CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP018764	Pediococcus acidilactici strain BCC1 plasmid pbcp1, complete sequence	0 crisprs	NA	0	0
NZ_CP018763	Pediococcus acidilactici strain BCC1 chromosome, complete genome	3 crisprs	cas9,cas1,cas2,csn2,DEDDh,DinG,cas3,csa3	10	6
NZ_CP018765	Pediococcus acidilactici strain BCC1 plasmid pbcp2, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP018763_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018763_1

429771-431258

TypeII

Consensus_repeat	Method
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	CRISPRCasFinder
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	CRT
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	PILER-CR

22 spacers

csn2,cas2,cas1,cas9

The CRISPR arrays of NZ_CP018763_1

>merge|NZ_CP018763|1|429771-431258|CRISPRCasFinder,CRT,PILER-CR
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATCTCGGACTCTGCATTGTCGTAAACGGCTTGGGTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATCCAAAAAAAGTTATTATTCCTGCATTGAAAGGTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATCTTACCGTTTTGTTTAGACTTGAAAACTTTAGTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATCCTTTTCTAGCTGATTACATTACCGGTTTTTGTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATCAGCGACAGCCGTTATTTACCGGACGAACCGGTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATCTGGCTGAACGTAAGGCTATAGAGAATCGACGTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATCCTTATTTGCTCGAAGAACATACTCATCAATGTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATCTTAGAGCTCGGCTTGTAGCTCCCGAAACTAGTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATCGGTATTGCTGAATGTTATCAGAGGTCCCTTGTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATCTATCAATGTCCCCAAATGTCCCCAAACAGAGTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATCGGGAAGTACGCTCCAATGACGCTAAATTACGTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATCATTACTGGTTACATGTTGGCGCATGTTGACGTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATCTCCCAATTGCCGCTTGCGCAGCGTGACGAGGTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATCGGCCATTTGCCGAGATTAGAAATGCGGTTAGTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATCTACCAGCCCACTGTCCAGCAGCACCACCTGGTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATCCCCAAGGATATCGTTTGACAAATAGTTTTTGTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATCAAGGATAATAACGCTGCCTTTGTCTATGACGTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATCGAACGGATTTCGGAGAATTCCTAAAATCTGGTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATCAGTCTGGGTTACGTAATGTAAGCCGTGCGGGTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATCACTATAGAGGAATGGAACGAGTGCCGACCTGTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATCCCGAATTAAGCAGACAATTTAGCATTGCTAGTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATCAGTCTATAAAGTGATTGATCACCGCACCGAGTTTCAAAAGGATGCCAAATCCCTAAGGCTAATCAA

>NZ_CP018763|1|1|429771-431258|CRISPRCasFinder
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	TCGGACTCTGCATTGTCGTAAACGGCTTGG
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	CAAAAAAAGTTATTATTCCTGCATTGAAAG
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	TTACCGTTTTGTTTAGACTTGAAAACTTTA
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	CTTTTCTAGCTGATTACATTACCGGTTTTT
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	AGCGACAGCCGTTATTTACCGGACGAACCG
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	TGGCTGAACGTAAGGCTATAGAGAATCGAC
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	CTTATTTGCTCGAAGAACATACTCATCAAT
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	TTAGAGCTCGGCTTGTAGCTCCCGAAACTA
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	GGTATTGCTGAATGTTATCAGAGGTCCCTT
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	TATCAATGTCCCCAAATGTCCCCAAACAGA
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	GGGAAGTACGCTCCAATGACGCTAAATTAC
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	ATTACTGGTTACATGTTGGCGCATGTTGAC
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	TCCCAATTGCCGCTTGCGCAGCGTGACGAG
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	GGCCATTTGCCGAGATTAGAAATGCGGTTA
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	TACCAGCCCACTGTCCAGCAGCACCACCTG
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	CCCAAGGATATCGTTTGACAAATAGTTTTT
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	AAGGATAATAACGCTGCCTTTGTCTATGAC
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	GAACGGATTTCGGAGAATTCCTAAAATCTG
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	AGTCTGGGTTACGTAATGTAAGCCGTGCGG
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	ACTATAGAGGAATGGAACGAGTGCCGACCT
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	CCGAATTAAGCAGACAATTTAGCATTGCTA
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	AGTCTATAAAGTGATTGATCACCGCACCGA
GTTTCAAAAGGATGCCAAATCCCTAAGGCTAATCAA

>NZ_CP018763|1|1|429771-431258|CRT
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	TCGGACTCTGCATTGTCGTAAACGGCTTGG
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	CAAAAAAAGTTATTATTCCTGCATTGAAAG
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	TTACCGTTTTGTTTAGACTTGAAAACTTTA
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	CTTTTCTAGCTGATTACATTACCGGTTTTT
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	AGCGACAGCCGTTATTTACCGGACGAACCG
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	TGGCTGAACGTAAGGCTATAGAGAATCGAC
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	CTTATTTGCTCGAAGAACATACTCATCAAT
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	TTAGAGCTCGGCTTGTAGCTCCCGAAACTA
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	GGTATTGCTGAATGTTATCAGAGGTCCCTT
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	TATCAATGTCCCCAAATGTCCCCAAACAGA
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	GGGAAGTACGCTCCAATGACGCTAAATTAC
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	ATTACTGGTTACATGTTGGCGCATGTTGAC
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	TCCCAATTGCCGCTTGCGCAGCGTGACGAG
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	GGCCATTTGCCGAGATTAGAAATGCGGTTA
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	TACCAGCCCACTGTCCAGCAGCACCACCTG
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	CCCAAGGATATCGTTTGACAAATAGTTTTT
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	AAGGATAATAACGCTGCCTTTGTCTATGAC
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	GAACGGATTTCGGAGAATTCCTAAAATCTG
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	AGTCTGGGTTACGTAATGTAAGCCGTGCGG
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	ACTATAGAGGAATGGAACGAGTGCCGACCT
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	CCGAATTAAGCAGACAATTTAGCATTGCTA
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	AGTCTATAAAGTGATTGATCACCGCACCGA
GTTTCAAAAGGATGCCAAATCCCTAAGGCTAATCAA

>NZ_CP018763|1|1|430629-431192|PILER-CR
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	GGCCATTTGCCGAGATTAGAAATGCGGTTA
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	TACCAGCCCACTGTCCAGCAGCACCACCTG
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	CCCAAGGATATCGTTTGACAAATAGTTTTT
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	AAGGATAATAACGCTGCCTTTGTCTATGAC
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	GAACGGATTTCGGAGAATTCCTAAAATCTG
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	AGTCTGGGTTACGTAATGTAAGCCGTGCGG
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	ACTATAGAGGAATGGAACGAGTGCCGACCT
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	CCGAATTAAGCAGACAATTTAGCATTGCTA
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018763.1\|WP_075139711.1\|441273_443637_+\|preprotein-translocase-subunit-SecA	unknown	unknown	gnl\|CDD\|237259
NZ_CP018763.1\|WP_075139703.1\|420042_422577_+\|M1-family-metallopeptidase	unknown	unknown	gnl\|CDD\|341064
NZ_CP018763.1\|WP_002831110.1\|436538_437714_+\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	unknown	unknown	gnl\|CDD\|133463
NZ_CP018763.1\|WP_024862579.1\|415933_417487_+\|glutamine-hydrolyzing-GMP-synthase	unknown	unknown	gnl\|CDD\|234614
NZ_CP018763.1\|WP_075139706.1\|427885_428791_+\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
NZ_CP018763.1\|WP_002829959.1\|432563_434186_+\|chaperonin-GroEL	unknown	unknown	gnl\|CDD\|234573
NZ_CP018763.1\|WP_075139710.1\|438451_439771_+\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|226583
NZ_CP018763.1\|WP_075139702.1\|418606_420016_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP018763.1\|WP_002829957.1\|434484_436317_+\|APC-family-permease	unknown	unknown	gnl\|CDD\|372624
NZ_CP018763.1\|WP_075139707.1\|429070_429742_+\|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl\|CDD\|213411
NZ_CP018763.1\|WP_075139704.1\|422804_423386_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370635
NZ_CP018763.1\|WP_058121014.1\|417770_418415_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187554
NZ_CP018763.1\|WP_005916130.1\|440055_440442_+\|ComF-family-protein	unknown	unknown	gnl\|CDD\|223970
NZ_CP018763.1\|WP_075139708.1\|431419_432067_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP018763.1\|WP_002831107.1\|428768_429074_+\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|226043
NZ_CP018763.1\|WP_002829962.1\|432256_432541_+\|co-chaperone-GroES	unknown	unknown	gnl\|CDD\|178988
NZ_CP018763.1\|WP_075139705.1\|423569_427670_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374653
NZ_CP018763.1\|WP_002829951.1\|440570_441125_+\|ribosome-associated-translation-inhibitor-RaiA	unknown	unknown	gnl\|CDD\|224461
NZ_CP018763.1\|WP_081372590.1\|413938_415807_+\|heavy-metal-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319774
NZ_CP018763.1\|WP_075139709.1\|437781_438420_-\|YigZ-family-protein	unknown	unknown	gnl\|CDD\|224653

Protein	Function_ID	Function_description	E-value
NZ_CP018763.1\|WP_075139711.1\|441273_443637_+\|preprotein-translocase-subunit-SecA	gnl\|CDD\|237259	PRK12904, PRK12904, preprotein translocase subunit SecA; Reviewed.	0
NZ_CP018763.1\|WP_075139703.1\|420042_422577_+\|M1-family-metallopeptidase	gnl\|CDD\|341064	cd09601, M1_APN-Q_like, Peptidase M1 aminopeptidase N catalytic domain family which includes aminopeptidase N (APN), aminopeptidase Q (APQ), tricorn interacting factor F3, and endoplasmic reticulum aminopeptidase 1 (ERAP1). This M1 peptidase family includes eukaryotic and bacterial members: the catalytic domains of aminopeptidase N (APN), aminopeptidase Q (APQ, laeverin), endoplasmic reticulum aminopeptidase 1 (ERAP1) as well as tricorn interacting factor F3. Aminopeptidase N (APN; CD13; alanyl aminopeptidase; EC 3.4.11.2), a type II integral membrane protease, preferentially cleaves neutral amino acids from the N-terminus of oligopeptides and is present in a variety of human tissues and cell types (leukocyte, fibroblast, endothelial and epithelial cells). APN expression is dysregulated in inflammatory diseases such as chronic pain, rheumatoid arthritis, multiple sclerosis, systemic sclerosis, systemic lupus erythematosus, polymyositis/dermatomyosytis and pulmonary sarcoidosis, and is enhanced in tumor cells such as melanoma, renal, prostate, pancreas, colon, gastric and thyroid cancers. It is considered a marker of differentiation since it is predominantly expressed on stem cells and on cells of the granulocytic and monocytic lineages at distinct stages of differentiation. Thus, APN inhibition may lead to the development of anti-cancer and anti-inflammatory drugs. ERAP1, also known as endoplasmic reticulum aminopeptidase associated with antigen processing (ERAAP), adipocyte derived leucine aminopeptidase (A-LAP), or aminopeptidase regulating tumor necrosis factor receptor I (THFRI) shedding (ARTS-1), associates with the closely related ER aminopeptidase ERAP2, for the final trimming of peptides within the ER for presentation by MHC class I molecules. ERAP1 is associated with ankylosing spondylitis (AS), an inflammatory arthritis that predominantly affects the spine. ERAP1 also aids in the shedding of membrane-bound cytokine receptors. The tricorn interacting factor F3, together with factors F1 and F2, degrades the tricorn protease products, producing free amino acids, thus completing the proteasomal degradation pathway. F3 is homologous to F2, but not F1, and shows a strong preference for glutamate in the P1' position. APQ, also known as laeverin, is specifically expressed in human embryo-derived extravillous trophoblasts (EVTs) that invade the uterus during early placentation. It cleaves the N-terminal amino acid of various peptides such as angiotensin III, endokinin C, and kisspeptin-10, all expressed in the placenta in large quantities. APN is a receptor for coronaviruses, although the virus receptor interaction site seems to be distinct from the enzymatic site and aminopeptidase activity is not necessary for viral infection. APNs are also putative Cry toxin receptors. Cry1 proteins are pore-forming toxins that bind to the midgut epithelial cell membrane of susceptible insect larvae, causing extensive damage. Several different toxins, including Cry1Aa, Cry1Ab, Cry1Ac, Cry1Ba, Cry1Ca and Cry1Fa, have been shown to bind to APNs; however, a direct role of APN in cytotoxicity has been yet to be firmly established.	0
NZ_CP018763.1\|WP_002831110.1\|436538_437714_+\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	gnl\|CDD\|133463	cd06853, GT_WecA_like, This subfamily contains Escherichia coli WecA, Bacillus subtilis TagO and related proteins. WecA is an UDP-N-acetylglucosamine (GlcNAc):undecaprenyl-phosphate (Und-P) GlcNAc-1-phosphate transferase that catalyzes the formation of a phosphodiester bond between a membrane-associated undecaprenyl-phosphate molecule and N-acetylglucosamine 1-phosphate, which is usually donated by a soluble UDP-N-acetylglucosamine precursor. WecA participates in the biosynthesis of O antigen LPS in many enteric bacteria and is also involved in the biosynthesis of enterobacterial common antigen. A conserved short sequence motif and a conserved arginine at a cytosolic loop of this integral membrane protein were shown to be critical in recognition of substrate UDP-N-acetylglucosamine.	4.92655e-87
NZ_CP018763.1\|WP_024862579.1\|415933_417487_+\|glutamine-hydrolyzing-GMP-synthase	gnl\|CDD\|234614	PRK00074, guaA, GMP synthase; Reviewed.	0
NZ_CP018763.1\|WP_075139706.1\|427885_428791_+\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	8.80136e-98
NZ_CP018763.1\|WP_002829959.1\|432563_434186_+\|chaperonin-GroEL	gnl\|CDD\|234573	PRK00013, groEL, chaperonin GroEL; Reviewed.	0
NZ_CP018763.1\|WP_075139710.1\|438451_439771_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|226583	COG4098, comFA, Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair].	4.27682e-172
NZ_CP018763.1\|WP_075139702.1\|418606_420016_+\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	6.05815e-48
NZ_CP018763.1\|WP_002829957.1\|434484_436317_+\|APC-family-permease	gnl\|CDD\|372624	pfam13520, AA_permease_2, Amino acid permease.	4.05738e-28
NZ_CP018763.1\|WP_075139707.1\|429070_429742_+\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	2.16927e-99
NZ_CP018763.1\|WP_075139704.1\|422804_423386_-\|hypothetical-protein	gnl\|CDD\|370635	pfam09726, Macoilin, Macoilin family. The Macoilin proteins has an N-terminal portion that is composed of 5 trasnmembrane helices, followed by a C-terminal coiled-coil region. Macoilin is a highly conserved protein present in eukaryotes. Macoilin appears to be found in the ER and be involved in the function of neurons.	0.000376757
NZ_CP018763.1\|WP_058121014.1\|417770_418415_+\|SDR-family-oxidoreductase	gnl\|CDD\|187554	cd05243, SDR_a5, atypical (a) SDRs, subgroup 5. This subgroup contains atypical SDRs, some of which are identified as putative NAD(P)-dependent epimerases, one as a putative NAD-dependent epimerase/dehydratase. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine-rich NAD(P)-binding motif that is very similar to the extended SDRs, GXXGXXG, and binds NADP. Generally, this subgroup has poor conservation of the active site tetrad; however, individual sequences do contain matches to the YXXXK active site motif, the upstream Ser, and there is a highly conserved Asp in place of the usual active site Asn throughout the subgroup. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.13551e-42
NZ_CP018763.1\|WP_005916130.1\|440055_440442_+\|ComF-family-protein	gnl\|CDD\|223970	COG1040, ComFC, Predicted amidophosphoribosyltransferases [General function prediction only].	4.57109e-22
NZ_CP018763.1\|WP_075139708.1\|431419_432067_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	3.11002e-10
NZ_CP018763.1\|WP_002831107.1\|428768_429074_+\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	3.63081e-29
NZ_CP018763.1\|WP_002829962.1\|432256_432541_+\|co-chaperone-GroES	gnl\|CDD\|178988	PRK00364, groES, co-chaperonin GroES; Reviewed.	1.42388e-45
NZ_CP018763.1\|WP_075139705.1\|423569_427670_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|374653	pfam16592, Cas9_REC, REC lobe of CRISPR-associated endonuclease Cas9. The REC lobe of Cas9 - the CRISPR-associated endonuclease Cas9 - includes the REC1 and REC2 domains. REC1 forms an elongated, alpha-helical structure consisting of 25 alpha helices and two beta-sheets, whereas REC2 inserted within REC1 adopts a six-helix bundle structure. The REC lobe and the NUC lobe of Cas9 fold to present a positively charged groove at their interface which accommodates the negatively charged sgRNA:target DNA heteroduplex. CRISPR (clustered regularly interspaced short palindromic repeat)-Cas system occurs naturally in bacteria as a defense against invasion by phages or other mobile genetic elements. Cas9 is targeted to specific genomic locations by sgRNAs or single guide RNAs, in order to complex with invading DNA in order to cleave it and render it inactive.	7.3053e-146
NZ_CP018763.1\|WP_002829951.1\|440570_441125_+\|ribosome-associated-translation-inhibitor-RaiA	gnl\|CDD\|224461	COG1544, COG1544, Ribosome-associated protein Y (PSrp-1) [Translation, ribosomal structure and biogenesis].	2.37568e-37
NZ_CP018763.1\|WP_081372590.1\|413938_415807_+\|heavy-metal-translocating-P-type-ATPase	gnl\|CDD\|319774	cd02079, P-type_ATPase_HM, P-type heavy metal-transporting ATPase. Heavy metal-transporting ATPases (Type IB ATPases) transport heavy metal ions (Cu(+), Cu(2+), Zn(2+), Cd(2+), Co(2+), etc.) across biological membranes. These ATPases include mammalian copper-transporting ATPases, ATP7A and ATP7B, Bacillus subtilis CadA which transports cadmium, zinc and cobalt out of the cell, Bacillus subtilis ZosA/PfeT which transports copper, and perhaps also zinc and ferrous iron, Archaeoglobus fulgidus CopA and CopB, Staphylococcus aureus plasmid pI258 CadA, a cadmium-efflux ATPase, and Escherichia coli ZntA which is selective for Pb(2+), Zn(2+), and Cd(2+). The characteristic N-terminal heavy metal associated (HMA) domain of this group is essential for the binding of metal ions. This family belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP018763.1\|WP_075139709.1\|437781_438420_-\|YigZ-family-protein	gnl\|CDD\|224653	COG1739, COG1739, Uncharacterized conserved protein [Function unknown].	4.69779e-58

>NZ_CP018763.1|WP_075139707.1|429070_429742_+|type-II-A-CRISPR-associated-protein-Csn2
MKLTYRTHEPVEIKPHAITVLGTNNSTVYTDLVNGMQERNELILAFDENYKELEISKVFDWIGDVGTQNLVIQKYLIKIERVFAEGLVNEQRNQIHDQVNQLFNTVAEQLFMLDLPISVNYDFDLKKLLKYCGVHFDPLSVGNPYGIIEAILKIHEECAINSCVVLTNVAHYLTATQIEELTQLVSQTNQALLLIEFTEIGNQEAYGNSEFYYIDNDFVDWHQ
>NZ_CP018763.1|WP_002831107.1|428768_429074_+|CRISPR-associated-endonuclease-Cas2
MRLMIMFDLPVETAVQRKQYRQFRKALINEGFLMIQYSVYVRVCVNKKSATFMENRIKTYLPENGTIQALTLTEKQYNDMHFLVGERVKDVRNTSDRTVIL
>NZ_CP018763.1|WP_075139706.1|427885_428791_+|type-II-CRISPR-associated-endonuclease-Cas1
MGWRSVIITQHAKLSYSAHAMIVQTNDGINQIPVDDVSLLLISTTQAVITTALISELSKKNVKIVFTDEAREPISEIYGYYPANRTAQLLREQVNWDLQLQQILWTKLVANKIINQINVLNLLDHSTDELVTELEKLELNDLTNREAVVAHKYFPLLFESGFTRRDGSAINAALNYGYSILLSAVNQEIVANGYVTYLGIHHDSEENQFNLASDLMEPFRPVVDCWVANQKFNQLTPDIKYGLVELLSLELKYNGKKTILRNAITDHVRNCLKYLAGKANSFTIEMELSDEVPNNAINDNV
>NZ_CP018763.1|WP_075139705.1|423569_427670_+|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MGDRKYNLGLDIGTSSIGFAAVDENNQPIRVKGKTAIGVRLFEEGKTAADRRGFRTTRRRLSRRRWRINLLNGIFDAHLAEVDPTFLARLKESNRSNLDPKKSFQGSLLFPERKDYQFYKEYPTIYHLRKALMEKDRKFDIREIYLAVHHIIKYRGNFLNGTPMRSFKVENIELDTLFDRLNQLYEEIIPDNELAFDLEQVADVKEVLSSTTIYKMDKKKQLVKMMLLPASNKALQSENKKIVTQFVNAILNYKFKLDVLLQVETDADWSLKLNDEGADDKLEEFTGDLDENRLEIIDLLQRLHNWFSLNEITKDGNSLSAAMVEKYKDHRHHLELLKKVIEDHPDAKKAKALKETYTAYVGKTDDKTQNQDDFYKAVEKNLDDSPEAKEIKRLIQLDQFMPKQRTGQNGAIPHQLHQQELDQIIEKQSKYYPFLAEPNPNVKRRKDAPYKLDELIAFKIPYYVGPLVTPEEQAQNGENVFAWMKRKAAGPITPWNFDEKVDRMESANRFIRRMTTKDTYLFGEDVLPAESMIYEKFVVLNELNNLKINGRHLSLKDKQDIYNDLFKQQKTVSIKALQNYYVTKKKAATAPTVGGLADPKKFLSSLSTYIDFKNMFGERVNDPQFQEDLEQIVEWSTIFEDRGIFKAKLQALGWLSEKQIQQLVAKRYKGWGRLSKKLLTGLKNAEGYSILDEMWRSTENFMQIQSRPEFAALIQQANEKQFEGNDPDNVWENIENILGDAYTSPQNKKAIRQVVKVVQDIEKAVGNPPEKIAIEFTREAAANPQRTQSRLRTLEKLYESAEEVVDAGLTAELAEFKENKHVLSDKYYLYFTQLGRDVYTGDRIRLDQLNDYDVDHILPQSFIKDDSLDNRVLTIRAVNNGKSDNVPVELFGKKMSSFWRRLLDNGMISKRKYNNLITDPDNISKYAQKGFINRQLVETSQVIKLTANILNGIYDKDTEIIEVPAKMNSQMRKMFDLVKVREVNDYHHAFDAYLTIFIGNYLYKCYPKLRPYFVYGKFKKFSDNEDIEVGDGRFNFLNRIERLKNVTDPETGEILWSNVAPNETIKRIKKVYNYKFMIVSREITTRRAELFNQTVYPKNYRGKLIPIKEDRPTDLYGGYSGNTDAYLAIVALEDKKKGKYFKVVGIPTRAAAKLEKLKQQDSQQYLQALHEVIAPQFTKSTKKGIKKAEFEIVLDKVHYRQLVQDGPVKMMLGSSTYKYNAKQLVLSEKALQVIKDDRKFDETQKDDNLIAVYDEILSIVNQSFDLYDINGFRKKLNDNRDQFIDLPAETKYEGRKVVAHGKREMILEILKGLHANASFGNLKPIGFATPFGQMQSKNGIELSENAFLIHQSPSGLFEHKIKLSDL
>NZ_CP018763.1|WP_075139704.1|422804_423386_-|hypothetical-protein
MKKIASIAILAVLPLTLASCGNHSTSNSDTSSNSSKTEKVAKSSSKSSVSKDAKSSSDDKATSSSASANSSKDSTNSNSSSNSNSASSSTSSVTDSSSSADNQMSRSDLTKAEKKNGNRPLADEKIQNEQAAVALLTEKYGNQNWKVAFSSIGKSSPIYFHITSPKHGSYYVYANGDVQSADGDLSNHQIVNK
>NZ_CP018763.1|WP_075139703.1|420042_422577_+|M1-family-metallopeptidase
MANIERFYTKFHPTNYQIKLAISRETKEIKGTTTITGEALSSQIDIHQKDLQIEELRVDGTAGDFTVDQAAEAIHVKLPHTGTVTLEIKYTTKLTNTMMGIYPSYYEVNGETKQLVGTQFETTFARQAFPCVDEPEAKATFDLAIKFDEHPGEVVLSNMPETKVEDGYHYFARTVKMSTYLIAFAFGDLQSKQTKTKSGVQVGVFATKAHQPQELDFALDIAKRAIEFYEDFYQTPYPLPHSWQLALPDFSAGAMENWGLVTYREAYLLLDPKNTTLRTKQVVATVIAHELAHQWFGDLVTMQWWDDLWLNESFANMMEYVAVDALEPEWQIWELFQNSEAGAALQRDATDGVQSVHVQVNDPAEIDALFDGAIVYAKGARMLVMVRALIGDDALRQGLQKYFASHQYGNATGNDLWQALGEAANMPIGDIMHTWLDQPGYPVVTAQVENGDLVLEQQQFFIGEGQAQQRQWQIPLNGNYAEVPALLQTKTLNLGNYQDLRDRNQQPFRLNVGNSSHFIVRYDQRLLDDILADWEQLSAIDQLQLLQDLRLLAEGKQISYAEIVPLLPRFAKTDSALVTEMLYRVANDLKKFVAPQSSAEKQLKKFFGELSQAPAQRLGWQAAAGETNDDQLMRPMVLKAALYAENSAVTAQAHQLFEENEAQLPKLPAAIRSLVIRNEVEHFGSPELFARLLKEYQRTSDASYKSDLCQALTATPSLPLIQQLVQQFENAQVIKPQDLRAWFRGVLANPQGQGPAWNWIRDEWQWLEDTVGGDMEFATYITVIAGIFQTPTRLAEFKAFFEPKLATPGLTREITMDIKVIETRVALIETERDAVQAAVVQAIK
>NZ_CP018763.1|WP_075139702.1|418606_420016_+|MFS-transporter
MEAQNTRHTNPMIVVAVVALMSFMGILTETSMNVTFPALMKEFHVPLNTVQWVTAGYLLMAALVMLTSAYMKRRFTNRQLFTAAAILFSSGDLICGLATNFWVLLAGRLIQAGCVGLCTPLMVNIILDVVPQHKLGTYIGMANLIILIAPALGPTFGGAVVAFNSWRMIFWSTLPVALVLMLLGMKVIKQYAPTDQHYAFDWTRFLLLGTALVSLIVGLNALGEMQLGTFVGLLIVSIGLTILFVKRSHTATKALFSLQVFKQPAFLYSFLPYIMLQFANVGINFLLPNYVQDVFQATSLVGGLILLPGSLFNGFGQPLYGWLLDRFGGKVPLYTGDLLFTLALVGLMCWGPQLGVVGITIAYLIFAIGRSMAFGNSVAYGLKHIDKEFQNDANALYNTGQQVTGAIGTTVLALLMGSVKRPGYTHAQNVSAGSQLAFILLVIFGCVIFVFFHHLVNLKNLPEDKGVDL
>NZ_CP018763.1|WP_058121014.1|417770_418415_+|SDR-family-oxidoreductase
MAKIFIAGGSGRVATALIKNLVADSNEVVAGARHPENVVEMDHVNAVKLDLHDGVDAIADLMKGSDAVYFTAGSRGADLLQTDAMGAVKTMQAAEKLGIKRYVMLSSLYTLESERKWHEGGLADLLDYTTAKFFADNYLVHDTDLDYTIVQPTSLTEEAGTGQIYIGKDLPQKTNPIPDVAKVLADVLKHPNTVKKVFMMSSGSQAIDQALANV
>NZ_CP018763.1|WP_024862579.1|415933_417487_+|glutamine-hydrolyzing-GMP-synthase
MANTDLSNFDKIIVLDFGSQYNQLITRRIREFGVYSELLSHKITAEEIKQINPKGIIFSGGPNSVYDDDAFRVDPEIYQLGIPILGICYGMQLMAYNLGGRVESADNREYGHADINVTDDQAALFKGLPATQTVWMSHGDLVREVPAGFKTVATSANCPIASMADDERKFYGVQFHAEVRNTQYGNDILRHFAFDVCQAQANWSMNDFIDMQVEKIREEVGDRKVLLGLSGGVDSSVVGVLLNKAIGDQLVCIFVDHGLLRKGEAKQVMDSLEGKFGLNIIKVDAQDRFLSKLAGVTDPEQKRKIIGNEFIEVFNDEAQKLKGIDFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPEDMHFELIEPLRTLFKDEARDLGEKLGMPEDLVWRQPFPGPGLGIRVLGEITEDKLQIVRDSDLILREEIKNAGLDRDIWQYFTVLPGIRSVGVMGDGRTYDYTVGIRAVNSIDGMTADFARIPWEVLQKISVRIVNEVDHVNRVVYDITSKPPATVEWE
>NZ_CP018763.1|WP_081372590.1|413938_415807_+|heavy-metal-translocating-P-type-ATPase
MMMIKMQRWFTRFANPLLGVAALLTATGWLLQHGGGSPEVAGMAYGIATLVAGMPILLKAIAALRARVASIELLVSIAVLGALIIGELEEAAMVTFLFGLGNYLERRTLKQTHRALANLTEMQPTQALLVSEGQTRTVAIDDVEVGDQLLVRIGDQVPVDGRVVTGTAAVNEAAITGEARVVNKTPTDQVYTGTIVENGQMVVEAQKVGEETTFGKIIELVEEAQDNQAPVSRFIDQFARFYTPLVLVLALLTQLVTQDFRLAITILVLACPGALVIGTPVSNVAGIGRGAQSGILIKGGQVIDQLAKVRTILMDKTGTITTGKPTVQSFYQYSQQDWLAVAAQLEKQTNHPLAAAVVEFYEQRTGQPVQNHDIAITTVKGIGVTATWHGHQVKLGSPRILEPSAQKLSNKQTADLQKLRENGQSVILMIVDGALVLAMGLSDQVRPGVASALKRLRQTGVTNQWMVTGDQLNVAQSVAHIVGITQVKAGQLPNEKAQFLKELQASGQPVLFVGDGINDSPAIAQAAVGIAMGSGTDVAIETSDVVLINPDFKNVVFARQIAQATLRNMMENVGIAVGTVALLMLGVSLGWVNMASGMFFHEVSILVVIFNAMRLLKLKRPG
>NZ_CP018763.1|WP_075139708.1|431419_432067_-|CPBP-family-intramembrane-metalloprotease
MKISKSSLLTLITYLAIFLLPSVINLFVRLGASFIWVETIDYLVGAALLVVINLKNSEINQIETRRIPFFRAIAWGIIGTALVIMLQFVVSYVTFILGQNPASANTATLVTLAKINPFFVLAITVGAPIMEELVFRKVLFGNLSTLFGMRSNLGLTIMAIISSLAFAFMHNDSHIFLYAAIGLLFCWLYYKTGRIQTSMIAHILMNGLVVLPLVM
>NZ_CP018763.1|WP_002829962.1|432256_432541_+|co-chaperone-GroES
MLKPLGDRVILEAKDEEEQTVGGIVLASNAKEKSQTGKVVAVGNGRVLDDGKTLPMNVKVGDTVVYDKYAGTEVTYEDQKYLVVHEKDLVAVVE
>NZ_CP018763.1|WP_002829959.1|432563_434186_+|chaperonin-GroEL
MAKEIKFSEDARTKMLKGVDKLADTVKSTIGPKGRNVVLEQSYGSPTITNDGVTIAKSIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVNEGMKNVTAGANPVGIRRGIEKATEKAVAALHNMSHEVKTKDDIAQIASISSANPEVGKLIADAMEKVGNDGVITIEESRGVDTTLDVVEGMQFDRGYMSQYMVTDNDKMEANLDNPYILITDKKIANIQDILPLLQSVVEQSRSLLIIADDITGEALPTLVLNKMRGTFNVVAVKAPGFGDRRKEQLEDIAILTGGTVITDDLGLNLKDVTIEQLGQANKVTVTKDDTTIVEGSGSQEQIAERVAMIKQQISETTSDFDKEKLQERLAKLAGGVAVIRVGAATETELKEKKYRIEDALNATRAAVEEGFVPGGGTALVNVIASLEDLDAEGDELTGINIVRRALEEPVRQIAENAGEEGSVIVTKLKTQKDGVGYNAATDEWVDMIEAGIVDPTKVTRSALQNAASVSALLLTTEAVVADLPEEKPAAPAAPNPGMGGMM
>NZ_CP018763.1|WP_002829957.1|434484_436317_+|APC-family-permease
MFSYLKRILIGKPLKTLDESGQALTKFKALALLSSDALSSIAYGTEEILSVLIVLSAAATWYSIPIAAIVLVLLFAITVSYRQIIKAYPSGGGAYVVASKNWGTSAGLVAGGSLLVDYMLTVAVSVTSGTEAITSAIPALQKYHVAIAVLIVLGIMALNLRGLRESASFLTIPVYLFVVVISIMIIVGLYNIVTGQVTYHAAAAIGSTVPGMTFVLFMRALSSGSSSLTGVEAISNAVPNFKKPRRKNAAATLAIMSLILASFFAGITFLAYYSGITPMSSQTVLSQIGVTVFGHGIFYYILQLSTALILAVAANTGFSAFPMLAYNLAKDKFMPHAYMDRGDRLGYSNGIISLAAGAIVLILIFGGQTGLLIPLYAIGVFVPFTLSQSGMIVHWKREGGAHWWINASANLLGALLSAVLVVCLLFLHFSNVWPYFVVMPLLLRMFYKIRKHYDEVADQLRVVEKGKVNLHDYDGSTVIVLVSNVTQVTSGAINYARSIGDYVIAMHVSFDANPEKEHKTAMEFKAEYPDVRFIDIHSSYRSITNPTLRFCDVIAKRAAERNYTTTVLVPQFVPRKPWQNILHNQTGLRLRAALNSRENIIVSTYNYHLK
>NZ_CP018763.1|WP_002831110.1|436538_437714_+|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase
MRFEIVVSLFATMIISAILTPFVRRIAFKIGAVDKPNARRVNKVPMPTMGGLAIFLAFNFSLFFLLRNQIPNPQFYGIFFGECIIMLTGIIDDIFELKPSQKMIGILLAALAVYWFAEVQMTTLTLPFIGIVHLGWFSLPITLIWIAAITNAINLLDGLDGLATGVTIIALFTTGFTGLFFLPSTNIYIVIMIFTLVAAEVGFLPYNFFPARIYLGDTGALFIGFMIAVFSLSGLKNATFISVLIPVMILGVPLTDTIYAILRRLLNKQSIAHADKRHLHHRLMQMGLTHRQTVLVIYGISMIFSFIALLYPLSTLWGSVLLTIGILVGIELFVEAIGLVGENRTPMLSWIKRLVRTTTSKTASNEFKEEDTLKDRVRSRSERHQQKKHHD
>NZ_CP018763.1|WP_075139709.1|437781_438420_-|YigZ-family-protein
MKLILSVKEPVTTEQDIKKSRFISRIIPVQTEEEAQTKLQDIREIEAKATHNCFAYVLGDHQDIQRASDDGEPSGTAGAPILEVLKRENLTNVLVVVTRYFGGIKLGAGGLIRAYGSSTSLAVQSATLMESVDQELLAITIDYQNNDQLTYYLEQHQITQVNHEYTTQVITTIAVDQDQVADLKAELTGLFSGNVSFKDGGQQRVQVPYQPQ
>NZ_CP018763.1|WP_075139710.1|438451_439771_+|DEAD/DEAH-box-helicase
MEAKVKEKFYGRLVPVNQAEATDPTVNYFPAVIVKKRRIQCQRCGATTKLKEGSLPNQQYYCRHCINLGRMSTLVKLGNLPEPNHFPVGRSYLKWQGQLTPDQQRCANEIISSIKQQTDRLLWAVTGAGKTEMLFPGINFALKKALRVAIASPRIDVVLELHPRIQAAFPEIAIALLHGRTSTPYTYTQLVLCTTHQLLRFYHAFDVLIIDEVDSFPFAMNPALHYAAHQARKECGTTIYLTATPDGQLLKDSRSHRLPTSYLTRRFHGHPLPEIKMVSRCNWQKLIHRRRLPERLRQFLMAQAKAQRQFLVFVPRIDQLSSVLRAIQKQFPELNLATVYAEDPERIEKVSAMREGQLTGLITTTILERGVTFPGIDVAVLGADDEIFSMAALVQIAGRVGRSPKRPTGTVLFIGQMLTRRIKRAQRQIKFMNQQAFKQ
>NZ_CP018763.1|WP_005916130.1|440055_440442_+|ComF-family-protein
MRKAFCNDFINFIQSLVKEDEHLVPIPVDQGTIKVRGFNQVAGLIEGLEFEPVLISQRSEQARHQFQRSRRERLQRENPFRVVEPNKVAGAKWVIIDDIYTTGVTVRQAGRELSKHGARQVRSITLCR
>NZ_CP018763.1|WP_002829951.1|440570_441125_+|ribosome-associated-translation-inhibitor-RaiA
MLDFNVRGENIEVTESIRDYVEKRIGKIEKYFDQGANPKAHVNLKVYQDRTAKVEVTIPLPYLVLRAEETSPDLYASVDLVTDKLERQIRKYKTKINRKSRETGYKGVEIPQEDAREDEEEASEFDIVRTKQVSLKPMGAEEAILQMDMLGHNFFIYEDADTGSVDIVYRRHDGRYGLIESANE
>NZ_CP018763.1|WP_075139711.1|441273_443637_+|preprotein-translocase-subunit-SecA
MANILKKWVESDAREIKRLGKKADKIDALKDEMAQLSDEELKAKTPEFKERLKNGETLDDILIEAFAVAREGAKRVLGLFPFRVQLIGGMVLHGGNIAEMKTGEGKTLTATLPVYLNALGGEGVHVVTVNEYLAERDSTEMGELYKWLGLTVGVNTAEMSPDEKREAYNCDITYSTNSEIGFDYLRDNMVVYKEDMVQRPLNFALIDEVDSVLIDEARTPLIISGQTEPSVTLYQRADRFVKTLTDGDYTIDWESKSISLTENGIRRGEKYFNTDNLYDVENSALNHHIDQALRANYIMTKDKDYVVSDDGEVLIVDSFTGRVMEGRRFSDGLHQAIEAKEHVEIQDGSKTMANITYQNLFRMYKKLSGMTGTAQTEAEEFREIYNMEVVSVPTNRPVVRDDRPDLLYPTLESKFKAVVKEIKKLHTKGQPVLVGTVAVETSEYLSRLLDRERIPHVVLNAKNHAREAEIVANAGQKGAVTIATNMAGRGTDIKLGPGVVELGGLAVIGTERHESRRIDNQLRGRSGRQGDVGMSQFYLSLEDDLMIRFGSERIKDLLSRMKVADEDAVIQSRLISRQVESAQKRVEGNNYDARKNVLQYDDVMRAQREVIYAERQQVIMEEHSLKDVLMPMVYRTIDRVVDAHTAKTKKSYDLDTIVEFARTTLVNENDINIEDLEGKSANEIKDYLNQLADQMYKQKEDALYAPEQILEFEKVVILRVVDQHWTDHIDAMDQLRQSVGLRGYGQLNPLVEYQQEGYRMFNEMVTDIEYETTRLFMKSEIRQNLER

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP018763_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018763_2

548388-548555

Orphan

Consensus_repeat	Method
AGTTCGTGAAGTATGTAAAATGACATACCATTGAACC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP018763_2

>merge|NZ_CP018763|2|548388-548555|CRISPRCasFinder
AGTTCGTGAAGTATGTAAAATGACATACCATTGAACCAGAGCAAAGTAAGCGAAAAACAAAAACAAAGTTCGTGAAGTATGTAAAATGACATACCATTGAACCTTAACTATCATAATCTAGTGCAGTCAGGTGTTCGTGAGGTATCTAAAATGACATACCATTAAACC

>NZ_CP018763|2|2|548388-548555|CRISPRCasFinder
AGTTCGTGAAGTATGTAAAATGACATACCATTGAACC	AGAGCAAAGTAAGCGAAAAACAAAAACAA
AGTTCGTGAAGTATGTAAAATGACATACCATTGAACC	TTAACTATCATAATCTAGTGCAGTCAGG
TGTTCGTGAGGTATCTAAAATGACATACCATTAAACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018763.1\|WP_081372606.1\|546036_546567_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_CP018763.1\|WP_005919347.1\|543795_544326_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341027
NZ_CP018763.1\|WP_075139727.1\|538707_539637_+\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP018763.1\|WP_058120753.1\|559459_560290_+\|bifunctional-hydroxymethylpyrimidine-kinase/phosphomethylpyrimidine-kinase	unknown	unknown	gnl\|CDD\|180561
NZ_CP018763.1\|WP_075139735.1\|553067_554222_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271189
NZ_CP018763.1\|WP_081041632.1\|555951_556752_+\|DUF1211-domain-containing-protein	unknown	unknown	gnl\|CDD\|226078
NZ_CP018763.1\|WP_075140322.1\|551722_552160_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018763.1\|WP_008842402.1\|542308_543643_-\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224169
NZ_CP018763.1\|WP_002829841.1\|558049_558274_-\|CsbD-family-protein	unknown	unknown	gnl\|CDD\|283241
NZ_CP018763.1\|WP_126130462.1\|539614_540553_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP018763.1\|WP_075139731.1\|545848_546121_+\|magnesium-transporter-CorA	unknown	unknown	gnl\|CDD\|213361
NZ_CP018763.1\|WP_008842435.1\|555114_555927_+\|LicD-family-protein	unknown	unknown	gnl\|CDD\|368225
NZ_CP018763.1\|WP_075139730.1\|545171_545819_+\|Mg2+-and-Co2+-transporter	unknown	unknown	gnl\|CDD\|213361
NZ_CP018763.1\|WP_075139729.1\|544340_544574_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018763.1\|WP_075139734.1\|552302_552533_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|200128
NZ_CP018763.1\|WP_075139733.1\|549815_551423_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|350691
NZ_CP018763.1\|WP_075139732.1\|546536_547130_+\|AlwI-family-type-II-restriction-endonuclease	unknown	unknown	gnl\|CDD\|312855
NZ_CP018763.1\|WP_075139726.1\|536821_538486_-\|glycosyltransferase-family-8-protein	unknown	unknown	gnl\|CDD\|133037
NZ_CP018763.1\|WP_008842437.1\|557113_557713_+\|chitin-binding-protein	unknown	unknown	gnl\|CDD\|237309
NZ_CP018763.1\|WP_058120754.1\|558668_559463_+\|hydroxyethylthiazole-kinase	unknown	unknown	gnl\|CDD\|236477

Protein	Function_ID	Function_description	E-value
NZ_CP018763.1\|WP_081372606.1\|546036_546567_-\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	3.05822e-19
NZ_CP018763.1\|WP_005919347.1\|543795_544326_-\|MFS-transporter	gnl\|CDD\|341027	cd17474, MFS_YfmO_like, Bacillus subtilis multidrug efflux protein YfmO and similar transporters of the Major Facilitator Superfamily. This family is composed of Bacillus subtilis multidrug efflux protein YfmO, bacillibactin exporter YmfD/YmfE, uncharacterized MFS-type transporter YvmA, and similar proteins. YfmO acts to efflux copper or a copper complex, and could contribute to copper resistance. YmfD/YmfE is involved in secretion of bacillibactin. The YfmO-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.69315e-08
NZ_CP018763.1\|WP_008842402.1\|542308_543643_-\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224169	COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion].	1.04794e-110
NZ_CP018763.1\|WP_058120753.1\|559459_560290_+\|bifunctional-hydroxymethylpyrimidine-kinase/phosphomethylpyrimidine-kinase	gnl\|CDD\|180561	PRK06427, PRK06427, bifunctional hydroxy-methylpyrimidine kinase/ hydroxy-phosphomethylpyrimidine kinase; Reviewed.	1.5456e-127
NZ_CP018763.1\|WP_075139735.1\|553067_554222_+\|site-specific-integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	2.53273e-48
NZ_CP018763.1\|WP_081041632.1\|555951_556752_+\|DUF1211-domain-containing-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	2.02762e-30
NZ_CP018763.1\|WP_075139727.1\|538707_539637_+\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	1.39229e-68
NZ_CP018763.1\|WP_002829841.1\|558049_558274_-\|CsbD-family-protein	gnl\|CDD\|283241	pfam05532, CsbD, CsbD-like. CsbD is a bacterial general stress response protein. It's expression is mediated by sigma-B, an alternative sigma factor. The role of CsbD in stress response is unclear.	0.000284974
NZ_CP018763.1\|WP_126130462.1\|539614_540553_+\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	9.46204e-31
NZ_CP018763.1\|WP_075139731.1\|545848_546121_+\|magnesium-transporter-CorA	gnl\|CDD\|213361	cd12827, EcCorA_ZntB-like_u2, uncharacterized bacterial subfamily of the Escherichia coli CorA-Salmonella typhimurium ZntB family. A uncharacterized subfamily of the Escherichia coli CorA-Salmonella typhimurium ZntB (EcCorA-ZntB_like) family of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes.The EcCorA-ZntB-like family includes the Mg2+ transporters Escherichia coli and Salmonella typhimurium CorAs, which can also transport Co2+, and Ni2+. Structures of the intracellular domain of EcCorA-ZntB-like family members, Vibrio parahaemolyticus and Salmonella typhimurium ZntB, form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA. Natural variants such as GVN and GIN, such as occur in some ZntB family proteins, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	6.63084e-33
NZ_CP018763.1\|WP_008842435.1\|555114_555927_+\|LicD-family-protein	gnl\|CDD\|368225	pfam04991, LicD, LicD family. The LICD family of proteins show high sequence similarity and are involved in phosphorylcholine metabolism. There is evidence to show that LicD2 mutants have a reduced ability to take up choline, have decreased ability to adhere to host cells and are less virulent. These proteins are part of the nucleotidyltransferase superfamily.	6.60967e-62
NZ_CP018763.1\|WP_075139730.1\|545171_545819_+\|Mg2+-and-Co2+-transporter	gnl\|CDD\|213361	cd12827, EcCorA_ZntB-like_u2, uncharacterized bacterial subfamily of the Escherichia coli CorA-Salmonella typhimurium ZntB family. A uncharacterized subfamily of the Escherichia coli CorA-Salmonella typhimurium ZntB (EcCorA-ZntB_like) family of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes.The EcCorA-ZntB-like family includes the Mg2+ transporters Escherichia coli and Salmonella typhimurium CorAs, which can also transport Co2+, and Ni2+. Structures of the intracellular domain of EcCorA-ZntB-like family members, Vibrio parahaemolyticus and Salmonella typhimurium ZntB, form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA. Natural variants such as GVN and GIN, such as occur in some ZntB family proteins, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	3.97785e-17
NZ_CP018763.1\|WP_075139732.1\|546536_547130_+\|AlwI-family-type-II-restriction-endonuclease	gnl\|CDD\|312855	pfam09491, RE_AlwI, AlwI restriction endonuclease. This family includes the AlwI (recognizes GGATC), Bsp6I (recognizes GC^NGC), BstNBI (recognizes GASTC), PleI(recognizes GAGTC) and MlyI (recognizes GAGTC) restriction endonucleases.	2.24782e-07
NZ_CP018763.1\|WP_075139734.1\|552302_552533_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|200128	TIGR01764, Probable_excisionase, DNA binding domain, excisionase family. An excisionase, or Xis protein, is a small protein that binds and promotes excisive recombination; it is not enzymatically active. This model represents a number of putative excisionases and related proteins from temperate phage, plasmids, and transposons, as well as DNA binding domains of other proteins, such as a DNA modification methylase. This model identifies mostly small proteins and N-terminal regions of large proteins, but some proteins appear to have two copies. This domain appears similar, in both sequence and predicted secondary structure (PSIPRED) to the MerR family of transcriptional regulators (pfam00376). [Unknown function, General].	1.32605e-08
NZ_CP018763.1\|WP_075139733.1\|549815_551423_-\|AAA-family-ATPase	gnl\|CDD\|350691	cd17933, DEXSc_RecD-like, DEXS-box helicase domain of RecD and similar proteins. RecD is a member of the RecBCD (EC 3.1.11.5, Exonuclease V) complex. It is the alpha chain of the complex and functions as a 3'-5' helicase. The RecBCD enzyme is both a helicase that unwinds, or separates the strands of DNA, and a nuclease that makes single-stranded nicks in DNA. RecD is a member of the DEAD-like helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.	4.25928e-09
NZ_CP018763.1\|WP_075139726.1\|536821_538486_-\|glycosyltransferase-family-8-protein	gnl\|CDD\|133037	cd04194, GT8_A4GalT_like, A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.	1.79706e-75
NZ_CP018763.1\|WP_008842437.1\|557113_557713_+\|chitin-binding-protein	gnl\|CDD\|237309	PRK13211, PRK13211, N-acetylglucosamine-binding protein GbpA.	3.10252e-70
NZ_CP018763.1\|WP_058120754.1\|558668_559463_+\|hydroxyethylthiazole-kinase	gnl\|CDD\|236477	PRK09355, PRK09355, hydroxyethylthiazole kinase; Validated.	1.00986e-101

>NZ_CP018763.1|WP_075139732.1|546536_547130_+|AlwI-family-type-II-restriction-endonuclease
MCHWVQSDGPVFQIAVAWYYISEEKYSLRESMNLTMDSEGLPVAQAGGQKKKQDENSGDITIEYKDRTLFLEVTLMDKNAIKRGEWEPVLRHTVNLSASRTVPVQTYFITDAVDKNTENIWRSVAATDLEETAVQHRSVRATIYPLTIDTLIKWLHDKGVNEKVIWDAVDTSYKPLIETDFDADWKADILASISSNN
>NZ_CP018763.1|WP_081372606.1|546036_546567_-|recombinase-family-protein
MVHLIEPNDTLIVIKLDRFARNTREALNLIDDLLKEKIMIKVLNLGTIDNTPIERMIVRTLLSVAEVERDMIIERMQAGKIFARQHNPNYKEGIPKRKEDSWNMAIFEYSNSHTVKEAAEAIKLLKGISLLKSQQSTSALNHIRVSQILYKYFLRRNQNQQIRLSITEIISTAKTP
>NZ_CP018763.1|WP_075139731.1|545848_546121_+|magnesium-transporter-CorA
MDRIILGYSQYLDDLEDMITNMISYQLNMIMKTLTEISIVLTIPAIIFGFWGINVHVPFEKSSYGVFAVLIISVILSLICWFWLRRKKYL
>NZ_CP018763.1|WP_075139730.1|545171_545819_+|Mg2+-and-Co2+-transporter
MLKTYSLTKDTLLVSSESNIKNSSVVYVYGDEREYIESFEHKYDLEIGNILTFDDQVAYDTMIDRNDEKSLLVSFLFPEVHEGGHLHNLTTSIVFLVFKNKLIIFTKQKLKFIPELLSNMVLRDVNNFIEEVLLKIIQKDFHVMLNHLRGVKEKIDDLDSEISTSGSLRPTFGDLLTLQKYMIALSTTYGANHKALDFIKKKSTTINDIDFTTKK
>NZ_CP018763.1|WP_075139729.1|544340_544574_-|hypothetical-protein
MALGNNGFNVIGALFLSQVRLGFIVFGIFTFAGVLITTLIVHEPSNLDETSTKKKEKFSLKNVKLIFPSWQIGATTT
>NZ_CP018763.1|WP_005919347.1|543795_544326_-|MFS-transporter
MFQGVGNFAITGYILYIMTDFLHRGNQTQSSIQLVNMIMLIFGILMGLVAGPLSNKFKILKLPVGLSTILLAIAGLSLFFLRNNTGIILYALAAGLGMGLWNALDNLLNLKVIPDQNRVAFFLGVYNLGNTITQAIAPVLAAAVISLFGYSGIFIVSFIFSLIGGISMLSIKSLKR
>NZ_CP018763.1|WP_008842402.1|542308_543643_-|NAD(P)/FAD-dependent-oxidoreductase
MTESYQFDVLYLGAGHGAFDGAVPLANSGKKVAIIEADKIGGTCPNRGCNAKITLDNPVQLLRHQERLDGIVNGDLKLDWTANVEHEHEVIDGLPDMITGLLDSVDIEIIHGRGKFVDAHTIEVDQQRYTADKIVIATGLRPHHLDVMGSELTHDSTDFMSLKQLPENIVIIGAGYIGMEFATIANAAGANVTVLLRHNRALRKFNQDYVKQVIADLEKRGVKFIYNAQVDRFEEDGSHFTVSYNDHETLTTDWILDATGRIPNIENIGLDEVGVSYNANGIEVNDHLQTNIDNIYASGDVLDKEQPKLTPTAIFESSYLTQLFTGKTTDAINYPPIPTIVFTSPQIAQVGMSVEEAQQNPDYTIKTNHLPDGWFRQVDKETIGDNTLIYDQDHHLVGAAEVSEHAADAINVLLPAIEFQYTAEQLGRIVPLFPTLGADVWSQI
>NZ_CP018763.1|WP_126130462.1|539614_540553_+|IS3-family-transposase
MCPKIRIKFAIYRNTKSGGETTGRYQAIQEMIAEGYSVSELTKAAGITRQAYYKWLKHKPSKREIEESEIFQLIKQLENEHKQSVGYDKMTRLINLSQQISYNVNKKRIIRIMKEHGIKADYRQPTRKRIQTQQAYEAENILKRQFNQTAANQVWVTDTTEITYGVRLNKVRLHVVLDLYGQYPVSWLITPTETAEGAIKAFERARVNEGALAPLIHTDRGAAYTSKAFNQYLVINNAQHSYSAPGTPADNAVIEHWWADFKAIWIAHLPKAQTLVELKQQVKEGITYFTEKFISAKRNDLTAAEYRFGKAN
>NZ_CP018763.1|WP_075139727.1|538707_539637_+|IS30-family-transposase
MSSITYSERIKIETFCELGLSNIQMGVRLNRSPATISYELARCEPYQAELAQTDAEYKRSRCGRKTKLSDELKQKILNHLRLSWSPGMIAHEFKLATKSIYNWLNQGRIGFSLNDLPEHGVRQRRNVDQRSKYNQSLGRSIEQRPMMINQRNRIGDFELDTVVGPRGHSKAVLLTLIDRKSRFLWAYRLKDRTTATVNEALTKFLTTFNGPVHSFTVDRGTEFSGLVSLESQYGIKTYYCHAYTPAERGSNERFNRNLRYFYPKGTRFEHISAQDLTTTLLQINQRPLKILDWQTPYQVMLTNLSKNSN
>NZ_CP018763.1|WP_075139726.1|536821_538486_-|glycosyltransferase-family-8-protein
MNLKKINILLAADRNYADPLCITIKTALEALNSATRAHFIVLTNNLGDQTRALLDKLMHNFHTIEYLNLDDERFDFCPTNQHINKTAYFRIIAPKLLASRQIDRLIYLDVDVLIRKDLTELAESNLNGNTVGAVIDTGQAFALHRLGVDPVVAASNLYFNSGIMVIDVARWNAHRITEKTLAFIRNHADRIIFHDQDALNAVLAGEVQFLHPKWNLQNSIIFRKHRPINQGYAELIDEAIKEPSIVHFTTHEKPWKDLTVHPYLDEYHEELGELEMHRGVINVISAANSAFTQALATSYVSILENDPDHQYNFFLLPDHLTDRDMMLLGSIIARYDNATIKIVEVNEELLANAVESDRIVKTAYYRILAPALLPSINRAIYLDCDIIANTSLHELWQTNLEGNVIAAVEDAGFHDRLEKMGITKENEKYFNSGMMLIDLVRWRAKSITQKVLDYINQNPEKLRFHDQDALNAILYNDWLHLHPQWNAQSNIVMETIFPPRTELLEPYAETREDPKLIHFCGHVKPWHEDCENPYAEVYLKYHEMVSNQGVKVRG
>NZ_CP018763.1|WP_075139733.1|549815_551423_-|AAA-family-ATPase
MKIGKVKLILTVGNAGTGKTTNISTTLDDINNTDVFLTSPNHTASSRLRDSLNNMDNTDLAKKLQRKTHVNFSSFDEYKATNIIIDEFGELSKIDFESLLFHVRNIKEKEGKDVNIYCYGDSHQLPPINKFGALDAIWMANRHLFNNADDSAYRNWMGQLYSNLLTKNTLNVVEDWNNTVDTIEVRTLYRNYRMERTDWEADDYDEEFYQELRNEHSFTRNYGKHLSKCLNEGWLILSPKYGRIHEANRLLANSGNCKPVNDFPFVAKKDDESDVHLNPYHTNIEDLQNNFPSIPTLDTELAGTEQYEFTCGCVVANVQGMEADRVCFYMGSEPISPMSHDFYTINNLHTGLTRGRKDWLYLGNIEDYDTMLNTPRRDARKQLELYSNNRALENMVKNACTNYFGETDLNPYQDYLMELYNLNTLGEHVEKWSKENFAIRLRDYLENNGNLPSHLRWAKDIINQSQANGRKIGGQNRKGTGRLQQQIENTLSDDVEKFKILKNDAFNLSQKEFKKEHDCDRNNVRHIIKEIETTN
>NZ_CP018763.1|WP_075140322.1|551722_552160_-|hypothetical-protein
MTLLKNKKREHFSATVIGFDMFKEITGERRPIVYLRNIGSDTHNFDFGWITYTKEMREKLGLLQKWDWIRFDARIPDKPRYADVMPSKAEFKNPTKAFLPKLDNRIKPVSKAKVMTMIDKFIAEKDKAKRDKELAQERNKLPFRF
>NZ_CP018763.1|WP_075139734.1|552302_552533_-|helix-turn-helix-domain-containing-protein
MELKQITDNKELMEQLSLLFKPAPRYMNKKEACKYMGICYRTFQKAIAEGLPAVQIGGVLRFDRLAIDEYLKNKII
>NZ_CP018763.1|WP_075139735.1|553067_554222_+|site-specific-integrase
MAKIKKYTTKTGKIRYEFQVYAGVDSLTGRQKTTRRRGFKTRKEASIVLSRLELEIEKRGLQEDERRFFRDVCTEWMEQYRLTVRESTLEKTQRIINIHVLPAFGDMLIDQITPNVCQKVVNRWFLQAKSYKKWLNYASMVFDYALRAEYVGRNPCTLVTMPRVQEQAGEKLENFWTRDELNTFFDYMTPKRDVEQFTMFRVLAYSGIRKGELLALTWKDIDFESNTLRVNKTLTQGLGGKLIVQPPKSRAGRRTIDLDDSTMRYLRQWKGVQRETFLGMGFNTNNTSQLVFASNRNHFRSMNTPTKWLNKAIKATGLKHISIHGFRHTHASLLYQSGVGLKETQQRLGHSRADSSVTLDVYTHTTEQQNVAALQRFEDYVEAK
>NZ_CP018763.1|WP_008842435.1|555114_555927_+|LicD-family-protein
MSQIEELHRVQLQMLQVVTAICDKYDIEYMLIGGTLLGAIRHDGFIPWDDDVDLGMTRENYDKFATVAPVEFQHTHYFMQTADTDPNFAFSYMKILDTNTYIEEKNNVNDARKGIFIDIFPFDKVPRQPEIRQAVYNRFKIADTAILLRLGYNVIKTPFRKDPKDKSLDLFMSVAKLKERRENIMRLYNHEPFHHYKNYASQYAYDKEVLSQRELTELTKHKFENLEVAIPKHYDKILTRMYGDYMELPPEKNRVAKHIDVVIIDGKHVE
>NZ_CP018763.1|WP_081041632.1|555951_556752_+|DUF1211-domain-containing-protein
MKERMDAFSDAVIAIIITIMVLELPLPQHDALSEYLQFGKSIGIFFISFCFVANIWYQHAMLFKDSDTMNDRVFVKEFTFLAFLSLTPIFTKVIIYDTNRTTVMAYGVLTMIVSILFMWLSYEVIKQKYTSHHEMRRIFHKIYDNHNNFLGFTSVLILVLAYFYPKWAVVIYLAIPVFSFVVTRHDYTDFQDVTELPEAEQDQFLSANNVDLHELRKKQREIMKKYRGHGRKRNDPELQAELRKLFQGYPDLAKRNRHQRGQYGNS
>NZ_CP018763.1|WP_008842437.1|557113_557713_+|chitin-binding-protein
MVKSRNRILHYILVAVSVVIVVLGFSVIKASAHGYVTNPGGRAYLGSSEFPGKPLNENIGPVMYEPQSIEAPKNTFIDGKIASAGLAKFSQLDEQTADRWYKTPIKSGAFDITWHLTAPHSTSTWDYYITKPGWDPNKPLKFSDFKKIASFDDHGATPGTEVTHKINIPDQKGYHVILSVWNIANTANAFYQVSDVNIQ
>NZ_CP018763.1|WP_002829841.1|558049_558274_-|CsbD-family-protein
MDKDRMENTKDKVAGKVHEGAGKLTGDKKEESKGKAQNMAGKVKDKLADVKDSAAGAMEELKDKLDKKDDKDHE
>NZ_CP018763.1|WP_058120754.1|558668_559463_+|hydroxyethylthiazole-kinase
MDLQGIKRIREVNPVVVNYANFVTPFLVANGLNAVGASPIMSEEESEAEELVRLASAVTINLGAVRREGWADIETLCQAANDQQKPLVLDPVAVGATQYRQQLNFRLLKKYHFDVIRGNLGEIAVLAGIDWQTRGIDAGNGDGDAHQVVKACAQKYHNVVIASGATDYISDGTRVVEIHNQTRLLPAVVGSGDLLSSLAAAFCAVGPTPLQAAINASLTLSCAGERVAEKLHDQYLPGSFLNGLMDELANITVAQVEERMKVEE
>NZ_CP018763.1|WP_058120753.1|559459_560290_+|bifunctional-hydroxymethylpyrimidine-kinase/phosphomethylpyrimidine-kinase
MINMDTKKPAQVLTIAGTDSGGGAGIQADLKTMQERRVFGTCVVVAVTAQNTLGVTDVAVMPRHIIDHQFAALAEDLDIKAAKTGMLANSAVVDAVVENYQKYDFGPLVVDPVMIAKGGAKLLSDEAIEAVRTRLLPLAYLITPNLPEAEKLAGMPIKNNADAKAAAARLQGLGAQNVLIKGGHFSDSAESRDYVLFVDGSELELASPRYETSNTHGTGDTISSVIVSEIAKGKSLKQALQIGKAFINAAISDGIQVGHGHGPLNHWAYREVENEI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP018763_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018763_3

619828-619931

Orphan

Consensus_repeat	Method
TTAGCTCAGTTGGGAGAGCATCTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP018763_3

>merge|NZ_CP018763|3|619828-619931|CRISPRCasFinder
TTAGCTCAGTTGGGAGAGCATCTGCCTTACAAGCAGGAGGTCACAGGTTCGAGCCCTGTATCCTCCATTATCTTGAGCCGTTAGCTCAGTTGGTAGAGCATCTG

>NZ_CP018763|3|3|619828-619931|CRISPRCasFinder
TTAGCTCAGTTGGGAGAGCATCTG	CCTTACAAGCAGGAGGTCACAGGTTCGAGCCCTGTATCCTCCATTATCTTGAGCCG
TTAGCTCAGTTGGTAGAGCATCTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018763.1\|WP_002830669.1\|622751_623942_+\|methionine-adenosyltransferase	unknown	unknown	gnl\|CDD\|235374
NZ_CP018763.1\|WP_005919128.1\|633410_633872_+\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NZ_CP018763.1\|WP_002829782.1\|605292_607500_-\|ATP-dependent-Clp-protease-ATP-binding-subunit	unknown	unknown	gnl\|CDD\|223616
NZ_CP018763.1\|WP_004166559.1\|613248_614253_+\|flippase-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|377103
NZ_CP018763.1\|WP_002829779.1\|608046_608313_+\|phosphocarrier-protein-HPr	unknown	unknown	gnl\|CDD\|237503
NZ_CP018763.1\|WP_002829785.1\|602997_603252_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018763.1\|WP_075139770.1\|612186_613203_+\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340831
NZ_CP018763.1\|WP_075139772.1\|627262_629680_+\|leucine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234743
NZ_CP018763.1\|WP_008842201.1\|608312_610037_+\|phosphoenolpyruvate--protein-phosphotransferase	unknown	unknown	gnl\|CDD\|224006
NZ_CP018763.1\|WP_002829774.1\|610968_612156_+\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340844
NZ_CP018763.1\|WP_008842200.1\|607715_607904_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018763.1\|WP_075139773.1\|632454_633285_-\|NAD(P)H-hydrate-dehydratase	unknown	unknown	gnl\|CDD\|238576
NZ_CP018763.1\|WP_070366758.1\|610109_610883_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP018763.1\|WP_005919149.1\|621848_622580_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018763.1\|WP_005919135.1\|631629_632349_+\|16S-rRNA-pseudouridine(516)-synthase	unknown	unknown	gnl\|CDD\|211327
NZ_CP018763.1\|WP_075139771.1\|625665_626229_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|377744
NZ_CP018763.1\|WP_053906527.1\|629936_631619_+\|polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|240529
NZ_CP018763.1\|WP_002830672.1\|626221_626857_-\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239486
NZ_CP018763.1\|WP_002830670.1\|624117_625587_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341045
NZ_CP018763.1\|WP_075139769.1\|603882_604860_+\|GMP-reductase	unknown	unknown	gnl\|CDD\|235479

Protein	Function_ID	Function_description	E-value
NZ_CP018763.1\|WP_002830669.1\|622751_623942_+\|methionine-adenosyltransferase	gnl\|CDD\|235374	PRK05250, PRK05250, S-adenosylmethionine synthetase; Validated.	0
NZ_CP018763.1\|WP_005919128.1\|633410_633872_+\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	1.49532e-25
NZ_CP018763.1\|WP_002829782.1\|605292_607500_-\|ATP-dependent-Clp-protease-ATP-binding-subunit	gnl\|CDD\|223616	COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones].	0
NZ_CP018763.1\|WP_070366758.1\|610109_610883_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.22543e-30
NZ_CP018763.1\|WP_002829779.1\|608046_608313_+\|phosphocarrier-protein-HPr	gnl\|CDD\|237503	PRK13780, PRK13780, phosphocarrier protein HPr; Provisional.	7.13708e-55
NZ_CP018763.1\|WP_004166559.1\|613248_614253_+\|flippase-like-domain-containing-protein	gnl\|CDD\|377103	pfam03706, LPG_synthase_TM, Lysylphosphatidylglycerol synthase TM region. LPG_synthase_TM is the N-terminal region of this family of bacterial phosphatidylglycerol lysyltransferases. The function of the family is to add lysyl groups to membrane lipids, and this region is the transmembrane domain of 7xTMs. In order to counteract attack by membrane-damaging external cationic antimicrobial molecules - from host immune systems, bacteriocins, defencins, etc - bacteria modify their anionic membrane phosphatidylglycerol with positively-charged L-lysine; this results in repulsion of the foreign cationic peptides.	1.92078e-32
NZ_CP018763.1\|WP_075139770.1\|612186_613203_+\|glycosyltransferase-family-4-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	3.12347e-35
NZ_CP018763.1\|WP_075139772.1\|627262_629680_+\|leucine--tRNA-ligase	gnl\|CDD\|234743	PRK00390, leuS, leucyl-tRNA synthetase; Validated.	0
NZ_CP018763.1\|WP_008842201.1\|608312_610037_+\|phosphoenolpyruvate--protein-phosphotransferase	gnl\|CDD\|224006	COG1080, PtsA, Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) [Carbohydrate transport and metabolism].	0
NZ_CP018763.1\|WP_002829774.1\|610968_612156_+\|glycosyltransferase-family-4-protein	gnl\|CDD\|340844	cd03817, GT4_UGDG-like, UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.	8.27925e-139
NZ_CP018763.1\|WP_075139773.1\|632454_633285_-\|NAD(P)H-hydrate-dehydratase	gnl\|CDD\|238576	cd01171, YXKO-related, B.subtilis YXKO protein of unknown function and related proteins. Based on the conservation of the ATP binding site, the substrate binding site and the Mg2+binding site and structural homology this group is a member of the ribokinase-like superfamily.	1.17936e-74
NZ_CP018763.1\|WP_075139771.1\|625665_626229_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|377744	pfam06962, rRNA_methylase, Putative rRNA methylase. This family contains a number of putative rRNA methylases. Note that many family members are hypothetical proteins.	2.53074e-71
NZ_CP018763.1\|WP_005919135.1\|631629_632349_+\|16S-rRNA-pseudouridine(516)-synthase	gnl\|CDD\|211327	cd02553, PseudoU_synth_RsuA, Pseudouridine synthase, Escherichia coli RsuA like. This group is comprised of eukaryotic and bacterial proteins similar to Escherichia coli RsuA. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi). No cofactors are required. E.coli RsuA makes psi516 in 16S RNA. Psi at this position is not generally conserved in other organisms.	1.20075e-86
NZ_CP018763.1\|WP_053906527.1\|629936_631619_+\|polysaccharide-biosynthesis-protein	gnl\|CDD\|240529	cd13124, MATE_SpoVB_like, Stage V sporulation protein B, also known as Stage III sporulation protein F, and related proteins. The integral membrane protein SpoVB has been implicated in the biosynthesis of the peptidoglycan component of the spore cortex in Bacillus subtilis. This model represents a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	1.76644e-140
NZ_CP018763.1\|WP_002830672.1\|626221_626857_-\|phosphatase-PAP2-family-protein	gnl\|CDD\|239486	cd03392, PAP2_like_2, PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase.	4.2342e-49
NZ_CP018763.1\|WP_002830670.1\|624117_625587_+\|MFS-transporter	gnl\|CDD\|341045	cd17502, MFS_Azr1_MDR_like, Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including various Saccharomyces cerevisiae proteins such as azole resistance protein 1 (Azr1p), vacuolar basic amino acid transporter 1 (Vba1p), vacuolar basic amino acid transporter 5 (Vba5p), and Sge1p (also known as Nor1p, 10-N-nonyl acridine orange resistance protein, and crystal violet resistance protein). MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.2669e-65
NZ_CP018763.1\|WP_075139769.1\|603882_604860_+\|GMP-reductase	gnl\|CDD\|235479	PRK05458, PRK05458, guanosine 5'-monophosphate oxidoreductase; Provisional.	0

>NZ_CP018763.1|WP_004166559.1|613248_614253_+|flippase-like-domain-containing-protein
MILAGLVIFGYSLRGVNLHQVSHDILNLNVGWLLVALLCIILYLGFEAVATKVLVESNGDRLSWKDAIRIPLIEQLFNGLTPFSSGGQPAQLVALMQSGIEGGRASSVLLMKFVVFQSMVVLNFIFSLLIGFQYLEDKIKFLSWFVLFGFLIHLAVIIGLLMIMYWHNFTKKMFDLIFIPIKRFTKPERYLRWKTSIDAKVDTFYLESVRMKSQWRLLAKVALLTFLQLLFYYLIPYFILLALGKTHVHLIMVTCLHVLIFMVISLFPIPGGAGGAEYGFSVIFAQFVGNSSKLVLAMIIWRLLTYYFGMFAGMFATVIKPNRINRIVPKKTSE
>NZ_CP018763.1|WP_075139770.1|612186_613203_+|glycosyltransferase-family-4-protein
MPIKVNMFSSASKVKGQGVGSAYEELIRLLKTHFPKEIDLSINRYTQADISHYHTIDPQFFASTFTKKRGVKVGYVHFLPETIEGSLKIPQPFRWLFYKYIIAFYKRMDQIVVVNPTFIDQLVKYGIKREIITYIPNFVRKDEFYQYDAEQRRQVRERLGVQDRFTILGIGQVQERKGVKDFIKLAQQHPEMYFIWAGGFSFGRLTDGYADLKKVVDNPPANLKFTGIVDRNKLVEYYNAADLFLLPSYNELFPMSVLEAFSCGTPVMLRDLDLYHSIIKGYYIAADNYAEMDQKLSALVKNPAQLRDYQQRADQASADYSEDHLAEIWLKYYSSLLK
>NZ_CP018763.1|WP_002829774.1|610968_612156_+|glycosyltransferase-family-4-protein
MNIGLFTDTYFPQVSGVATSIKTLRDQLEKQGHQVYIFTTTDPKVDTNVYERNVFRFTSIPFVSFTDRRIAISGFIRATQIAKELNLDIVHTQTEFSLGWMGKFVAKALKIPVIHTYHTMYEDYLHYVANGKLLKPYHVKQMTRAFCYHIDGIVAPSERVQRTIQRYGIQVPTRIIPTGVNLEQYQKDSNPQQCREALGYDAKTPVLLSLSRLAYEKNIQEVIDCFPAILKEVPDAQLLIVGDGPARTSLENQVHDLGLEKHVKFTGEINNDQVYRYYQAADLFVSASDSESQGLTYIEAMASHLKVVAKSGPYTDELLDDPSLGKVFDTEAQLVQAIKRYIEHPDEFNDPRPREKKLYEISADYFGKRIVDYYNSAISAHADLEHGSKKESELE
>NZ_CP018763.1|WP_070366758.1|610109_610883_+|alpha/beta-hydrolase
MEFILKTGETIYYEDQGEGIPILFLTGFGGNTEIWSGQVNFFLQHGYRVIRLDYLNHGRSDRVDYDLKIGDLADEVLQLVDALEIKEPIGIGNSMGAAVLWNILSIRSWDFVSKAIFVDQSPRMMNDDQWHYGFKNLSEANFEQLMSEPILRPAYRRIEGYVYKNSKAIDSKYPFSQPKNRSLVKGHARKDWRPVLRAATKPVLFILGEKSPFFNPQMGDALKQLNSRIQVEVMPNVGHIPMAEEPAQFNQLVLRFL
>NZ_CP018763.1|WP_008842201.1|608312_610037_+|phosphoenolpyruvate--protein-phosphotransferase
MTGTLKGIAASDGIAIAKAYLMVDPDLSFEKKTITDVDAEINRLHDALEQSKKELTLIKAKAAENLGAEEAEVFEAHLTILSDPELIGNIEDKIKNDTINAEEATKEVTDNFIAMFEAMTDNAYMQERAADIRDVTKRLMSHLLGVELPNPALIDSEVIIVAHDLTPSDTAQLDRRYVKGFITDIGGRTSHSAIMSRTLEIPAVVGSEKATTSVKQGDMMIVDGLTGDALINPSDDEIKEYEQKSADFKAQKAEWEKLKNERTVSKDGVHFDLAANVGTPDDLQGVLDNGGEAVGLFRSEFLYMNASELPSEDQQFEAYKKVVEGMNGKQVVVRTMDIGGDKDLPYLPLPEEMNPFLGYRAIRISLDRTDLFRTQLRALLRASAYGKLAIMFPMIATVAEFKKARAIYDDERQKMIDAGTKVGEIQVGMMMEIPAAAMIADKLAKYVDFFSIGTNDLIQYSFAADRGNEKVSYLYQPYNPSLLRLIKQTIDASHAEGKWTGMCGEMAGDQIAVPILMGLGLDEFSMSATSILKTRSLMKKLSTDDMKKLAEKAITEAETNEDVIKLVEETVNNK
>NZ_CP018763.1|WP_002829779.1|608046_608313_+|phosphocarrier-protein-HPr
MEKRDFHVIAETGIHARPATLLVQAASKFNSDIQLTYKDKSVNLKSIMGVMSLGVGQGADVTISADGDDEADAIAALEDTMKKEGLSE
>NZ_CP018763.1|WP_008842200.1|607715_607904_+|hypothetical-protein
MRDYLKLLNDLKDGVLDELTITAEEFQDFQPVFMDFPERKQLIGEAQRGGTITYRYENNKKQ
>NZ_CP018763.1|WP_002829782.1|605292_607500_-|ATP-dependent-Clp-protease-ATP-binding-subunit
MLCQNCHKNEATIHLYTNVNGRRTEVNLCQNCYQLLKNQQLNNNNGNGGARMAQDPFGFGNLDDIFRAMQGGNVSRPEDMYGQQVPPTQAGRGGGNNPNGGNGSSLLGQYGLNLTDLAKQGKIDPVIGRDKEIERVIEILNRRTKNNPVLIGEAGVGKTAVVEGLAQRIVEGSVPQKLLNKQIIRLDVVSLVQGTGIRGQFEQRMQELMKEVQNNPDLIVFIDEIHEIVGAGNAEGGMDAGNVLKPALARGDFQLVGATTLKEFRDIEKDAALARRLQPVQVDEPSEEEAIKILKGIQKKYEDYHHVHYTDDAIVAAVKLSKRYIQDRYLPDKAIDLLDEAGSKKNLTINVADPETIQKKIDEAEAEKKKALESEDYEKAAYYRDQVSKLEKNKDGATNKEDEPTITAEDMEKIIESKTDIPVGDLQKQEQEQLQNLASNLKAHVIGQDEAVDKISRAIRRNRIGLNGTGRPIGSFLFVGPTGVGKTELAKQLADQLFGSKDAMIRFDMSEYMEPHSISKLIGSPPGYVGYEEAGQLTEQVRRHPYSLILLDEVEKAHPDVMHMFLQILDDGRLTDSQGRTVSFKDTIIIMTSNAGSGDVEADVGFGAAMQGKTHSVLDKLGNYFKPEFLNRFDDIVEFHALTKDNLMQIVDLMIADVNKMLATQGLHVNVTKPVEERLVELGYDPKMGARPLRRVIQEQIEDRIADFYLDHPSEKQLIARIKDDKIEVAPDDKK
>NZ_CP018763.1|WP_075139769.1|603882_604860_+|GMP-reductase
MKVFDYEDIQLIPAKCVVRSRSECDPTVELGKHTFKLPVVPANMQTIINEEIAEKLAADGYFYIMHRFEPETRLAFVKKMKAKGLISSISVGVKDGEYDFIDELAAKNLVPDYITIDVAHGHAQTVIDMIHYIKEKLPESFVIAGNVGTPEGVRELESAGADATKIGIGPGKVCITKLKTGFGTGGWQLSALRWCAKVARKPLIADGGIRNHGDIAKSIRFGATMVMIGSLFAGHIESPGETKAEDGVTYKEYFGSASQYQKGEAKNVEGKKIWIHQRGHLADTLKAMREDLQSAISYAGGRDLESIRKVDYVIVKNSIFNGDIL
>NZ_CP018763.1|WP_002829785.1|602997_603252_+|hypothetical-protein
MSKNLKIDLNTDELIGSREASLMWGKQKDYVRTIYNKYPERFPTGTIRKFGKQLIVTREGMESVTGIKYEDLDKKNIEKAKLPR
>NZ_CP018763.1|WP_005919149.1|621848_622580_-|hypothetical-protein
MNKIKIPKINYHVDRKSYLPAILAVILTSTIWYFSGHFSSEPFKHNLTVQIIFFLASFMANFITFDQLTNKTNLRLIAPLAVIPVAFFIILLVSKERYVSLLGLLTLVPFVSVFLPFQGKNGVGLISFAFSISVLSPIAFFYIRNAFVSSMFLKTCLLLCLVFLMILFSVFVAHPEQFIYLEIGLLVVITIFGFVLFKQWSAVLYPMIGILGWYLPRVKLPRNFILLVLIILICVTFLFTAGH
>NZ_CP018763.1|WP_002830669.1|622751_623942_+|methionine-adenosyltransferase
MSERHLFTSESVSEGHPDKIADQISDAILDELLKNDPDARVACETTVTTGLVVVVGEISTTAYIDIQKVVRKTIKDIGYVGGEYGFDGENCAVIVAIDEQSPDIAQGVDDSLETREGHEDRLNRIGAGDQGLMFGYATDETKELMPLPIMLSHHLMQRIAKLRKEQVISYLRPDAKAEVTVEYDDNDQPVRVDTVVLSTQHDPDVTLEQIRKDVIEKVIKEVIPAELLDEKTNFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGAAHHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGLAKKAEVQIAYAIGVAEPVSVMVDTFGTGKVSEEALTKAVRQIFDLRPAGIIEMLDLKRPIYKQTAAYGHFGRTDVDLPWEKTDKVAELKAFFQK
>NZ_CP018763.1|WP_002830670.1|624117_625587_+|MFS-transporter
MKKKQTNVALVTVAIFVATFMSAIEGTIVSTAMPTIVGDLHGVNLMNWVISIFLLTNAIFTPIYGKLSDIFGRKRVFIIGIIIFLIGSMLSGLAHSMTTLIIWRALQGIGAGSIMPVSNTIIADIYSLEKRAKVMGLNGSAWGIASIIAPLLGGFIVDNLSWHWIFFINVPIGIITIILIQLYLKEEVSVHRKKIDYWGSVWLMLSLLGLMYGFQLLGESTASKLILGLSFIIFVVAGALFIRQERRAEDPIIFLDLFNDRTFVIQNVATMLVSGLLIGFEVYLPTWTQGILGLPASLAGFAVTPSSVLWIFGSFLAGKMLVKLKANQILRISLTILAIGSFLLAVIPASTPFVAFFFIAAILGVGFGITITSTLVISQQLVSKDRIGVATSFNTLAKTLGQTIMMSVFGIIMNGTINMGIAHHPRINMTMMNQVINPQTAKQLPADLLPTLRDILYSALHNIYICGFILIIVAIVINAFSRPRTQKNK
>NZ_CP018763.1|WP_075139771.1|625665_626229_-|methyltransferase-domain-containing-protein
MLDNAMQYSHRLLAEVVQPGDHVVDATMGNGHDTLFLANLVQSQGRVFSFDIQAAALSATEARLEKQLPDHQHVQLIQDSHDQLAQYVDTPISGAVFNLGYLPGGDKQIITHSASTIAAVQQCLQLLKVGGRVVLVCYYGHPGGAAELAKLLEFTANLDQHQFTCLRYEFINQVHQPPILLAIERRK
>NZ_CP018763.1|WP_002830672.1|626221_626857_-|phosphatase-PAP2-family-protein
MRFKKFGWLILNWLPLLGLLTLVISVSNRWNWVHTYDRYLQKIIHGWQSPGLTPLVKIYTQLGNAKPFIFISIVILGMLLWRGYDRLAAFFLANVVLGNAINHLIKLWIQRPRPHFRLITIGGYSFPSGHSVAAMLLFGSLIFITTQTVRSPKWRISWILTCIILMLLLGLSRVYLNVHYPSDVTAGLLLGLVILQTTHWIFYRKKESQHA
>NZ_CP018763.1|WP_075139772.1|627262_629680_+|leucine--tRNA-ligase
MAYNHKEIEPKWQRYWQKHETFKTVESEQKPKYYALDMFPYPSGQGLHVGHPEGYTATDIMSRMKRMQGYKVLHPMGWDAFGLPAEQYAMKTGNNPKDFTAHNIKNFKRQIQSLGFSYDWSREVNTTDPEYYKWTQWIFEQLYKKGLAYEKETLVNWAPDLMGGTVVANEEVVNGKTERGGFPVYRKPMKQWILKITAYADRLIDDLDLVDWPDSIKEMQKNWIGRSIGASVFFDVEDSDQKIEIFTTRADTLYGATYLVISPEHPLVDQLTTLESKAAVEEYKQAVATKSDLERTDLNKDKTGVFTGSYAVNPVNGKKIPIWIADYVLASYGTGAVMAVPAHDPRDYEFAKKFKIDIVPVIEGGNLDEEAYTGDGPHINSGFLDGLNKQEAIDKMLDWLEEHGAGHKKVNYRLRDWVFSRQRYWGEPIPVIHWEDGEITLVPEDELPLRLPATDNIKPSGTGESPLANLEDWLNVVDENGRKGRRETNTMPQWAGSSWYFLRYVDPKNQNKIADEDLLKEWLPVDLYVGGAEHAVLHLLYARFWHKVLYDLGVVPTKEPFQKLVNQGMILGSNHEKMSKSKGNVVNPDDIVERFGADTLRLYEMFMGPLTESVAWSEEGLNGSRKWIERVWRLMIDDNNHLRDRITMINDHKLDLIYNQTVKKVTEDYENMRFNTAISQMMVFVNEAYKADALPMVYMEGLVKLLSPIIPHVAEEIWQIMGHDETITYETWPTYDESKLVQDTVQVILQVNGKVRSKVEVEKDLDQAELEKIALADERIQQWTAEKDIKKVIVIPNKIVNIVAK
>NZ_CP018763.1|WP_053906527.1|629936_631619_+|polysaccharide-biosynthesis-protein
MDKPSEFDTAESQYLGSQPLRENSGNSSSKAKMLEGSAWMTAGSIFSRILGAIYIIPWVIWFGVYSDQANALYTKGYNIYSFFLIAAIAGIPSAISKQVAHYNAINEFALGQRLYKRGLLLSVGTGVVCAAILFFGAPFLNDGDPNVTTVLHALAWAVLVIPTMSLTRGFFQGYQEMGPSAVSQFIEQLARVAYMLVTAYLIMYKNHGDWVYGVAQSTFAAFIGALGGLLVLIGYFVKYRRRLRYLSQHSVNGLAISTTSLYKEIIAQAVPFIIIGSAITIFQLIDQYTFFRIMRSVSDYSATVLNNMFAIFAFNANKLVMIVISLASALAVTSVPILSEAKTRGDRAEISRQVADSILLFAFLMIPSALGMAAVAQPAYTLFYHLSDVGTAILQFNSYVAIVLGLFTVISAVMQGIGENVLAVKYFVVGMLVKFIFQFPMVAIFSAVGSLISTAIGFAVVNWLILRHINREYGLDYDKINGFIGKIITYSFGTFFIAFVVTNGLYLVMNPANKVQALIVILVAATLGGLFYVVCVLKSRLADEIIGGRAAGLRRMLKIK
>NZ_CP018763.1|WP_005919135.1|631629_632349_+|16S-rRNA-pseudouridine(516)-synthase
MRVDKFLHDMNVGTRSQIRKLIKEKAVFVNDVVAKSGRVKVDPVVDQVRLGEQVITYQQYFYFMMNKPLGVVTATEDRKQKTVMDLFNKVDFRKDLFPVGRLDKDTEGLLLITNNGPLAHQLLAPERHVQKTYEAVVTGQITDPAVKQFADGMVLKDGTQLKPADLTILNYSALDEQTLVHVTLKEGKYHQVRRMFGSLGERVVSLKRISFGPLQLEEGLLPGTYRELSDEEIEKLKTE
>NZ_CP018763.1|WP_075139773.1|632454_633285_-|NAD(P)H-hydrate-dehydratase
MLKINRQTLKSHWPVRQKQSHKGTYGHLLLIAGNAQYGGAGILAASAAVYAGGGLVTLATAKNNFTAVRATLAEIMLIDFTDFDQLSQSLANATGVVIGPGLGTDSTSLAVLNFTMAHIAEGVPLIIDGSAIDLVAQHDLQVSHHPTIYTPHQMEWQRLSGIKIADQSVERNQAVVDQLNATVVLKHYHTEIYAPAAPVAQIMAGNPGMATGGSGDSLTGILLALIAQANSVNEGVRLGTFLHSYTADLIYEHEAVVLPHRLIRRLPAVLKQLTQP
>NZ_CP018763.1|WP_005919128.1|633410_633872_+|universal-stress-protein
MDYKKILFGYDGSPESMAAFNRAVEIAKSNHAKLIIASVMKKQHANTASVSLGFGVIETGIDLQDTLDQWKTTLEKLKQDAQQQGLPAEDIEVVFKQGSPKSMLSYTLPKEYDVDLIVLGATGMGTVAQVILGSTASYVVENAAPDVVIVKNN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP018763_2	2.1\|548425\|29\|NZ_CP018763\|CRISPRCasFinder	548425-548453	29	NZ_CP039931	Acinetobacter baumannii strain TG29392 plasmid pTG29392_1, complete sequence	29087-29115	5	0.828
NZ_CP018763_1	1.2\|429873\|30\|NZ_CP018763\|CRISPRCasFinder,CRT	429873-429902	30	NC_014633	Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence	577858-577887	6	0.8
NZ_CP018763_1	1.2\|429873\|30\|NZ_CP018763\|CRISPRCasFinder,CRT	429873-429902	30	NZ_LR214986	Mycoplasma cynos strain NCTC10142 plasmid 13	134-163	6	0.8
NZ_CP018763_1	1.15\|430731\|30\|NZ_CP018763\|CRISPRCasFinder,CRT,PILER-CR	430731-430760	30	NC_041977	Citrobacter phage Mordin, complete genome	56087-56116	6	0.8
NZ_CP018763_1	1.15\|430731\|30\|NZ_CP018763\|CRISPRCasFinder,CRT,PILER-CR	430731-430760	30	NC_028247	Citrobacter phage Michonne, complete genome	35423-35452	6	0.8
NZ_CP018763_1	1.15\|430731\|30\|NZ_CP018763\|CRISPRCasFinder,CRT,PILER-CR	430731-430760	30	MH920362	Citrobacter phage Maleficent, complete genome	35459-35488	6	0.8
NZ_CP018763_1	1.16\|430797\|30\|NZ_CP018763\|CRISPRCasFinder,CRT,PILER-CR	430797-430826	30	MN434096	Klebsiella phage JIPh_Kp127, complete genome	30153-30182	6	0.8
NZ_CP018763_2	2.1\|548425\|29\|NZ_CP018763\|CRISPRCasFinder	548425-548453	29	MH616660	Microviridae sp. isolate ctbb538, complete genome	5069-5097	6	0.793
NZ_CP018763_2	2.1\|548425\|29\|NZ_CP018763\|CRISPRCasFinder	548425-548453	29	MT438761	Listeria virus P61, complete genome	70188-70216	6	0.793
NZ_CP018763_2	2.1\|548425\|29\|NZ_CP018763\|CRISPRCasFinder	548425-548453	29	DQ003638	Listeria phage A511, complete genome	58978-59006	6	0.793
NZ_CP018763_1	1.6\|430137\|30\|NZ_CP018763\|CRISPRCasFinder,CRT	430137-430166	30	NC_048164	Escherichia phage HZP2, partial genome	3710-3739	7	0.767
NZ_CP018763_1	1.6\|430137\|30\|NZ_CP018763\|CRISPRCasFinder,CRT	430137-430166	30	MG832642	Escherichia phage HZ2R8, complete genome	3203-3232	7	0.767
NZ_CP018763_1	1.15\|430731\|30\|NZ_CP018763\|CRISPRCasFinder,CRT,PILER-CR	430731-430760	30	NC_023284	Streptomyces sp. F2 plasmid pFRL4, complete sequence	260381-260410	7	0.767
NZ_CP018763_1	1.15\|430731\|30\|NZ_CP018763\|CRISPRCasFinder,CRT,PILER-CR	430731-430760	30	KM236239	Citrobacter phage Moogle, complete genome	37007-37036	7	0.767
NZ_CP018763_1	1.15\|430731\|30\|NZ_CP018763\|CRISPRCasFinder,CRT,PILER-CR	430731-430760	30	KY654690	Citrobacter phage Mijalis, complete genome	37007-37036	7	0.767
NZ_CP018763_1	1.15\|430731\|30\|NZ_CP018763\|CRISPRCasFinder,CRT,PILER-CR	430731-430760	30	NZ_CP045299	Kosakonia arachidis strain KACC 18508 plasmid unnamed1, complete sequence	29151-29180	7	0.767
NZ_CP018763_1	1.15\|430731\|30\|NZ_CP018763\|CRISPRCasFinder,CRT,PILER-CR	430731-430760	30	NZ_CP040393	Kosakonia radicincitans strain DSM 107547 plasmid pKrDSM107547, complete sequence	11244-11273	7	0.767
NZ_CP018763_1	1.17\|430863\|30\|NZ_CP018763\|CRISPRCasFinder,CRT,PILER-CR	430863-430892	30	NZ_CP040452	Halomonas sp. PA16-9 plasmid p_unnamed1, complete sequence	1010140-1010169	7	0.767
NZ_CP018763_1	1.22\|431193\|30\|NZ_CP018763\|CRISPRCasFinder,CRT	431193-431222	30	NZ_CP018468	Xanthomonas vesicatoria strain LM159 plasmid pLM159.1, complete sequence	1396-1425	7	0.767
NZ_CP018763_2	2.1\|548425\|29\|NZ_CP018763\|CRISPRCasFinder	548425-548453	29	AP014314	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S31-C24, * SEQUENCING IN PROGRESS *	32202-32230	7	0.759
NZ_CP018763_2	2.1\|548425\|29\|NZ_CP018763\|CRISPRCasFinder	548425-548453	29	JQ182728	Enterobacteria phage mEp460, complete genome	22866-22894	7	0.759
NZ_CP018763_1	1.3\|429939\|30\|NZ_CP018763\|CRISPRCasFinder,CRT	429939-429968	30	MN855619	Siphoviridae sp. isolate 157, complete genome	12798-12827	8	0.733
NZ_CP018763_1	1.6\|430137\|30\|NZ_CP018763\|CRISPRCasFinder,CRT	430137-430166	30	MN481366	Escherichia phage vB_EcoP_PHB20, complete genome	38421-38450	8	0.733
NZ_CP018763_1	1.6\|430137\|30\|NZ_CP018763\|CRISPRCasFinder,CRT	430137-430166	30	NC_027387	Escherichia phage CICC 80001, complete genome	4740-4769	8	0.733
NZ_CP018763_1	1.6\|430137\|30\|NZ_CP018763\|CRISPRCasFinder,CRT	430137-430166	30	NC_048082	Enterobacteria phage vB_EcoP_IME390, complete genome	37567-37596	8	0.733
NZ_CP018763_1	1.13\|430599\|30\|NZ_CP018763\|CRISPRCasFinder,CRT	430599-430628	30	NZ_CP020399	Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence	148044-148073	8	0.733
NZ_CP018763_1	1.15\|430731\|30\|NZ_CP018763\|CRISPRCasFinder,CRT,PILER-CR	430731-430760	30	NZ_CP047963	Aeromonas media strain MC64 plasmid pMC64A, complete sequence	177875-177904	8	0.733
NZ_CP018763_1	1.15\|430731\|30\|NZ_CP018763\|CRISPRCasFinder,CRT,PILER-CR	430731-430760	30	MN693318	Marine virus AFVG_25M474, complete genome	30965-30994	8	0.733
NZ_CP018763_2	2.1\|548425\|29\|NZ_CP018763\|CRISPRCasFinder	548425-548453	29	NZ_CP020504	Serratia marcescens strain 95 plasmid unnamed3, complete sequence	7793-7821	8	0.724
NZ_CP018763_2	2.1\|548425\|29\|NZ_CP018763\|CRISPRCasFinder	548425-548453	29	NZ_CP026402	Escherichia coli strain ECONIH4 plasmid pECO-e618, complete sequence	7965-7993	8	0.724
NZ_CP018763_1	1.2\|429873\|30\|NZ_CP018763\|CRISPRCasFinder,CRT	429873-429902	30	GU075905	Prochlorococcus phage P-HM2, complete genome	98383-98412	9	0.7
NZ_CP018763_1	1.14\|430665\|30\|NZ_CP018763\|CRISPRCasFinder,CRT,PILER-CR	430665-430694	30	NZ_CP041424	Escherichia coli strain STEC409 plasmid pSTEC409_2, complete sequence	39226-39255	9	0.7
NZ_CP018763_1	1.22\|431193\|30\|NZ_CP018763\|CRISPRCasFinder,CRT	431193-431222	30	NC_010310	Acinetobacter venetianus strain VE-C3 plasmid pAV2, complete sequence	4286-4315	9	0.7

1. spacer 2.1|548425|29|NZ_CP018763|CRISPRCasFinder matches to NZ_CP039931 (Acinetobacter baumannii strain TG29392 plasmid pTG29392_1, complete sequence) position: , mismatch: 5, identity: 0.828

agagcaaagtaagcgaaaaacaaaaacaa	CRISPR spacer
agcaaaaagtaagcaaaatacaaaaacaa	Protospacer
** . *********.*** **********

2. spacer 1.2|429873|30|NZ_CP018763|CRISPRCasFinder,CRT matches to NC_014633 (Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence) position: , mismatch: 6, identity: 0.8

caaaaaaagttattattcctgcattgaaag	CRISPR spacer
caaacaaatttattattcctgcatttgtaa	Protospacer
**** *** **************** . *.

3. spacer 1.2|429873|30|NZ_CP018763|CRISPRCasFinder,CRT matches to NZ_LR214986 (Mycoplasma cynos strain NCTC10142 plasmid 13) position: , mismatch: 6, identity: 0.8

caaaaaaagttattattcctgcattgaaag	CRISPR spacer
gaaaaaaagttattattacttcattgttat	Protospacer
 **************** ** *****  *

4. spacer 1.15|430731|30|NZ_CP018763|CRISPRCasFinder,CRT,PILER-CR matches to NC_041977 (Citrobacter phage Mordin, complete genome) position: , mismatch: 6, identity: 0.8

taccagcccactgtccagcagcaccacctg	CRISPR spacer
caccagcccactgaccagcagcacctacat	Protospacer
.************ ***********  *

5. spacer 1.15|430731|30|NZ_CP018763|CRISPRCasFinder,CRT,PILER-CR matches to NC_028247 (Citrobacter phage Michonne, complete genome) position: , mismatch: 6, identity: 0.8

taccagcccactgtccagcagcaccacctg	CRISPR spacer
caccagcccactgaccagcagcacctacat	Protospacer
.************ ***********  *

6. spacer 1.15|430731|30|NZ_CP018763|CRISPRCasFinder,CRT,PILER-CR matches to MH920362 (Citrobacter phage Maleficent, complete genome) position: , mismatch: 6, identity: 0.8

taccagcccactgtccagcagcaccacctg	CRISPR spacer
caccagcccactgaccagcagcacctacat	Protospacer
.************ ***********  *

7. spacer 1.16|430797|30|NZ_CP018763|CRISPRCasFinder,CRT,PILER-CR matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 6, identity: 0.8

cccaaggatatcgtttgacaaatagttttt	CRISPR spacer
caccggcatatcgtttggcaaatacttttt	Protospacer
* * .* **********.****** *****

8. spacer 2.1|548425|29|NZ_CP018763|CRISPRCasFinder matches to MH616660 (Microviridae sp. isolate ctbb538, complete genome) position: , mismatch: 6, identity: 0.793

agagcaaagtaagcgaaaaacaaaaacaa	CRISPR spacer
gcgaccaagtaagcgaacaacaaaaacaa	Protospacer
. ..* *********** ***********

9. spacer 2.1|548425|29|NZ_CP018763|CRISPRCasFinder matches to MT438761 (Listeria virus P61, complete genome) position: , mismatch: 6, identity: 0.793

agagcaaagtaagcgaaaaacaaaaacaa	CRISPR spacer
tgtggaaagtaaggaaaaaacaaaaacag	Protospacer
 * * ******** .*************.

10. spacer 2.1|548425|29|NZ_CP018763|CRISPRCasFinder matches to DQ003638 (Listeria phage A511, complete genome) position: , mismatch: 6, identity: 0.793

agagcaaagtaagcgaaaaacaaaaacaa	CRISPR spacer
tgtggaaagtaaggaaaaaacaaaaacag	Protospacer
 * * ******** .*************.

11. spacer 1.6|430137|30|NZ_CP018763|CRISPRCasFinder,CRT matches to NC_048164 (Escherichia phage HZP2, partial genome) position: , mismatch: 7, identity: 0.767

tggctgaacgtaaggctatagagaatcgac	CRISPR spacer
gcgaggaacgtaaggctatagtgattcgaa	Protospacer
  *  **************** ** ****

12. spacer 1.6|430137|30|NZ_CP018763|CRISPRCasFinder,CRT matches to MG832642 (Escherichia phage HZ2R8, complete genome) position: , mismatch: 7, identity: 0.767

tggctgaacgtaaggctatagagaatcgac	CRISPR spacer
gcgaggaacgtaaggctatagtgattcgaa	Protospacer
  *  **************** ** ****

13. spacer 1.15|430731|30|NZ_CP018763|CRISPRCasFinder,CRT,PILER-CR matches to NC_023284 (Streptomyces sp. F2 plasmid pFRL4, complete sequence) position: , mismatch: 7, identity: 0.767

taccagcccactgtccagcagcaccacctg	CRISPR spacer
gctcgccccaccgtccagcagcacctcctg	Protospacer
  .*. *****.************* ****

14. spacer 1.15|430731|30|NZ_CP018763|CRISPRCasFinder,CRT,PILER-CR matches to KM236239 (Citrobacter phage Moogle, complete genome) position: , mismatch: 7, identity: 0.767

taccagcccactgtccagcagcaccacctg	CRISPR spacer
caccagcccattgaccagcagcaccgacat	Protospacer
.*********.** ***********. *

15. spacer 1.15|430731|30|NZ_CP018763|CRISPRCasFinder,CRT,PILER-CR matches to KY654690 (Citrobacter phage Mijalis, complete genome) position: , mismatch: 7, identity: 0.767

taccagcccactgtccagcagcaccacctg	CRISPR spacer
caccagcccattgaccagcagcaccgacat	Protospacer
.*********.** ***********. *

16. spacer 1.15|430731|30|NZ_CP018763|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP045299 (Kosakonia arachidis strain KACC 18508 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

taccagcccactgtccagcagcaccacctg	CRISPR spacer
taccagcccactgttcagcagagcatgatg	Protospacer
**************.****** .*    **

17. spacer 1.15|430731|30|NZ_CP018763|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP040393 (Kosakonia radicincitans strain DSM 107547 plasmid pKrDSM107547, complete sequence) position: , mismatch: 7, identity: 0.767

taccagcccactgtccagcagcaccacctg	CRISPR spacer
taccagcccactgttcagcagggcatgatg	Protospacer
**************.****** .*    **

18. spacer 1.17|430863|30|NZ_CP018763|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP040452 (Halomonas sp. PA16-9 plasmid p_unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

aaggataataacgctgcctttgtctatgac	CRISPR spacer
aacgacaataacgctgcctttgtggaagcg	Protospacer
** **.*****************  * *

19. spacer 1.22|431193|30|NZ_CP018763|CRISPRCasFinder,CRT matches to NZ_CP018468 (Xanthomonas vesicatoria strain LM159 plasmid pLM159.1, complete sequence) position: , mismatch: 7, identity: 0.767

agtctata---aagtgattgatcaccgcaccga	CRISPR spacer
---ctgtgctcaagggattgatcaccgcaccgg	Protospacer
   **.*.   *** *****************.

20. spacer 2.1|548425|29|NZ_CP018763|CRISPRCasFinder matches to AP014314 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S31-C24, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.759

agagcaaagtaagcgaaaaacaaaaacaa	CRISPR spacer
gagcaaaagtaagcgaaaaagaaaatcaa	Protospacer
...  *************** **** ***

21. spacer 2.1|548425|29|NZ_CP018763|CRISPRCasFinder matches to JQ182728 (Enterobacteria phage mEp460, complete genome) position: , mismatch: 7, identity: 0.759

agagcaaagtaagcgaaaaacaaaaacaa	CRISPR spacer
aacacaatgtaagcgaaaaagaaaaaccg	Protospacer
*. .*** ************ ****** .

22. spacer 1.3|429939|30|NZ_CP018763|CRISPRCasFinder,CRT matches to MN855619 (Siphoviridae sp. isolate 157, complete genome) position: , mismatch: 8, identity: 0.733

ttaccgttttgtttagacttgaaaacttta	CRISPR spacer
cgtccgttttgtttaaacttgtaaacgtgc	Protospacer
.  ************.***** **** *

23. spacer 1.6|430137|30|NZ_CP018763|CRISPRCasFinder,CRT matches to MN481366 (Escherichia phage vB_EcoP_PHB20, complete genome) position: , mismatch: 8, identity: 0.733

tggctgaacgtaaggctatagagaatcgac	CRISPR spacer
gcgaggaacgtaaggctatagtgattcgta	Protospacer
  *  **************** ** ***

24. spacer 1.6|430137|30|NZ_CP018763|CRISPRCasFinder,CRT matches to NC_027387 (Escherichia phage CICC 80001, complete genome) position: , mismatch: 8, identity: 0.733

tggctgaacgtaaggctatagagaatcgac	CRISPR spacer
gcgaggaacgtaaggctatagtgattcgta	Protospacer
  *  **************** ** ***

25. spacer 1.6|430137|30|NZ_CP018763|CRISPRCasFinder,CRT matches to NC_048082 (Enterobacteria phage vB_EcoP_IME390, complete genome) position: , mismatch: 8, identity: 0.733

tggctgaacgtaaggctatagagaatcgac	CRISPR spacer
gcgaggaacgtaaggctatagtgattcgta	Protospacer
  *  **************** ** ***

26. spacer 1.13|430599|30|NZ_CP018763|CRISPRCasFinder,CRT matches to NZ_CP020399 (Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

tcccaattgccgcttgcgcagcgtgacgag	CRISPR spacer
agccgcgtgccgcttgcgcagcgcgacgtc	Protospacer
  **.  ****************.****

27. spacer 1.15|430731|30|NZ_CP018763|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP047963 (Aeromonas media strain MC64 plasmid pMC64A, complete sequence) position: , mismatch: 8, identity: 0.733

taccagcccactgtccagcagcaccacctg	CRISPR spacer
ggacagcccactccccagcagcaccagaag	Protospacer
 . ********* .************   *

28. spacer 1.15|430731|30|NZ_CP018763|CRISPRCasFinder,CRT,PILER-CR matches to MN693318 (Marine virus AFVG_25M474, complete genome) position: , mismatch: 8, identity: 0.733

taccagcccactgtccagcagcaccacctg	CRISPR spacer
gcgcactccactgtccagcagcgccaccct	Protospacer
   ** .***************.*****.

29. spacer 2.1|548425|29|NZ_CP018763|CRISPRCasFinder matches to NZ_CP020504 (Serratia marcescens strain 95 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.724

agagcaaagtaagcgaaaaacaaaaacaa	CRISPR spacer
tgagcaaagaaagcgaaaaacacgttgat	Protospacer
 ******** ************ .   *

30. spacer 2.1|548425|29|NZ_CP018763|CRISPRCasFinder matches to NZ_CP026402 (Escherichia coli strain ECONIH4 plasmid pECO-e618, complete sequence) position: , mismatch: 8, identity: 0.724

agagcaaagtaagcgaaaaacaaaaacaa	CRISPR spacer
tgagcaaagaaagcgaaaaacacgttgat	Protospacer
 ******** ************ .   *

31. spacer 1.2|429873|30|NZ_CP018763|CRISPRCasFinder,CRT matches to GU075905 (Prochlorococcus phage P-HM2, complete genome) position: , mismatch: 9, identity: 0.7

caaaaaaagttattattcctgcattgaaag	CRISPR spacer
gtgaaaaagttattactcctgcatatgact	Protospacer
  .************.********  .*

32. spacer 1.14|430665|30|NZ_CP018763|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP041424 (Escherichia coli strain STEC409 plasmid pSTEC409_2, complete sequence) position: , mismatch: 9, identity: 0.7

ggccatttgccgagattagaaatgcggtta	CRISPR spacer
gttttgccaccgagattaaaaatgcggtta	Protospacer
* ..  ...*********.***********

33. spacer 1.22|431193|30|NZ_CP018763|CRISPRCasFinder,CRT matches to NC_010310 (Acinetobacter venetianus strain VE-C3 plasmid pAV2, complete sequence) position: , mismatch: 9, identity: 0.7

agtctataaagtgattgatcaccgcaccga	CRISPR spacer
taaacataaactgattgatcactgcaccat	Protospacer
 .  .***** ***********.*****.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

514066 : 523550

Enterococcus_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075139720.1\|514066_515494_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	1.7e-11	26.7
WP_024862546.1\|515504_516080_-	ABC transporter permease	NA	NA	NA	NA
WP_024862545.1\|516528_517269_+	glucose 1-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	8.3e-18	32.3
WP_063504644.1\|517791_519942_+	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.5e-256	59.9
WP_024862543.1\|519952_520540_+	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	3.5e-51	56.9
WP_024862542.1\|520554_521331_+	Fe-S cluster assembly ATPase SufC	A0A285PWH2	Cedratvirus	2.4e-07	24.6
WP_075139721.1\|521311_522373_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_128688344.1\|522320_523550_+	cysteine desulfurase	Q2XUY6	environmental_halophage	1.0e-81	40.6

DBSCAN-SWA_2

535548 : 585687

Escherichia_phage(20.0%)

protease,integrase,transposase

attL 533832:533854|attR 554439:554461

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
533832:533854	attL	NA	NA	NA	NA
WP_024862535.1\|535548_536469_-\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	7.1e-51	38.2
WP_075139726.1\|536821_538486_-	glycosyltransferase family 8 protein	NA	NA	NA	NA
WP_075139727.1\|538707_539637_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	6.5e-20	29.9
WP_126130462.1\|539614_540553_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_008842402.1\|542308_543643_-	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	2.2e-29	27.2
WP_005919347.1\|543795_544326_-	MFS transporter	NA	NA	NA	NA
WP_075139729.1\|544340_544574_-	hypothetical protein	NA	NA	NA	NA
WP_075139730.1\|545171_545819_+	Mg2+ and Co2+ transporter	NA	NA	NA	NA
WP_075139731.1\|545848_546121_+	magnesium transporter CorA	NA	NA	NA	NA
WP_081372606.1\|546036_546567_-	recombinase family protein	A0A0A8WIK3	Clostridium_phage	1.9e-16	39.4
WP_075139732.1\|546536_547130_+	AlwI family type II restriction endonuclease	NA	NA	NA	NA
WP_075139733.1\|549815_551423_-	AAA family ATPase	NA	NA	NA	NA
WP_075140322.1\|551722_552160_-	hypothetical protein	NA	NA	NA	NA
WP_075139734.1\|552302_552533_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_075139735.1\|553067_554222_+\|integrase	site-specific integrase	P97010	Streptococcus_pyogenes_phage	8.9e-59	36.6
WP_008842435.1\|555114_555927_+	LicD family protein	A0A1V0SD50	Indivirus	7.7e-09	53.4
554439:554461	attR	NA	NA	NA	NA
WP_081041632.1\|555951_556752_+	DUF1211 domain-containing protein	NA	NA	NA	NA
WP_008842437.1\|557113_557713_+	chitin-binding protein	A0A0K1Y848	Apis_mellifera_filamentous_virus	2.6e-14	29.9
WP_002829841.1\|558049_558274_-	CsbD family protein	NA	NA	NA	NA
WP_058120754.1\|558668_559463_+	hydroxyethylthiazole kinase	NA	NA	NA	NA
WP_058120753.1\|559459_560290_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_075139736.1\|560279_560960_+	thiamine phosphate synthase	NA	NA	NA	NA
WP_008842259.1\|560941_561619_+	thiaminase II	NA	NA	NA	NA
WP_155569851.1\|561660_561810_-	hypothetical protein	NA	NA	NA	NA
WP_075139737.1\|561985_562168_-	hypothetical protein	NA	NA	NA	NA
WP_053905833.1\|562371_564126_+	DNA helicase RecQ	A0A2K9L3P7	Tupanvirus	4.3e-73	37.0
WP_005917527.1\|564262_564976_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_075139738.1\|565302_566424_+	serine hydrolase	NA	NA	NA	NA
WP_075139739.1\|566439_567219_+	chain-length determining protein	NA	NA	NA	NA
WP_075139740.1\|567228_567975_+	CpsD/CapB family tyrosine-protein kinase	NA	NA	NA	NA
WP_002829826.1\|567977_568766_+	tyrosine protein phosphatase	NA	NA	NA	NA
WP_075139741.1\|568767_569433_+	sugar transferase	NA	NA	NA	NA
WP_075139742.1\|569452_570628_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_075139743.1\|570630_571929_+	glycosyltransferase	NA	NA	NA	NA
WP_075139744.1\|572110_573292_+	EpsG family protein	NA	NA	NA	NA
WP_075139745.1\|573318_574461_+	glycosyltransferase	NA	NA	NA	NA
WP_075139746.1\|574457_575354_+	glycosyltransferase	NA	NA	NA	NA
WP_075139747.1\|575374_576286_+	hypothetical protein	NA	NA	NA	NA
WP_075139748.1\|576288_577365_+	hypothetical protein	NA	NA	NA	NA
WP_075139749.1\|577351_578773_+	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_075139750.1\|578803_579670_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	6.8e-104	63.5
WP_075139751.1\|579680_580262_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A1D7XFA9	Escherichia_phage	1.6e-32	40.6
WP_075139752.1\|580274_581303_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	9.9e-70	43.5
WP_075139753.1\|581354_582194_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	2.2e-35	38.4
WP_075139754.1\|582431_583268_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	9.7e-15	27.0
WP_075140323.1\|583264_583864_-	helix-turn-helix domain-containing protein	A0A0C5AJ29	Paenibacillus_phage	3.7e-24	35.1
WP_075139755.1\|583968_585687_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	2.8e-93	37.8

DBSCAN-SWA_3

627262 : 717726

114

Lactobacillus_phage(54.39%)

head,terminase,integrase,plate,tail,tRNA,portal,holin,capsid

attL 662085:662106|attR 698811:698832

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075139772.1\|627262_629680_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	68.2
WP_053906527.1\|629936_631619_+	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_005919135.1\|631629_632349_+	16S rRNA pseudouridine(516) synthase	NA	NA	NA	NA
WP_075139773.1\|632454_633285_-	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
WP_005919128.1\|633410_633872_+	universal stress protein	NA	NA	NA	NA
WP_005919122.1\|635990_636650_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	3.8e-46	45.5
WP_075139774.1\|637322_638141_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_004165595.1\|638142_638346_+	hypothetical protein	NA	NA	NA	NA
WP_075139775.1\|638342_638561_+	AbrB protein	NA	NA	NA	NA
WP_002830688.1\|638560_638839_+	heavy metal-binding domain-containing protein	NA	NA	NA	NA
WP_119179331.1\|638956_639193_-	hypothetical protein	NA	NA	NA	NA
WP_002830690.1\|639787_641668_+	asparagine synthase (glutamine-hydrolyzing)	NA	NA	NA	NA
WP_075139776.1\|641686_643210_+	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_002830692.1\|643209_644466_+	carboxylate--amine ligase	NA	NA	NA	NA
WP_002830693.1\|644471_645179_+	amino acid racemase	NA	NA	NA	NA
WP_075139777.1\|645270_646080_+	DNA/RNA non-specific endonuclease	NA	NA	NA	NA
WP_002830695.1\|646162_646975_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_008842223.1\|647255_647945_-	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_075139778.1\|648339_649419_-\|integrase	site-specific integrase	Q9ZXG6	Leuconostoc_phage	8.9e-45	36.6
WP_075139779.1\|649566_649971_-	hypothetical protein	NA	NA	NA	NA
WP_075139780.1\|650006_650546_-	hypothetical protein	A0A097BY93	Leuconostoc_phage	1.1e-14	40.3
WP_075139781.1\|650607_651018_-	hypothetical protein	NA	NA	NA	NA
WP_075139782.1\|651021_651366_-	XRE family transcriptional regulator	A0A2P0ZLA1	Lactobacillus_phage	4.5e-11	36.2
WP_053905906.1\|651638_651854_+	hypothetical protein	NA	NA	NA	NA
WP_075139783.1\|651985_652702_+	phage regulatory protein	D2IYT0	Enterococcus_phage	1.4e-54	50.2
WP_075139784.1\|652764_652971_+	hypothetical protein	NA	NA	NA	NA
WP_075139785.1\|653067_653406_+	hypothetical protein	NA	NA	NA	NA
WP_081372591.1\|653564_654020_+	chromosome segregation protein SMC	NA	NA	NA	NA
WP_075139787.1\|654020_654713_+	ERF family protein	I6TJU2	Staphylococcus_virus	2.0e-21	39.0
WP_075139788.1\|654705_655131_+	single-stranded DNA-binding protein	A0A2D1GPB7	Lactobacillus_phage	1.6e-42	57.5
WP_075139789.1\|655141_655843_+	hypothetical protein	E9LUU3	Lactobacillus_phage	1.3e-84	67.4
WP_075139790.1\|655820_656687_+	hypothetical protein	A0A1W6JNI1	Staphylococcus_phage	1.9e-37	39.8
WP_075139791.1\|656676_657909_+	DNA helicase	A0A0P0IXJ2	Lactobacillus_phage	3.7e-63	38.0
WP_075139792.1\|657908_658325_+	hypothetical protein	NA	NA	NA	NA
WP_036685676.1\|658321_658753_+	RusA family crossover junction endodeoxyribonuclease	A0A0P0IXM5	Lactobacillus_phage	3.4e-40	56.4
WP_075139793.1\|658752_658980_+	hypothetical protein	NA	NA	NA	NA
WP_075139794.1\|658979_659615_+	RNA polymerase subunit sigma-70	NA	NA	NA	NA
WP_075139795.1\|659777_660149_+	N-acetylmuramoyl-L-alanine amidase	NA	NA	NA	NA
WP_075139796.1\|660314_660608_+	hypothetical protein	NA	NA	NA	NA
WP_075139797.1\|660610_660829_+	hypothetical protein	NA	NA	NA	NA
WP_081372607.1\|660899_661130_+	hypothetical protein	A8ASM5	Listeria_phage	6.1e-12	55.2
WP_075139798.1\|661129_661378_+	hypothetical protein	A0A2K9VC51	Lactobacillus_phage	1.1e-22	59.5
WP_075139799.1\|661387_661681_+	hypothetical protein	NA	NA	NA	NA
WP_155764004.1\|661886_662048_+	hypothetical protein	NA	NA	NA	NA
662085:662106	attL	NA	NA	NA	NA
WP_075139800.1\|662111_662450_+	hypothetical protein	NA	NA	NA	NA
WP_075139801.1\|662554_662998_+	hypothetical protein	NA	NA	NA	NA
WP_008842056.1\|663537_664062_+\|terminase	terminase small subunit	A0A097BYC9	Leuconostoc_phage	2.4e-43	64.4
WP_075139802.1\|664045_665320_+\|terminase	PBSX family phage terminase large subunit	Q6SE84	Lactobacillus_prophage	1.1e-171	68.3
WP_081372592.1\|665380_666736_+\|portal	phage portal protein	A0A0P0IJV3	Lactobacillus_phage	3.4e-142	58.6
WP_075139804.1\|666704_667688_+\|head	phage head morphogenesis protein	A0A0P0I371	Lactobacillus_phage	2.3e-79	47.7
WP_075139805.1\|667792_668509_+	DUF4355 domain-containing protein	A0A0A1EN85	Lactobacillus_phage	2.4e-22	40.0
WP_075139806.1\|668508_669327_+\|capsid	N4-gp56 family major capsid protein	B5SP31	Lactococcus_phage	1.6e-99	72.8
WP_075139807.1\|669344_669611_+	hypothetical protein	A0A2D1GPN4	Lactobacillus_phage	1.6e-08	50.0
WP_075139808.1\|669622_669997_+\|head,tail	phage head-tail connector protein	A0A0P0IV23	Lactobacillus_phage	8.7e-24	52.2
WP_075139809.1\|670001_670307_+	hypothetical protein	NA	NA	NA	NA
WP_075139810.1\|670299_670641_+	hypothetical protein	A0ZVS5	Lactococcus_phage	2.6e-19	45.3
WP_075139811.1\|670641_671043_+	hypothetical protein	A0A097BYB7	Leuconostoc_phage	7.4e-21	38.3
WP_075139812.1\|671063_671669_+\|tail	phage major tail protein, TP901-1 family	A0A0A1ELH3	Lactobacillus_phage	2.8e-48	54.8
WP_155764005.1\|671677_671968_+	hypothetical protein	A0A0P0IXC0	Lactobacillus_phage	6.3e-06	40.9
WP_075139814.1\|671974_672190_+	hypothetical protein	NA	NA	NA	NA
WP_008842043.1\|672252_672588_+	hypothetical protein	A0A0A1ER95	Lactobacillus_phage	2.9e-26	57.7
WP_036685658.1\|672632_673004_+	hypothetical protein	A0A1B0Y2Q4	Lactobacillus_phage	2.1e-17	42.6
WP_075139815.1\|672987_676008_+\|tail	phage tail tape measure protein	A0A0A1ENQ9	Lactobacillus_phage	9.0e-111	62.3
WP_075139816.1\|676007_676769_+\|tail	phage tail protein	A0A286QMT6	Streptococcus_phage	9.4e-41	40.8
WP_075139817.1\|676768_679714_+	peptidoglycan DD-metalloendopeptidase family protein	Q6SEC2	Lactobacillus_prophage	9.9e-155	36.7
WP_075139818.1\|679713_680127_+	hypothetical protein	NA	NA	NA	NA
WP_075139819.1\|680130_681867_+\|plate	phage baseplate upper protein	NA	NA	NA	NA
WP_075139820.1\|681859_682819_+	hypothetical protein	NA	NA	NA	NA
WP_075139821.1\|682818_683097_+	hypothetical protein	NA	NA	NA	NA
WP_075139822.1\|683096_683243_+	XkdX family protein	NA	NA	NA	NA
WP_075140325.1\|683262_683577_+	hypothetical protein	NA	NA	NA	NA
WP_075139823.1\|683576_683816_+\|holin	holin	A0A2H4PBB2	Lactobacillus_phage	2.3e-06	48.3
WP_075139824.1\|683799_685128_+	1,4-beta-N-acetylmuramidase	A0A1X9IGI4	Lactococcus_phage	7.3e-81	67.0
WP_075139778.1\|686351_687431_-\|integrase	site-specific integrase	Q9ZXG6	Leuconostoc_phage	8.9e-45	36.6
WP_075139779.1\|687578_687983_-	hypothetical protein	NA	NA	NA	NA
WP_075139780.1\|688018_688558_-	hypothetical protein	A0A097BY93	Leuconostoc_phage	1.1e-14	40.3
WP_075139781.1\|688619_689030_-	hypothetical protein	NA	NA	NA	NA
WP_075139782.1\|689033_689378_-	XRE family transcriptional regulator	A0A2P0ZLA1	Lactobacillus_phage	4.5e-11	36.2
WP_053905906.1\|689650_689866_+	hypothetical protein	NA	NA	NA	NA
WP_075139783.1\|689997_690714_+	phage regulatory protein	D2IYT0	Enterococcus_phage	1.4e-54	50.2
WP_075139784.1\|690776_690983_+	hypothetical protein	NA	NA	NA	NA
WP_075139785.1\|691079_691418_+	hypothetical protein	NA	NA	NA	NA
WP_081372591.1\|691576_692032_+	chromosome segregation protein SMC	NA	NA	NA	NA
WP_075139787.1\|692032_692725_+	ERF family protein	I6TJU2	Staphylococcus_virus	2.0e-21	39.0
WP_075139788.1\|692717_693143_+	single-stranded DNA-binding protein	A0A2D1GPB7	Lactobacillus_phage	1.6e-42	57.5
WP_075139789.1\|693153_693855_+	hypothetical protein	E9LUU3	Lactobacillus_phage	1.3e-84	67.4
WP_075139791.1\|694689_695922_+	DNA helicase	A0A0P0IXJ2	Lactobacillus_phage	3.7e-63	38.0
WP_075139792.1\|695921_696338_+	hypothetical protein	NA	NA	NA	NA
WP_036685676.1\|696334_696766_+	RusA family crossover junction endodeoxyribonuclease	A0A0P0IXM5	Lactobacillus_phage	3.4e-40	56.4
WP_075139793.1\|696765_696993_+	hypothetical protein	NA	NA	NA	NA
WP_075139794.1\|696992_697628_+	RNA polymerase subunit sigma-70	NA	NA	NA	NA
WP_075139795.1\|697790_698162_+	N-acetylmuramoyl-L-alanine amidase	NA	NA	NA	NA
WP_075139796.1\|698326_698620_+	hypothetical protein	NA	NA	NA	NA
WP_075139797.1\|698622_698841_+	hypothetical protein	NA	NA	NA	NA
698811:698832	attR	NA	NA	NA	NA
WP_081372607.1\|698911_699142_+	hypothetical protein	A8ASM5	Listeria_phage	6.1e-12	55.2
WP_075139798.1\|699141_699390_+	hypothetical protein	A0A2K9VC51	Lactobacillus_phage	1.1e-22	59.5
WP_075139799.1\|699399_699693_+	hypothetical protein	NA	NA	NA	NA
WP_155764004.1\|699898_700060_+	hypothetical protein	NA	NA	NA	NA
WP_075139800.1\|700123_700462_+	hypothetical protein	NA	NA	NA	NA
WP_075139801.1\|700566_701010_+	hypothetical protein	NA	NA	NA	NA
WP_008842056.1\|701549_702074_+\|terminase	terminase small subunit	A0A097BYC9	Leuconostoc_phage	2.4e-43	64.4
WP_075139802.1\|702057_703332_+\|terminase	PBSX family phage terminase large subunit	Q6SE84	Lactobacillus_prophage	1.1e-171	68.3
WP_081372592.1\|703392_704748_+\|portal	phage portal protein	A0A0P0IJV3	Lactobacillus_phage	3.4e-142	58.6
WP_075139804.1\|704716_705700_+\|head	phage head morphogenesis protein	A0A0P0I371	Lactobacillus_phage	2.3e-79	47.7
WP_075139805.1\|705803_706520_+	DUF4355 domain-containing protein	A0A0A1EN85	Lactobacillus_phage	2.4e-22	40.0
WP_075139826.1\|706519_707338_+\|capsid	N4-gp56 family major capsid protein	B5SP31	Lactococcus_phage	1.1e-95	70.9
WP_075139812.1\|709074_709680_+\|tail	phage major tail protein, TP901-1 family	A0A0A1ELH3	Lactobacillus_phage	2.8e-48	54.8
WP_155764005.1\|709688_709979_+	hypothetical protein	A0A0P0IXC0	Lactobacillus_phage	6.3e-06	40.9
WP_081372593.1\|710052_710202_+	hypothetical protein	NA	NA	NA	NA
WP_008842043.1\|710264_710600_+	hypothetical protein	A0A0A1ER95	Lactobacillus_phage	2.9e-26	57.7
WP_036685658.1\|710644_711016_+	hypothetical protein	A0A1B0Y2Q4	Lactobacillus_phage	2.1e-17	42.6
WP_075139815.1\|710999_714020_+\|tail	phage tail tape measure protein	A0A0A1ENQ9	Lactobacillus_phage	9.0e-111	62.3
WP_075139816.1\|714019_714781_+\|tail	phage tail protein	A0A286QMT6	Streptococcus_phage	9.4e-41	40.8
WP_075139817.1\|714780_717726_+	peptidoglycan DD-metalloendopeptidase family protein	Q6SEC2	Lactobacillus_prophage	9.9e-155	36.7

DBSCAN-SWA_4

1129477 : 1138040

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_070366160.1\|1129477_1130059_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	8.8e-23	35.2
WP_075139991.1\|1130058_1131105_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F0L1	Synechococcus_phage	3.5e-54	38.7
WP_008840998.1\|1131107_1132577_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.8e-57	34.5
WP_075139992.1\|1132561_1134766_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.7e-146	41.4
WP_036685062.1\|1134783_1135458_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_008841001.1\|1135454_1135715_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_008841002.1\|1135701_1136436_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A1D7SLB8	Cyanophage	1.3e-42	42.5
WP_075139993.1\|1136413_1137574_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_008841004.1\|1137557_1138040_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	1.6e-17	39.7

DBSCAN-SWA_5

1176043 : 1183365

Staphylococcus_phage(28.57%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075140025.1\|1176043_1176889_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	8.0e-17	34.8
WP_075140027.1\|1177285_1177768_-	dihydrofolate reductase	G9J252	Bacillus_phage	3.6e-22	35.4
WP_005917050.1\|1177785_1178736_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	1.0e-113	59.6
WP_075140028.1\|1178740_1180636_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	1.5e-50	30.3
WP_075140029.1\|1180638_1181847_-\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	1.3e-44	34.8
WP_005917055.1\|1181962_1182832_+	YitT family protein	M1Q1P6	Streptococcus_phage	2.6e-55	37.8
WP_075140030.1\|1182894_1183365_-	nucleoside 2-deoxyribosyltransferase	K4I206	Lactobacillus_phage	4.6e-14	34.6

DBSCAN-SWA_6

1532948 : 1609183

Erysipelothrix_phage(48.57%)

head,terminase,integrase,tail,portal,protease,tRNA,holin,capsid,transposase

attL 1547167:1547226|attR 1557593:1558404

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003717945.1\|1532948_1533917_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4JAA2	uncultured_Caudovirales_phage	3.7e-34	28.9
WP_075140135.1\|1533989_1535081_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_075140136.1\|1535070_1536603_-	SAM-dependent DNA methyltransferase	A0A2H4PQP4	Staphylococcus_phage	2.8e-52	30.2
WP_003672018.1\|1536605_1536827_-	helix-turn-helix transcriptional regulator	A0A2K5B261	Erysipelothrix_phage	2.2e-19	67.2
WP_075140137.1\|1536838_1539451_-	helicase	NA	NA	NA	NA
WP_075140138.1\|1539455_1540841_-	DUF1837 domain-containing protein	NA	NA	NA	NA
WP_003672022.1\|1541151_1541670_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_075140139.1\|1541769_1541973_+	hypothetical protein	A0A2I4R673	Erysipelothrix_phage	2.2e-05	34.3
WP_013923826.1\|1541956_1542292_+	hypothetical protein	A0A2K5B2A7	Erysipelothrix_phage	3.6e-05	39.1
WP_003672026.1\|1542288_1543425_+	DUF2800 domain-containing protein	A0A2K5B2A8	Erysipelothrix_phage	2.0e-108	52.4
WP_003672028.1\|1543405_1543981_+	DUF2815 family protein	A0A2K5B2A9	Erysipelothrix_phage	5.7e-75	74.5
WP_075140140.1\|1544036_1545971_+	DNA polymerase	A0A2K5B2B0	Erysipelothrix_phage	1.1e-226	58.3
WP_075140141.1\|1546037_1546442_+	hypothetical protein	NA	NA	NA	NA
1547167:1547226	attL	NA	NA	NA	NA
WP_013330746.1\|1547221_1547908_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	5.9e-127	99.1
WP_013330746.1\|1548095_1548782_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	5.9e-127	99.1
WP_002415638.1\|1548829_1550458_-	ABC-F type ribosomal protection protein PoxtA	A0A1V0SKJ1	Klosneuvirus	1.2e-48	28.7
WP_013330747.1\|1551430_1552117_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.3e-126	99.1
WP_125276271.1\|1552120_1552651_+	hypothetical protein	NA	NA	NA	NA
WP_002415214.1\|1552763_1553045_+\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	1.4e-13	52.4
WP_002415211.1\|1554156_1555566_+	MFS transporter	NA	NA	NA	NA
WP_000395511.1\|1556070_1556685_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_075140143.1\|1556823_1557414_-\|integrase	site-specific integrase	D2XR58	Bacillus_phage	1.7e-21	34.3
WP_013330746.1\|1557647_1558334_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	5.9e-127	99.1
WP_075140144.1\|1560156_1560438_+	VRR-NUC domain-containing protein	A0A1B0RXC4	Streptococcus_phage	7.5e-20	52.2
1557593:1558404	attR	NA	NA	NA	NA
WP_075140145.1\|1560418_1561774_+	DEAD/DEAH box helicase	A0A2K5B273	Erysipelothrix_phage	1.2e-152	65.2
WP_075140146.1\|1561770_1562238_+	restriction endonuclease	NA	NA	NA	NA
WP_003671980.1\|1562386_1562764_+	HNH endonuclease	A0A2K5B276	Erysipelothrix_phage	4.6e-33	57.3
WP_003671981.1\|1562883_1563426_+\|terminase	terminase	A0A2K5B277	Erysipelothrix_phage	1.0e-57	59.9
WP_003671982.1\|1563425_1564652_+	DNA modification methylase	A0A2I4R670	Erysipelothrix_phage	1.0e-153	63.1
WP_075140147.1\|1564724_1565345_+	hypothetical protein	A0A2K5B280	Erysipelothrix_phage	4.5e-41	44.5
WP_003671984.1\|1565347_1565554_+	DUF5049 domain-containing protein	NA	NA	NA	NA
WP_075140148.1\|1565596_1567216_+\|terminase	terminase large subunit	A0A2K5B285	Erysipelothrix_phage	3.2e-248	77.3
WP_075140332.1\|1567310_1568510_+\|portal	phage portal protein	Q6DMU2	Streptococcus_phage	1.4e-152	63.4
WP_003671987.1\|1568506_1569178_+\|protease	Clp protease ClpP	Q6DMU1	Streptococcus_phage	4.4e-58	52.2
WP_003671989.1\|1569196_1570375_+\|capsid	phage major capsid protein	A0A2I4R671	Erysipelothrix_phage	3.1e-128	58.7
WP_003671991.1\|1570391_1570670_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_075140149.1\|1570669_1571053_+\|head	phage head closure protein	NA	NA	NA	NA
WP_003671994.1\|1571039_1571453_+\|holin	phage holin family protein	A0A2K5B2A2	Erysipelothrix_phage	3.9e-41	64.2
WP_075140150.1\|1571449_1572328_+	1,4-beta-N-acetylmuramidase	A0A2K9V3I9	Faecalibacterium_phage	1.1e-24	36.0
WP_047767200.1\|1572594_1572828_+	hypothetical protein	NA	NA	NA	NA
WP_075140151.1\|1572863_1574525_+	recombinase family protein	A0A2K5B2B2	Erysipelothrix_phage	2.8e-106	40.6
WP_075140152.1\|1574517_1576095_+	recombinase family protein	A0A2K5B2B4	Erysipelothrix_phage	1.8e-131	49.1
WP_075140153.1\|1576145_1577360_-	hypothetical protein	NA	NA	NA	NA
WP_075140154.1\|1577744_1579118_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	1.4e-122	50.6
WP_075140155.1\|1579390_1580386_-	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	3.2e-17	26.0
WP_002832213.1\|1580413_1581841_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_005918902.1\|1581840_1583301_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_005918900.1\|1583300_1583615_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_005918898.1\|1583634_1584792_-	CamS family sex pheromone protein	NA	NA	NA	NA
WP_075140156.1\|1584867_1587141_-	DNA helicase PcrA	A7KV33	Bacillus_phage	3.9e-135	41.1
WP_002832220.1\|1587231_1588371_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_002832221.1\|1588404_1588977_-	xanthine phosphoribosyltransferase	NA	NA	NA	NA
WP_002832222.1\|1588998_1589640_-	glycoside hydrolase family 73 protein	S5M633	Brevibacillus_phage	6.0e-33	50.3
WP_075140157.1\|1589740_1590349_-	ECF transporter S component	NA	NA	NA	NA
WP_075140158.1\|1590870_1593720_+	DEAD/DEAH box helicase	Q5YA94	Bacillus_phage	3.8e-26	27.0
WP_075140159.1\|1593766_1594885_+	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_005918884.1\|1595150_1595408_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002832230.1\|1595551_1595773_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_005918882.1\|1596338_1596542_-	hypothetical protein	NA	NA	NA	NA
WP_075140160.1\|1596572_1597874_-	Y-family DNA polymerase	Q6DMX4	Streptococcus_phage	2.7e-80	39.1
WP_024862990.1\|1598274_1598826_+	hypothetical protein	NA	NA	NA	NA
WP_075140161.1\|1598912_1599767_+	hypothetical protein	NA	NA	NA	NA
WP_075140333.1\|1599954_1601331_-	amino acid permease	NA	NA	NA	NA
WP_008841074.1\|1601343_1602444_-	alanine dehydrogenase	NA	NA	NA	NA
WP_036685148.1\|1602764_1602983_-	PspC domain-containing protein	NA	NA	NA	NA
WP_081372603.1\|1603482_1606077_+	SEC10/PgrA surface exclusion domain-containing protein	NA	NA	NA	NA
WP_075140162.1\|1606250_1607183_+	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_002832236.1\|1607460_1607853_-	30S ribosomal protein S9	NA	NA	NA	NA
WP_024862984.1\|1607867_1608311_-	50S ribosomal protein L13	NA	NA	NA	NA
WP_075140163.1\|1608436_1609183_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP018763

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection