	NA	NA	NA
WP_011090895.1\|9051011_9052253_+\|integrase	site-specific integrase	A0A248SL35	Klebsiella_phage	1.9e-160	66.8
WP_011090896.1\|9052195_9053593_+	DUF1016 domain-containing protein	Q9JMP5	Wolbachia_phage	6.4e-112	55.5
WP_011090897.1\|9053594_9054848_+	hypothetical protein	NA	NA	NA	NA
WP_011090898.1\|9054938_9057428_-	AAA family ATPase	NA	NA	NA	NA
9055608:9055624	attR	NA	NA	NA	NA
WP_014498594.1\|9057424_9057649_-	hypothetical protein	NA	NA	NA	NA
WP_011090899.1\|9057738_9058605_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011090900.1\|9058674_9059337_-	hypothetical protein	NA	NA	NA	NA
WP_014498597.1\|9059374_9061162_+	ATP-binding protein	NA	NA	NA	NA
WP_011085265.1\|9061202_9062312_+\|transposase	IS630-like element ISBj5 family transposase	NA	NA	NA	NA
WP_011090918.1\|9062361_9063225_-\|transposase	transposase	A0A059NT77	Lactococcus_phage	8.1e-33	37.2
WP_011090919.1\|9063224_9064724_-\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	7.8e-15	28.8
WP_011084668.1\|9065023_9065566_-	hypothetical protein	NA	NA	NA	NA
WP_080668329.1\|9066535_9067066_-	hypothetical protein	NA	NA	NA	NA
WP_011090921.1\|9067037_9067442_-	hypothetical protein	NA	NA	NA	NA
WP_014498651.1\|9067614_9068070_+\|transposase	transposase	NA	NA	NA	NA
WP_011090925.1\|9069653_9069983_-	hypothetical protein	NA	NA	NA	NA
WP_011090926.1\|9069983_9070148_-	hypothetical protein	NA	NA	NA	NA
WP_011090929.1\|9070855_9071071_-	hypothetical protein	NA	NA	NA	NA
WP_011090930.1\|9071120_9072254_-	FAD-dependent oxidoreductase	A0A2K9L3K5	Tupanvirus	3.1e-08	24.4
WP_011090936.1\|9074708_9076250_+\|transposase	IS21-like element ISFK1 family transposase	K4I413	Acidithiobacillus_phage	2.0e-127	44.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP013127

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection