CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP018809	Lactobacillus jensenii strain SNUV360 chromosome, complete genome	1 crisprs	cas3,DEDDh,DinG,csn2,cas2,cas1,cas9	6	26	6	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP018809_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018809_1

1376549-1378168

TypeII

Consensus_repeat	Method
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	CRISPRCasFinder
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	CRT
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	PILER-CR

24 spacers

csn2,cas2,cas1,cas9

The CRISPR arrays of NZ_CP018809_1

>merge|NZ_CP018809|1|1376549-1378168|CRISPRCasFinder,CRT,PILER-CR
TTTTTTCAACTTACTGATTTAACAACCTTCTAAAACACTAACCTTAAATATTCATCGACTACTTTTGTTTTTCAACTTACTGATTTAACAACCTTCTAAAACCTCGCTATTGAGTTGCGACTTCAAGTTTTCGTTTTTCAACTTACTGATTTAACAACCTTCTAAAACATCTTTTCTGCAACTGCCCATTCTGGTAGTGTTTTTCAACTTACTGATTTAACAACCTTCTAAAACTTAGAAACATTAATCTTATTGTCTTTAGCCGTTTTTCAACTTACTGATTTAACAACCTTCTAAAACTAGCTCATCGGCAATTTCCTGCAAAAATTTGTTTTTCAACTTACTGATTTAACAACCTTCTAAAACCTAGTTAAGTCAATATAGCCACTAGGCGTAGTTTTTCAACTTACTGATTTAACAACCTTCTAAAACAAGAAGCTTGACAGAGAAATTGAAAGTAGTGTTTTTCAACTTACTGATTTAACAACCTTCTAAAACACACTAAAAATGATGCTGAAAAAGCTTTAGGTTTTTCAACTTACTGATTTAACAACCTTCTAAAACAGCCATCTAATGCTTCAGGCTTGATATATTGTTTTTCAACTTACTGATTTAACAACCTTCTAAAACTTGTGCAATATCCTTATTACGTATTGTCTTGTTTTTCAACTTACTGATTTAACAACCTTCTAAAACTTACATGTATGTATGCAGATTAAAATAGAGGTTTTTCAACTTACTGATTTAACAACCTTCTAAAACGCTCAATAGTCTTGTTTACTACTTTAAACAGTTTTTCAACTTACTGATTTAACAACCTTCTAAAACAACTGATAAATGGAAGGCCTGCCAGTATCCGTTTTTCAACTTACTGATTTAACAACCTTCTAAAACTGGAAGGTATATCCTACACAGTATCCTAATGTTTTTCAACTTACTGATTTAACAACCTTCTAAAACATCAACCAATGTTAACTCGTGAAATCAAGAGTTTTTCAACTTACTGATTTAACAACCTTCTAAAACCAGATGGATCCTATTCACTTGCTGATTCAAGTTTTTCAACTTACTGATTTAACAACCTTCTAAAACGTCATATTTAGGGTTCTTCAAGTCCTTACTGTTTTTCAACTTACTGATTTAACAACCTTCTAAAACGACGCAGACAATATAGCAAAAGCAGTTTTAGTTTTTCAACTTACTGATTTAACAACCTTCTAAAACTTAAAAATTACAGTCAAGGCATACTTTGGTGTTTTTCAACTTACTGATTTAACAACCTTCTAAAACAACAGTTGGATTACTACCGCAAAAAGTATCGTTTTTCAACTTACTGATTTAACAACCTTCTAAAACTTGACGTAATGACCTAATTCGTGTCCTGCTGTTTTTCAACTTACTGATTTAACAACCTTCTAAAACAAGCAAGCTGAAGCTGTAAATGAAGTAATAGTTTTTCAACTTACTGATTTAACAACCTTCTAAAACACTTCATCCCCAACAGCGAACTGATAGTGAGTTTTTCAACTTACTGATTTAACAACCTTCTAAAACTGGTGGATGAAATTGGGCTGGGCCTTTGGAGTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC

>NZ_CP018809|1|1|1376549-1378168|CRISPRCasFinder
TTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	ACTAACCTTAAATATTCATCGACTACTTTT
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	CTCGCTATTGAGTTGCGACTTCAAGTTTTC
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	ATCTTTTCTGCAACTGCCCATTCTGGTAGT
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	TTAGAAACATTAATCTTATTGTCTTTAGCC
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	TAGCTCATCGGCAATTTCCTGCAAAAATTT
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	CTAGTTAAGTCAATATAGCCACTAGGCGTA
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	AAGAAGCTTGACAGAGAAATTGAAAGTAGT
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	ACACTAAAAATGATGCTGAAAAAGCTTTAG
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	AGCCATCTAATGCTTCAGGCTTGATATATT
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	TTGTGCAATATCCTTATTACGTATTGTCTT
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	TTACATGTATGTATGCAGATTAAAATAGAG
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	GCTCAATAGTCTTGTTTACTACTTTAAACA
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	AACTGATAAATGGAAGGCCTGCCAGTATCC
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	TGGAAGGTATATCCTACACAGTATCCTAAT
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	ATCAACCAATGTTAACTCGTGAAATCAAGA
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	CAGATGGATCCTATTCACTTGCTGATTCAA
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	GTCATATTTAGGGTTCTTCAAGTCCTTACT
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	GACGCAGACAATATAGCAAAAGCAGTTTTA
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	TTAAAAATTACAGTCAAGGCATACTTTGGT
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	AACAGTTGGATTACTACCGCAAAAAGTATC
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	TTGACGTAATGACCTAATTCGTGTCCTGCT
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	AAGCAAGCTGAAGCTGTAAATGAAGTAATA
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	ACTTCATCCCCAACAGCGAACTGATAGTGA
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	TGGTGGATGAAATTGGGCTGGGCCTTTGGA
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC

>NZ_CP018809|1|1|1376549-1378168|CRT
TTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	ACTAACCTTAAATATTCATCGACTACTTTT
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	CTCGCTATTGAGTTGCGACTTCAAGTTTTC
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	ATCTTTTCTGCAACTGCCCATTCTGGTAGT
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	TTAGAAACATTAATCTTATTGTCTTTAGCC
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	TAGCTCATCGGCAATTTCCTGCAAAAATTT
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	CTAGTTAAGTCAATATAGCCACTAGGCGTA
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	AAGAAGCTTGACAGAGAAATTGAAAGTAGT
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	ACACTAAAAATGATGCTGAAAAAGCTTTAG
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	AGCCATCTAATGCTTCAGGCTTGATATATT
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	TTGTGCAATATCCTTATTACGTATTGTCTT
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	TTACATGTATGTATGCAGATTAAAATAGAG
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	GCTCAATAGTCTTGTTTACTACTTTAAACA
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	AACTGATAAATGGAAGGCCTGCCAGTATCC
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	TGGAAGGTATATCCTACACAGTATCCTAAT
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	ATCAACCAATGTTAACTCGTGAAATCAAGA
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	CAGATGGATCCTATTCACTTGCTGATTCAA
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	GTCATATTTAGGGTTCTTCAAGTCCTTACT
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	GACGCAGACAATATAGCAAAAGCAGTTTTA
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	TTAAAAATTACAGTCAAGGCATACTTTGGT
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	AACAGTTGGATTACTACCGCAAAAAGTATC
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	TTGACGTAATGACCTAATTCGTGTCCTGCT
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	AAGCAAGCTGAAGCTGTAAATGAAGTAATA
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	ACTTCATCCCCAACAGCGAACTGATAGTGA
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC	TGGTGGATGAAATTGGGCTGGGCCTTTGGA
GTTTTTCAACTTACTGATTTAACAACCTTCTAAAAC

>NZ_CP018809|1|1|1376550-1378168|PILER-CR
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACA	CTAACCTTAAATATTCATCGACTACTTTTG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACC	TCGCTATTGAGTTGCGACTTCAAGTTTTCG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACA	TCTTTTCTGCAACTGCCCATTCTGGTAGTG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACT	TAGAAACATTAATCTTATTGTCTTTAGCCG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACT	AGCTCATCGGCAATTTCCTGCAAAAATTTG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACC	TAGTTAAGTCAATATAGCCACTAGGCGTAG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACA	AGAAGCTTGACAGAGAAATTGAAAGTAGTG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACA	CACTAAAAATGATGCTGAAAAAGCTTTAGG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACA	GCCATCTAATGCTTCAGGCTTGATATATTG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACT	TGTGCAATATCCTTATTACGTATTGTCTTG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACT	TACATGTATGTATGCAGATTAAAATAGAGG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACG	CTCAATAGTCTTGTTTACTACTTTAAACAG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACA	ACTGATAAATGGAAGGCCTGCCAGTATCCG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACT	GGAAGGTATATCCTACACAGTATCCTAATG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACA	TCAACCAATGTTAACTCGTGAAATCAAGAG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACC	AGATGGATCCTATTCACTTGCTGATTCAAG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACG	TCATATTTAGGGTTCTTCAAGTCCTTACTG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACG	ACGCAGACAATATAGCAAAAGCAGTTTTAG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACT	TAAAAATTACAGTCAAGGCATACTTTGGTG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACA	ACAGTTGGATTACTACCGCAAAAAGTATCG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACT	TGACGTAATGACCTAATTCGTGTCCTGCTG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACA	AGCAAGCTGAAGCTGTAAATGAAGTAATAG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACA	CTTCATCCCCAACAGCGAACTGATAGTGAG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAACT	GGTGGATGAAATTGGGCTGGGCCTTTGGAG
TTTTTCAACTTACTGATTTAACAACCTTCTAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018809.1\|WP_006587837.1\|1387950_1388931_-\|Gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223745
NZ_CP018809.1\|WP_006585734.1\|1378866_1379172_-\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|226043
NZ_CP018809.1\|WP_006585737.1\|1375393_1375675_-\|HicB-family-protein	unknown	unknown	gnl\|CDD\|374224
NZ_CP018809.1\|WP_006585731.1\|1384578_1386009_-\|PTS-transporter-subunit-EIIC	unknown	unknown	gnl\|CDD\|181971
NZ_CP018809.1\|WP_006585740.1\|1370279_1371992_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227904
NZ_CP018809.1\|WP_006585736.1\|1375752_1376022_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018809.1\|WP_006585738.1\|1372543_1374928_-\|phosphoenolpyruvate-synthase	unknown	unknown	gnl\|CDD\|235809
NZ_CP018809.1\|WP_006585729.1\|1386915_1387815_-\|N-acetylmuramic-acid-6-phosphate-etherase	unknown	unknown	gnl\|CDD\|235467
NZ_CP018809.1\|WP_006588051.1\|1369589_1370234_+\|DUF3862-domain-containing-protein	unknown	unknown	gnl\|CDD\|289729
NZ_CP018809.1\|WP_006585733.1\|1379149_1380058_-\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
NZ_CP018809.1\|WP_006588050.1\|1368429_1369275_-\|NAD(P)H-hydrate-dehydratase	unknown	unknown	gnl\|CDD\|238576
NZ_CP018809.1\|WP_006585739.1\|1372045_1372456_-\|peptide-deformylase	unknown	unknown	gnl\|CDD\|181704
NZ_CP018809.1\|WP_006585745.1\|1364232_1365144_-\|class-II-fructose-bisphosphate-aldolase-family-protein	unknown	unknown	gnl\|CDD\|238477
NZ_CP018809.1\|WP_075362503.1\|1365222_1366899_-\|arginine--tRNA-ligase	unknown	unknown	gnl\|CDD\|183534
NZ_CP018809.1\|WP_006585730.1\|1386023_1386911_-\|prolyl-oligopeptidase-family-serine-peptidase	unknown	unknown	gnl\|CDD\|223700
NZ_CP018809.1\|WP_006585743.1\|1367149_1368418_-\|D-alanyl-D-alanine-carboxypeptidase	unknown	unknown	gnl\|CDD\|224600
NZ_CP018809.1\|WP_006585728.1\|1389003_1389672_-\|type-1-glutamine-amidotransferase	unknown	unknown	gnl\|CDD\|153212
NZ_CP018809.1\|WP_075362504.1\|1380280_1384453_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374653
NZ_CP018809.1\|WP_006585727.1\|1389802_1390453_-\|nitroreductase-family-protein	unknown	unknown	gnl\|CDD\|380314
NZ_CP018809.1\|WP_006585735.1\|1378201_1378870_-\|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl\|CDD\|213411

Protein	Function_ID	Function_description	E-value
NZ_CP018809.1\|WP_006585734.1\|1378866_1379172_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	1.31344e-25
NZ_CP018809.1\|WP_006585737.1\|1375393_1375675_-\|HicB-family-protein	gnl\|CDD\|374224	pfam15919, HicB_lk_antitox, HicB_like antitoxin of bacterial toxin-antitoxin system. This is a family of HicB-like antitoxins.	2.5296e-08
NZ_CP018809.1\|WP_006585731.1\|1384578_1386009_-\|PTS-transporter-subunit-EIIC	gnl\|CDD\|181971	PRK09586, murP, PTS system N-acetylmuramic acid transporter subunits EIIBC; Reviewed.	2.11301e-89
NZ_CP018809.1\|WP_006585740.1\|1370279_1371992_-\|hypothetical-protein	gnl\|CDD\|227904	COG5617, COG5617, Predicted integral membrane protein [Function unknown].	0.000690298
NZ_CP018809.1\|WP_006587837.1\|1387950_1388931_-\|Gfo/Idh/MocA-family-oxidoreductase	gnl\|CDD\|223745	COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only].	2.34202e-42
NZ_CP018809.1\|WP_006588051.1\|1369589_1370234_+\|DUF3862-domain-containing-protein	gnl\|CDD\|289729	pfam12978, DUF3862, Domain of Unknown Function with PDB structure (DUF3862). Structure 3D4E shared structural similarity to beta-lactamase inhibitory proteins (BLIP) which already include 1XXM, 1S0W, 1JTG, 2G2U, 2G2W, 2B5R, and 3due. All of structures are involved in beta-lactamase inhibitor complex. (REF http://www.topsan.org/Proteins/JCSG/3d4e).	3.12916e-16
NZ_CP018809.1\|WP_006585729.1\|1386915_1387815_-\|N-acetylmuramic-acid-6-phosphate-etherase	gnl\|CDD\|235467	PRK05441, murQ, N-acetylmuramic acid-6-phosphate etherase; Reviewed.	1.83361e-159
NZ_CP018809.1\|WP_006585738.1\|1372543_1374928_-\|phosphoenolpyruvate-synthase	gnl\|CDD\|235809	PRK06464, PRK06464, phosphoenolpyruvate synthase; Validated.	0
NZ_CP018809.1\|WP_006585733.1\|1379149_1380058_-\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	1.58221e-103
NZ_CP018809.1\|WP_006588050.1\|1368429_1369275_-\|NAD(P)H-hydrate-dehydratase	gnl\|CDD\|238576	cd01171, YXKO-related, B.subtilis YXKO protein of unknown function and related proteins. Based on the conservation of the ATP binding site, the substrate binding site and the Mg2+binding site and structural homology this group is a member of the ribokinase-like superfamily.	6.2935e-81
NZ_CP018809.1\|WP_006585739.1\|1372045_1372456_-\|peptide-deformylase	gnl\|CDD\|181704	PRK09218, PRK09218, peptide deformylase; Validated.	1.81638e-83
NZ_CP018809.1\|WP_006585745.1\|1364232_1365144_-\|class-II-fructose-bisphosphate-aldolase-family-protein	gnl\|CDD\|238477	cd00947, TBP_aldolase_IIB, Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases. TBP aldolase is a tetrameric class II aldolase that catalyzes the reversible condensation of dihydroxyacetone phosphate with glyceraldehyde 3-phsophate to produce tagatose 1,6-bisphosphate. There is an absolute requirement for a divalent metal ion, usually zinc, and in addition the enzymes are activated by monovalent cations such as Na+. The type A and type B Class II FBPA's differ in the presence and absence of distinct indels in the sequence that result in differing loop lengths in the structures.	3.68772e-130
NZ_CP018809.1\|WP_075362503.1\|1365222_1366899_-\|arginine--tRNA-ligase	gnl\|CDD\|183534	PRK12451, PRK12451, arginyl-tRNA synthetase; Reviewed.	0
NZ_CP018809.1\|WP_006585730.1\|1386023_1386911_-\|prolyl-oligopeptidase-family-serine-peptidase	gnl\|CDD\|223700	COG0627, COG0627, Predicted esterase [General function prediction only].	1.25633e-25
NZ_CP018809.1\|WP_006585743.1\|1367149_1368418_-\|D-alanyl-D-alanine-carboxypeptidase	gnl\|CDD\|224600	COG1686, DacC, D-alanyl-D-alanine carboxypeptidase [Cell envelope biogenesis, outer membrane].	5.97973e-68
NZ_CP018809.1\|WP_006585728.1\|1389003_1389672_-\|type-1-glutamine-amidotransferase	gnl\|CDD\|153212	cd01741, GATase1_1, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. This group contains a subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. GATase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. Glutamine amidotransferases (GATase) includes the triad family of amidotransferases which have a conserved Cys-His-Glu catalytic triad in the glutaminase active site. In this subgroup this triad is conserved. GATase activity can be found in a range of biosynthetic enzymes, including: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase , anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. Glutamine amidotransferase (GATase) domains can occur either as single polypeptides, as in glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase.	5.45901e-60
NZ_CP018809.1\|WP_075362504.1\|1380280_1384453_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|374653	pfam16592, Cas9_REC, REC lobe of CRISPR-associated endonuclease Cas9. The REC lobe of Cas9 - the CRISPR-associated endonuclease Cas9 - includes the REC1 and REC2 domains. REC1 forms an elongated, alpha-helical structure consisting of 25 alpha helices and two beta-sheets, whereas REC2 inserted within REC1 adopts a six-helix bundle structure. The REC lobe and the NUC lobe of Cas9 fold to present a positively charged groove at their interface which accommodates the negatively charged sgRNA:target DNA heteroduplex. CRISPR (clustered regularly interspaced short palindromic repeat)-Cas system occurs naturally in bacteria as a defense against invasion by phages or other mobile genetic elements. Cas9 is targeted to specific genomic locations by sgRNAs or single guide RNAs, in order to complex with invading DNA in order to cleave it and render it inactive.	1.25179e-120
NZ_CP018809.1\|WP_006585727.1\|1389802_1390453_-\|nitroreductase-family-protein	gnl\|CDD\|380314	cd02137, MhqN-like, nitroreductase family protein similar to the NAD(P)H nitroreductase MhqN. A diverse subfamily of the nitroreductase family containing uncharacterized proteins; includes nitroreductases MhqN, YodC, YdgI, DrgA. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and nitroimidazoles. This process requires NAD(P)H as electron donor in an obligatory two-electron transfer and uses FMN as cofactor. The enzyme is typically a homodimer.	1.73528e-45
NZ_CP018809.1\|WP_006585735.1\|1378201_1378870_-\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	5.23522e-90

>NZ_CP018809.1|WP_006585736.1|1375752_1376022_-|hypothetical-protein
MDEINKIAIEVGAEDMINRPSLVKAQELFHDKTFTMPLIAKYTGISISRLKNLSSGRTPLDQLPEANLLKLAKFSDTCEIFRKLAEKIV
>NZ_CP018809.1|WP_006585737.1|1375393_1375675_-|HicB-family-protein
MKYFAILHKNKNNQFEVSFPDLAPAAATFGDTLEEAIESAHDSLTGYLLTAEDYNEVVTAPTNNPSIFKIQGSDIIVPVEVNLEFERIKEQNN
>NZ_CP018809.1|WP_006585738.1|1372543_1374928_-|phosphoenolpyruvate-synthase
MDQRKNANVLWFDELKREDVDLVGGKSSSLGELTSGTNVPVPYGFATTAAAYRYFMKVTGLNEKINALLKTLKNVDDSDELHKICSQIRKLIVAAKMPADLAKEIGDNYDKLAMKMKVNEPFVAVRSSATAEDLPDASFAGQQDTYLNVHGRDNVIQKVKECYASTFTDRATYYRVKQGFPHEKVALSAAVQMMAFSKASGVMFTVNVATGDYTKVMIEGSWGLGEYIVQGTVTPDNFVVDKASGKISDKTINNKNVELIRLPDGGVEDRKVPEDIATKPCLSDEQVEQLASYAKEIEKHYGCYMDMEWSLDENDKLWLVQARPETVWSQRKKAGKMSKDTSDEKLTTDHKVLVSGLPASPGIKHGIVHVIENPEDIDKFKDGEVLVTLMTSPDWVPAMKKASAIVTNNGGMTCHAAIVSREMQIPCIVGTASRGAKATAVLKDGQEVTVDAKNGVVYQGVVADMVKKPEKQVSAPAAEYFAPTATGVMMNLGDPDLVDRYKDLPCDGIGLMREEFLWTTYIHQHPLYLIETGHPERVVNELANGISKVARAMNPRPVVLRFSDFKSGEYRNLKGGDKFEPHESADLLGWRGASRYYDPKYIEAFKLELEAVKKVRNEYGLTNLNVMIPFVRTVDELKKVTEIMAEAGLRRSNDFKVYMMAEIPSNIILADQFNQYIDGYSIGSNDLTMLLLGCDRNNDTVSSLFDERNLAIKRAIRHLIKTAHKDGKTVSICGQAPSEYPEFTEFLVKSGIDYVSVNPDMVKATKRNVARYEQRIILDHATGLGRADTEDYDW
>NZ_CP018809.1|WP_006585739.1|1372045_1372456_-|peptide-deformylase
MIKEIVKDEMFLKRKSLPATKADLPIGQDLRDTLQANKERCVGMAANMIGYSKRVIIVNIGFLNVVMFNSVILERKDPYQVSEGCLSLSGSRNTLRFKEVKVAFLDEKWENQELTLTGFAAEICQHEMDHLEGILI
>NZ_CP018809.1|WP_006585740.1|1370279_1371992_-|hypothetical-protein
MKKLKEKYFRELLPYSLIFLVIIATLYVQIAVHSTNMGADNYFHFARFYDIKAQLMTGKFNWFQTNFTFEQTGKVINALYGPLFAYLNGMLLLVAKTWYQYEVITNILLNFIAAIGMYKLAQKVKAPKNVSVILALLYINTGMIPSWIEGMNFSAWGGVFIPYLLIQVVNLLEDKEKPIHVVGLMTCISLIANTHLLSTLLIVLVLAPVVLISFIKTQDKKSFIIDLLKVAVGTIILTASVWGGLLVIYSQNTIATPYSVNMGMFTIHLSHFQAFRQFIFPSALLLFTGQFIYAVLHCKKQFNNFVVTFIGYCFLLIGSKWFLDWNWIQMKLPIISGIFQFPFRLTSVAYPLILLGLAYTFATNAKQKKSYKEWNYAVIFSIFVMVQACFSTYKVVLDTAQGQNGENSISLVTQMRYSPDYVKKWTQSQTGIFDLYENAQPDYLPLNKKMPSRVVVEKYRAILAVRKKYQHIVNRDGSLTLRWRAKKQKKVTLPLVMYKQSRLIVNGKKKNKINQNDIGAPIIVQKKGENTVNLKFMVPLWFNILLAINILGWIVLIGYYARKKYLIAKK
>NZ_CP018809.1|WP_006588051.1|1369589_1370234_+|DUF3862-domain-containing-protein
MKKEKDNKKPIYKRIWFWIVIIVLVGGASSTIGKGNSNSNNSSTTNSSSSSSNSSNKVSLANFNKINLSSSNGDSKAAIRKLFGKKESSTSSSTVENVKTELLTWDSVNNGSFASNITVNFDNDHAVVKSISGLKVNRSKKIALSDFEAISDGQSQEDIKKKFGEPNGYTITDLANYKSEVWDYTSGIKGSVGANFNITFTDGKVSGKSQYDMK
>NZ_CP018809.1|WP_006588050.1|1368429_1369275_-|NAD(P)H-hydrate-dehydratase
MIEISDKVVKSIIVERPSDSYKGMFGRVLLIGGSLNFGGAIIMATEAAVNSGAGLTSVATNINNLSSLHSRIPEAMFIDWQESNLVKVIKNSNIIAIGPGLGLDEHAQSLLQLVKRTVKNTQTVILDASALDLLAQDHTLMPTNAETIIMTPHQKEWERVSQIKIPFQEDKDNFSVLKSLFPDNNGILVLKSNHTKIYDCFGNIYQNPLGNPGMATGGMGDTLTGILAGFCGQFSAKIETIASAVYLHSLAGDELYKEHYVVLPTQLSAKIPQLMKKFSLE
>NZ_CP018809.1|WP_006585743.1|1367149_1368418_-|D-alanyl-D-alanine-carboxypeptidase
MKRFFKTIICLLSFLLISSLALTGGTVFASTSINNVNANEAKLNVKAAITIDQKTGEVLYAKNAAKALPIASMSKLITIYLTLQAIKNGKLSWNQKLTPTKNIVKLSNNSDYSNVPLQEKHQYTVKQLYEASLIESANGAVMMLAQAVYGSQENAVNQMRTLLKKWQINGAQIYTTCGLKNGEVGSDAYPGAGKNVENEVPAVGVAKIVDHLLTDYPEVLSTSKLAELDFKDGSTVTKMKNWNWMLKGLSQYDSEYPLDGLKTGTSEKAGACFAGTLKYKGRRLITIVMGAKHVDGTDPSRFVQTKKMLDYVYSNYQLYIYKKGTQLANLKGVKVADGNQKISNLVVKKDSGIWQKTSSTGKLTFSKSEIEAPIKKGQLAGYYLFTNNPSIYSSKGTKLAATVRENIDQANIFVRIWHLFFK
>NZ_CP018809.1|WP_075362503.1|1365222_1366899_-|arginine--tRNA-ligase
MDFKQKVVELISSQVELPKEKINSLIERPKNPEMGDYAFPAFILAKTLHKNPAEIAKDIVANLADDNFEKIQAVGPYVNFSIKKSALISQTLEEVLVKKNNYGNQNLGSGNVAIDMSSPNIAKPMSMGHLRSTVIGNSIAKILTKVGYTPIKINHLGDYGTQFGKLITAYKLWGNEEDVKKDPINSLFHYYVKFHEVAEEKPELEDEGRAWFKKLEGGDPEAVKLWNWFRKVSLQEFNRIYKKLNVEFDSYHGEAFYNDKMDVIVDELRQKDLLVESRGAQVVDLGPDKNPAMILKSDGTSIYTTRDLTAAEYRKKHYDFVQALYVVGNEQSAYFEQLKEVLKKMGHNWADDIHHIPFGLITQGGKKLSTRKGNVVFLDKVLEDAVELAMKQIETKNPGLPNKEQVANEVGIGAVVFHDLKNDRLDAFDFNLEEVVRFEGETGPYVQYTNARAQSILRKANQIVTIDELDLSDEWAFAVAKDLADFRAVLAKASEKYEPSIIAKFALKLAKHFNKYYANVRILDEDDQLAARLALVKATSIVLTESLHLLGVAAPKEM
>NZ_CP018809.1|WP_006585745.1|1364232_1365144_-|class-II-fructose-bisphosphate-aldolase-family-protein
MAYFDNGNEIFKEARKHHYAVGAYNTNNLEWTRAELRAAEETRTPLLIQVSTGAAKYMGGYKFVKDMVADQMDAMNISVPVILNLDHGDFESAKECIKLGYSSVMFDGHALPTEENLAKTKEIIKLAHERGISVEAEIGKIGENQGGGELASVEDAKAFVAAGVDKLACGIGNIHGVYPADWKGLNFDRLKEIAEAVPETPLVLHGGSGIPQDQIKKAIQLGIAKININTEFQLAFQEATREYIMAEKDLDKDHKGYDPRKLLLPGTEAITDKMKEMISWMGTKTIDDELKDASFDRSSLNEE
>NZ_CP018809.1|WP_006585735.1|1378201_1378870_-|type-II-A-CRISPR-associated-protein-Csn2
MIISYEGHHPIKVSDGKITFIKVANSAVYRDFILSFQGKSEKVKFFDEHYNQLEKNKSIDWVGDVLITQDYLNSYQNKIISNLFDTLNENQRNKIFNTWRQLSTDIQDIIFMTDLPIEVGENLDLKKLFKFDGIHFDDSVLSDPYAIIETVVKIHIECKLNSVVTFANVSHYLTKEQLNNLITFINEVNMPLILIEFSSSDFKVVSGDARVCYIDEDFVDWY
>NZ_CP018809.1|WP_006585734.1|1378866_1379172_-|CRISPR-associated-endonuclease-Cas2
MRLLIMFDLPTETAQDRKNYRIFRKELINEGFVMIQFSVYVRVCVNRKMAIFLENRVRNFLPEEGLVQSLMLTEKQYNDMHFLIGEAVDDVRNTSDRTVII
>NZ_CP018809.1|WP_006585733.1|1379149_1380058_-|type-II-CRISPR-associated-endonuclease-Cas1
MAWRNVIITQHAKLSYSSNMMQVQTSKGITQIPLSDIALLLVESTQAVITSQLISKLAEQGCKVIFVDNKYNPITETVNYYAPKCNYQNLLAQLHWDETLKQRLWTEVVWLKMNNQLNVLKNYHLPTEKVEQEINKLEFNDVSNREAVVAREYFQELFGKSFVRQDEGDTINAALNYGYSILLSSFNRRIVQNGYETYLGIHHSSIANQFNLASDLMEPFRPFVDYWVAGQKLKDFTPDVRYGLVELLSLQIKYNGKAILLANAIDLFTKECLGYLSNDVDKVESVMDFVNEVPNHAIADNV
>NZ_CP018809.1|WP_075362504.1|1380280_1384453_-|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MKEIKDYIIGLDIGTNSCGYVVTDKQNNILKLKGKTAIGARLFKEGEAAADRRAFRTTRRRLARRRWRLSLLEEIFDEEMNKVDPSFFRRLKESDYSPKDRRKQFNSIVFESSEADKAFYEKYPTIYHLRNALMHDNQKHDLREIFLAVHHIVKYRGNFLREDSVKAFKAAKFTLQGEDGIGPVDKLNDLLKEIYIEAAPELATDNLSKIEDIIKDKKLYKQDKLKQIANLLPKAVDSKDKAKLNKDIAKQVANALMGYMFRLDTLFSFTDVDVKDYKLKFSDANIDESLDALTSLLTDAQIEFVLELQSIYNTIVLNEIVPDGMSLSESMVKKYDDHKKDLKLYKEYIDSLSDQKKAKQLEAAYALYVNYRKADLLAAKKLFEKKIGDKKFVDVISNFEVFGKFVSDNLDDSELANKIKARLDLGEFLPKQRTNQNGVIPYQLHQVELTQILEKQGKYYPFLITPNPVESHRNNAPYEISELVSFRVPYYVGPLIDNQSIKDKQNKNKFAWMVRQKQGQITPWNFEEMVDTTESANQFIKRMTRKDTYLLAEDVLPKSSLIYQKFMILDELNRIKIDGKKLTSKLKHDIFEKLFKKQKSINLDNLKNYLLAEGNIPGLIEGLSDGINFNNSFSTYIDYRNILGDEIDNPNKQADFEKMIEWSTVFEDRKIFKRKLKEITWLTPEQIKQVSSKRYSGWGRLSKKLLTQITDENGVNILQRLWNEPETLTEVLANPVIKRKISEANSLFVQINKVENILDDAYTSPQNKKAIRQVIRVVDDIIAAAHGKKPSQIAIEFARSSQNKAKVPDTRKKQLDKIYNKISSEILDSSIKNELKNLKSNKYLSKDKLFLYFKQMGRDAYTGDKLSLDQLQNYDIDHIFPRSFIKDDSLDNRVLTQKPINAKKSDYGIPALEFGNKYVPDLGITVKEMWKLWQENGLISKSKLINLCTNPKKIGSKRASGFINRQLVETSQVIKLVAIILQAEFPDTEIIEVKALQNTTLRESFHLYKNRSVNDYHHAIDAYLTTIVGNYLYQVYPKLRPYFVYGQFKKFNQEKNIDILKRLKNFNFLRQLIFNTDDNIYISGTKEIVFNKKDIIHKLETAYGYKYMNISRECYQETSSLFNQTLYAHNSSVKNSLIPKKKGLPTEIYGGYSGNKDSFFVLVKIVKKRTNLYRIVGIPTRELAKLNSSNNYNQALNKIVESKLCLKETESFKILIKRLLYGTLIVDNGQKFRIGSFKEKHNVQQLVLQLKSMKYIKFYIDGGQNYFTDVERKKLEKQDRDKCLLYVFDDIMNVVNKRFTLFDMSKYEKDGDSLREKFNCLDFNDKVSILSDLLKAFHANSDRTSITKLKITNLGRHQAGKNGITLTTNAQIIYQSPTGLFERRIKIKDL
>NZ_CP018809.1|WP_006585731.1|1384578_1386009_-|PTS-transporter-subunit-EIIC
MSDQELAKKILSLVGGKKNIKNVASCMTRLRLSLNDVSLANIDELKKLDGVLGVVQADTLQIVLGPGKVTKVAEQFAKLVQQKLSQTQADDALDEVKAQAAKNKAENKKKHDKPLQRGLQHVANVFIPLLPGIIAAGLINGICNVIDFQTGSAFANDWWYATIKTIGWGMFAFLPLLVAMNAAAEFKGSRVLGAIGGIYCLNLGITTFPLASLALNMPFTNSPYVAGVGGILTALLIGFFIAFVEKWVRSWMPDMLDTFLSPLITVIFCGLIAVVFLQPVGSWLTNIIYVVMDFFYNKLSWFGGYILSSTFLGLVSVGLHQALTPIHIMLNDPTGPTKGINYLLPILMMAGGGQVGAGLALFFKSKNKRFKKLVMSSIPVAVLGVGEPLMYAVTLPLGRTFVTACLGAGFGGVAASLFHLGTVSQGVSGLFGLLIMQPGQQLQFLIALLIAYLGGFIITWFFGVDEGRINELFPEK
>NZ_CP018809.1|WP_006585730.1|1386023_1386911_-|prolyl-oligopeptidase-family-serine-peptidase
MKKRSSLFILIILMLSLVLTGCTSNKDAAKAKAANQSQVVTTTLYSKHLGIDWNYDVYLPAGYNPKANKKYPVLFMLHGLYGNHRNLLERFNSQQIIDGLVHRTSKKMIVVFVDGFNSFYVNQKGGMQMETAIIKDLIPKINQTYKVATNPNQRAIGGISMGGYGAARLALKYPNQFSKAVMISPSVWYSLAKGNPIRANMHAFTDGKTNWSDQVYNSEFPTKYINNKSRNVKLYIETTSSDTTVPVKDVNHFVNDVKSQGINVKYVKDSGDNHNWTYWTKAAPKAYAWAIKELN
>NZ_CP018809.1|WP_006585729.1|1386915_1387815_-|N-acetylmuramic-acid-6-phosphate-etherase
MTLDISKLETEQPNPKTRKIDECSTDQILKLINDQDQTIAGVVRKTIPKIGQIVEAATNAIKNGGHVYYVGAGTSGRLGVLDAAECPPTYGVSPELFQGILAGGKEAIFVAKEGVEDSESRGKQALVEHNLAKSDLVIGIAASGRTPYVIGALKYANDVGAGTASIACVTNSALARYAKIAIEAVTGPEVITGSTRMKSGTAQKLILNMISTTTMIKLGKVYENYMVDVSPTNQKLEVRACNMIKLFTDLDDQAAKDLFIASHKEVKTAIVMYLKKVDYKQAKVLLDKSQGHIRQAIKE
>NZ_CP018809.1|WP_006587837.1|1387950_1388931_-|Gfo/Idh/MocA-family-oxidoreductase
MLKLGVIGTSWISKQLVEAAQATKKWTVTSVYSRSLERAKEFGEPLGIEGFFDDLESFFSKGNFEVVYIASPNSLHFKQAKMAIEHDKNVIVEKPAFTKPKQYDEIAELLDTHDCHFIEAARHIHTKIFRKLTDEVKKLPQVDGAYLNVRQYSSRMHTLTPGQKPANVFKPEFAGGALMDIGVYGVYVAVSLFGMPNACSYTPVLHKNEIDVSGNALLKYDNFFVNIDIAKNTMTYQGSEIYGSKEVVGIDSILDMHKVAYYDAEGKKHASRIKVPDNPLYEEMNEFADLFINPDEKLFDYWVLSAQVGEVLNTLRQSAGIKFPDD
>NZ_CP018809.1|WP_006585728.1|1389003_1389672_-|type-1-glutamine-amidotransferase
MRVNILQHTPNEGPGAIADWCHDRGHEMYVYHPYQFGKLPEASETDMLVILGGPMSPNDDLFWIKEERVLITQLLASDTPIFGACYGAQQIAKVLGSKIGKAPHKEVGWAPVYLQNHVIDGLPEKIVALHWHEEMFEIPTGAHLLYSSDLVKNQGFVFGSHVIGLQFHFEPLADNVREMVVNDGEYALQNNDLKQSPSQILQKQVPSENKQIMYKLLDFITK
>NZ_CP018809.1|WP_006585727.1|1389802_1390453_-|nitroreductase-family-protein
MTEIEFENNDFSSVMLNRHSVRHFDKSCKIDRSVLTEMVKEATTAPSSCNLQAWHFVVVDTDEGKEKLRKIFMPFNHPQLDTCSAMVVLFGDTDAFKKYRDLWQGMYEEKKITKERLETILGTFLPIYEKADRTLLTADAMVDASLAAMQFMLDARARGFATNPIAGYDATKMALAMGLDPVRYVPVMAIAIGKPDESKQELVSTRYDVKDVLEFR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Identity
NZ_CP018809_1	1.9\|1377113\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377113-1377142	30	NZ_CP018809.1	989825-989854	1.0
NZ_CP018809_1	1.15\|1377509\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377509-1377538	30	NZ_CP018809.1	1610332-1610361	1.0
NZ_CP018809_1	1.24\|1378103\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1378103-1378132	30	NZ_CP018809.1	52583-52612	1.0
NZ_CP018809_1	1.33\|1377114\|30\|NZ_CP018809\|PILER-CR	1377114-1377143	30	NZ_CP018809.1	989825-989854	1.0
NZ_CP018809_1	1.39\|1377510\|30\|NZ_CP018809\|PILER-CR	1377510-1377539	30	NZ_CP018809.1	1610332-1610361	1.0
NZ_CP018809_1	1.48\|1378104\|30\|NZ_CP018809\|PILER-CR	1378104-1378133	30	NZ_CP018809.1	52583-52612	1.0

1. spacer 1.9|1377113|30|NZ_CP018809|CRISPRCasFinder,CRT matches to position: 989825-989854, mismatch: 0, identity: 1.0

agccatctaatgcttcaggcttgatatatt	CRISPR spacer
agccatctaatgcttcaggcttgatatatt	Protospacer
******************************

2. spacer 1.15|1377509|30|NZ_CP018809|CRISPRCasFinder,CRT matches to position: 1610332-1610361, mismatch: 0, identity: 1.0

atcaaccaatgttaactcgtgaaatcaaga	CRISPR spacer
atcaaccaatgttaactcgtgaaatcaaga	Protospacer
******************************

3. spacer 1.24|1378103|30|NZ_CP018809|CRISPRCasFinder,CRT matches to position: 52583-52612, mismatch: 0, identity: 1.0

tggtggatgaaattgggctgggcctttgga	CRISPR spacer
tggtggatgaaattgggctgggcctttgga	Protospacer
******************************

4. spacer 1.33|1377114|30|NZ_CP018809|PILER-CR matches to position: 989825-989854, mismatch: 0, identity: 1.0

agccatctaatgcttcaggcttgatatatt	CRISPR spacer
agccatctaatgcttcaggcttgatatatt	Protospacer
******************************

5. spacer 1.39|1377510|30|NZ_CP018809|PILER-CR matches to position: 1610332-1610361, mismatch: 0, identity: 1.0

atcaaccaatgttaactcgtgaaatcaaga	CRISPR spacer
atcaaccaatgttaactcgtgaaatcaaga	Protospacer
******************************

6. spacer 1.48|1378104|30|NZ_CP018809|PILER-CR matches to position: 52583-52612, mismatch: 0, identity: 1.0

tggtggatgaaattgggctgggcctttgga	CRISPR spacer
tggtggatgaaattgggctgggcctttgga	Protospacer
******************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP018809_1	1.9\|1377113\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377113-1377142	30	EU871039	Lactobacillus phage Lv-1, complete genome	3962-3991	0	1.0
NZ_CP018809_1	1.33\|1377114\|30\|NZ_CP018809\|PILER-CR	1377114-1377143	30	EU871039	Lactobacillus phage Lv-1, complete genome	3962-3991	0	1.0
NZ_CP018809_1	1.19\|1377773\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377773-1377802	30	EU871039	Lactobacillus phage Lv-1, complete genome	34069-34098	4	0.867
NZ_CP018809_1	1.21\|1377905\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377905-1377934	30	MN693707	Marine virus AFVG_250M784, complete genome	14595-14624	4	0.867
NZ_CP018809_1	1.43\|1377774\|30\|NZ_CP018809\|PILER-CR	1377774-1377803	30	EU871039	Lactobacillus phage Lv-1, complete genome	34069-34098	4	0.867
NZ_CP018809_1	1.45\|1377906\|30\|NZ_CP018809\|PILER-CR	1377906-1377935	30	MN693707	Marine virus AFVG_250M784, complete genome	14595-14624	4	0.867
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	MT074454	Salmonella phage ende, complete genome	90290-90319	5	0.833
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	MG065692	UNVERIFIED: Campylobacter phage C13, complete genome	7687-7716	5	0.833
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	KY775453	Salmonella phage Stp1 contig.00003 genomic sequence	3982-4011	5	0.833
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	MK972716	Salmonella phage SE8, complete genome	9164-9193	5	0.833
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NC_047754	Escherichia phage APCEc03, complete genome	3375-3404	5	0.833
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	MK373799	Escherichia phage vB_EcoS_EASG3, complete genome	28675-28704	5	0.833
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	MK373797	Escherichia phage vB_EcoS_HASG4, complete genome	28714-28743	5	0.833
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	MN445182	Salmonella phage vB_SalS_SA001, complete genome	25630-25659	5	0.833
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	AJ604531	Bacteriophage 5 tRNA gene region	1819-1848	5	0.833
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	KY114934	Salmonella phage SP01, complete genome	89618-89647	5	0.833
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	MK972715	Salmonella phage SE11, complete genome	41040-41069	5	0.833
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	LN887948	Escherichia phage slur09 genome assembly slu09, chromosome : 1	105059-105088	5	0.833
NZ_CP018809_1	1.21\|1377905\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377905-1377934	30	NZ_CP017104	Rhizobium gallicum strain IE4872 plasmid pRgalIE4872c, complete sequence	417146-417175	5	0.833
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	MT074454	Salmonella phage ende, complete genome	90290-90319	5	0.833
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	MG065692	UNVERIFIED: Campylobacter phage C13, complete genome	7687-7716	5	0.833
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	KY775453	Salmonella phage Stp1 contig.00003 genomic sequence	3982-4011	5	0.833
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	MK972716	Salmonella phage SE8, complete genome	9164-9193	5	0.833
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NC_047754	Escherichia phage APCEc03, complete genome	3375-3404	5	0.833
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	MK373799	Escherichia phage vB_EcoS_EASG3, complete genome	28675-28704	5	0.833
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	MK373797	Escherichia phage vB_EcoS_HASG4, complete genome	28714-28743	5	0.833
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	MN445182	Salmonella phage vB_SalS_SA001, complete genome	25630-25659	5	0.833
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	AJ604531	Bacteriophage 5 tRNA gene region	1819-1848	5	0.833
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	KY114934	Salmonella phage SP01, complete genome	89618-89647	5	0.833
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	MK972715	Salmonella phage SE11, complete genome	41040-41069	5	0.833
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	LN887948	Escherichia phage slur09 genome assembly slu09, chromosome : 1	105059-105088	5	0.833
NZ_CP018809_1	1.45\|1377906\|30\|NZ_CP018809\|PILER-CR	1377906-1377935	30	NZ_CP017104	Rhizobium gallicum strain IE4872 plasmid pRgalIE4872c, complete sequence	417146-417175	5	0.833
NZ_CP018809_1	1.5\|1376849\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376849-1376878	30	MN013077	Klebsiella phage vB_KaeM_KaOmega, complete genome	143430-143459	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NC_018265	Melissococcus plutonius DAT561 plasmid 1, complete sequence	120915-120944	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NC_018265	Melissococcus plutonius DAT561 plasmid 1, complete sequence	151203-151232	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NZ_CP006684	Melissococcus plutonius S1 plasmid pMEPL_178, complete sequence	46077-46106	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NZ_CP006684	Melissococcus plutonius S1 plasmid pMEPL_178, complete sequence	71527-71556	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NZ_AP021886	Melissococcus plutonius strain DAT1033 plasmid pMP1, complete sequence	46078-46107	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NZ_AP021886	Melissococcus plutonius strain DAT1033 plasmid pMP1, complete sequence	71525-71554	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NZ_AP018525	Melissococcus plutonius strain DAT585 plasmid pMP1, complete sequence	46095-46124	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NZ_AP018525	Melissococcus plutonius strain DAT585 plasmid pMP1, complete sequence	71627-71656	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	LR597659	Escherichia phage T5_ev212 genome assembly, chromosome: 1	30016-30045	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	217525-217554	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	248603-248632	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	252832-252861	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	629770-629799	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	210654-210683	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	215960-215989	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	230152-230181	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	MG592614	Vibrio phage 1.248.O._10N.261.54.F1, partial genome	21164-21193	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	MT311645	Salmonella phage vB_Sen-E22, complete genome	16978-17007	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	MG592477	Vibrio phage 1.105.O._10N.286.49.B4, partial genome	21745-21774	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	MG592622	Vibrio phage 1.256.O._10N.286.45.F8, partial genome	19952-19981	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	MN956514	Salmonella phage L6jm, complete genome	29444-29473	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	MH102285	Salmonella phage vB_SenS_PHB06, partial genome	73777-73806	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NC_047881	Shigella phage SSP1, complete genome	117-146	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	MN026741	Salmonella phage Th1, complete genome	29266-29295	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	MG592647	Vibrio phage 1.278.O._10N.286.54.E8, partial genome	21504-21533	6	0.8
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	MG592608	Vibrio phage 1.243.O._10N.261.54.B5, partial genome	20360-20389	6	0.8
NZ_CP018809_1	1.11\|1377245\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377245-1377274	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	309320-309349	6	0.8
NZ_CP018809_1	1.11\|1377245\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377245-1377274	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	203567-203596	6	0.8
NZ_CP018809_1	1.18\|1377707\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377707-1377736	30	MT080586	UNVERIFIED: Staphylococcus phage vB_SauM_EW2, complete genome	93512-93541	6	0.8
NZ_CP018809_1	1.18\|1377707\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377707-1377736	30	MT080594	UNVERIFIED: Staphylococcus phage vB_SauM_EW4, complete genome	7675-7704	6	0.8
NZ_CP018809_1	1.18\|1377707\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377707-1377736	30	MT080582	UNVERIFIED: Staphylococcus phage vB_SauM_EW1, complete genome	25578-25607	6	0.8
NZ_CP018809_1	1.29\|1376850\|30\|NZ_CP018809\|PILER-CR	1376850-1376879	30	MN013077	Klebsiella phage vB_KaeM_KaOmega, complete genome	143430-143459	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NC_018265	Melissococcus plutonius DAT561 plasmid 1, complete sequence	120915-120944	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NC_018265	Melissococcus plutonius DAT561 plasmid 1, complete sequence	151203-151232	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NZ_CP006684	Melissococcus plutonius S1 plasmid pMEPL_178, complete sequence	46077-46106	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NZ_CP006684	Melissococcus plutonius S1 plasmid pMEPL_178, complete sequence	71527-71556	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NZ_AP021886	Melissococcus plutonius strain DAT1033 plasmid pMP1, complete sequence	46078-46107	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NZ_AP021886	Melissococcus plutonius strain DAT1033 plasmid pMP1, complete sequence	71525-71554	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NZ_AP018525	Melissococcus plutonius strain DAT585 plasmid pMP1, complete sequence	46095-46124	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NZ_AP018525	Melissococcus plutonius strain DAT585 plasmid pMP1, complete sequence	71627-71656	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	LR597659	Escherichia phage T5_ev212 genome assembly, chromosome: 1	30016-30045	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	217525-217554	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	248603-248632	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	252832-252861	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	629770-629799	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	210654-210683	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	215960-215989	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	230152-230181	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	MG592614	Vibrio phage 1.248.O._10N.261.54.F1, partial genome	21164-21193	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	MT311645	Salmonella phage vB_Sen-E22, complete genome	16978-17007	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	MG592477	Vibrio phage 1.105.O._10N.286.49.B4, partial genome	21745-21774	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	MG592622	Vibrio phage 1.256.O._10N.286.45.F8, partial genome	19952-19981	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	MN956514	Salmonella phage L6jm, complete genome	29444-29473	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	MH102285	Salmonella phage vB_SenS_PHB06, partial genome	73777-73806	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NC_047881	Shigella phage SSP1, complete genome	117-146	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	MN026741	Salmonella phage Th1, complete genome	29266-29295	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	MG592647	Vibrio phage 1.278.O._10N.286.54.E8, partial genome	21504-21533	6	0.8
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	MG592608	Vibrio phage 1.243.O._10N.261.54.B5, partial genome	20360-20389	6	0.8
NZ_CP018809_1	1.35\|1377246\|30\|NZ_CP018809\|PILER-CR	1377246-1377275	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	309320-309349	6	0.8
NZ_CP018809_1	1.35\|1377246\|30\|NZ_CP018809\|PILER-CR	1377246-1377275	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	203567-203596	6	0.8
NZ_CP018809_1	1.42\|1377708\|30\|NZ_CP018809\|PILER-CR	1377708-1377737	30	MT080586	UNVERIFIED: Staphylococcus phage vB_SauM_EW2, complete genome	93512-93541	6	0.8
NZ_CP018809_1	1.42\|1377708\|30\|NZ_CP018809\|PILER-CR	1377708-1377737	30	MT080594	UNVERIFIED: Staphylococcus phage vB_SauM_EW4, complete genome	7675-7704	6	0.8
NZ_CP018809_1	1.42\|1377708\|30\|NZ_CP018809\|PILER-CR	1377708-1377737	30	MT080582	UNVERIFIED: Staphylococcus phage vB_SauM_EW1, complete genome	25578-25607	6	0.8
NZ_CP018809_1	1.4\|1376783\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376783-1376812	30	MH576972	Gordonia phage Beyoncage, complete genome	47934-47963	7	0.767
NZ_CP018809_1	1.4\|1376783\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376783-1376812	30	MT771348	Gordonia phage BiteSize, complete genome	48020-48049	7	0.767
NZ_CP018809_1	1.4\|1376783\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376783-1376812	30	MT771345	Gordonia phage Sienna, complete genome	48011-48040	7	0.767
NZ_CP018809_1	1.4\|1376783\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376783-1376812	30	MH271313	Gordonia phage Suzy, complete genome	48964-48993	7	0.767
NZ_CP018809_1	1.4\|1376783\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376783-1376812	30	NC_031001	Gordonia phage Terapin, complete genome	47935-47964	7	0.767
NZ_CP018809_1	1.4\|1376783\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376783-1376812	30	MH025890	Gordonia phage Djokovic, complete genome	47933-47962	7	0.767
NZ_CP018809_1	1.5\|1376849\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376849-1376878	30	NZ_CP012189	Lactobacillus paracasei strain CAUH35 plasmid unnamed2, complete sequence	35672-35701	7	0.767
NZ_CP018809_1	1.5\|1376849\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376849-1376878	30	NC_013544	Lactobacillus paracasei subsp. paracasei plasmid pCD02, complete sequence	6024-6053	7	0.767
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	MK448933	Streptococcus phage Javan420, complete genome	27427-27456	7	0.767
NZ_CP018809_1	1.9\|1377113\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377113-1377142	30	NZ_CP024772	Bacillus thuringiensis LM1212 plasmid pLM1, complete sequence	158924-158953	7	0.767
NZ_CP018809_1	1.9\|1377113\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377113-1377142	30	NZ_CP041074	Bacillus tropicus strain LM1212-W3 plasmid p1, complete sequence	136207-136236	7	0.767
NZ_CP018809_1	1.18\|1377707\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377707-1377736	30	NZ_MK323041	Acinetobacter seifertii strain Asp-1069 plasmid pAs1069_b, complete sequence	1155-1184	7	0.767
NZ_CP018809_1	1.28\|1376784\|30\|NZ_CP018809\|PILER-CR	1376784-1376813	30	MH576972	Gordonia phage Beyoncage, complete genome	47934-47963	7	0.767
NZ_CP018809_1	1.28\|1376784\|30\|NZ_CP018809\|PILER-CR	1376784-1376813	30	MT771348	Gordonia phage BiteSize, complete genome	48020-48049	7	0.767
NZ_CP018809_1	1.28\|1376784\|30\|NZ_CP018809\|PILER-CR	1376784-1376813	30	MT771345	Gordonia phage Sienna, complete genome	48011-48040	7	0.767
NZ_CP018809_1	1.28\|1376784\|30\|NZ_CP018809\|PILER-CR	1376784-1376813	30	MH271313	Gordonia phage Suzy, complete genome	48964-48993	7	0.767
NZ_CP018809_1	1.28\|1376784\|30\|NZ_CP018809\|PILER-CR	1376784-1376813	30	NC_031001	Gordonia phage Terapin, complete genome	47935-47964	7	0.767
NZ_CP018809_1	1.28\|1376784\|30\|NZ_CP018809\|PILER-CR	1376784-1376813	30	MH025890	Gordonia phage Djokovic, complete genome	47933-47962	7	0.767
NZ_CP018809_1	1.29\|1376850\|30\|NZ_CP018809\|PILER-CR	1376850-1376879	30	NZ_CP012189	Lactobacillus paracasei strain CAUH35 plasmid unnamed2, complete sequence	35672-35701	7	0.767
NZ_CP018809_1	1.29\|1376850\|30\|NZ_CP018809\|PILER-CR	1376850-1376879	30	NC_013544	Lactobacillus paracasei subsp. paracasei plasmid pCD02, complete sequence	6024-6053	7	0.767
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	MK448933	Streptococcus phage Javan420, complete genome	27427-27456	7	0.767
NZ_CP018809_1	1.33\|1377114\|30\|NZ_CP018809\|PILER-CR	1377114-1377143	30	NZ_CP024772	Bacillus thuringiensis LM1212 plasmid pLM1, complete sequence	158924-158953	7	0.767
NZ_CP018809_1	1.33\|1377114\|30\|NZ_CP018809\|PILER-CR	1377114-1377143	30	NZ_CP041074	Bacillus tropicus strain LM1212-W3 plasmid p1, complete sequence	136207-136236	7	0.767
NZ_CP018809_1	1.42\|1377708\|30\|NZ_CP018809\|PILER-CR	1377708-1377737	30	NZ_MK323041	Acinetobacter seifertii strain Asp-1069 plasmid pAs1069_b, complete sequence	1155-1184	7	0.767
NZ_CP018809_1	1.3\|1376717\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376717-1376746	30	NZ_AP017309	Leptolyngbya sp. NIES-3755 plasmid plasmid1 DNA, complete genome	268058-268087	8	0.733
NZ_CP018809_1	1.3\|1376717\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376717-1376746	30	NZ_CP051678	Spirosoma sp. CJU-R4 plasmid unnamed1, complete sequence	177251-177280	8	0.733
NZ_CP018809_1	1.4\|1376783\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376783-1376812	30	NZ_CP039285	Leptospira interrogans strain FMAS_AW1 plasmid pLiSL2, complete sequence	16625-16654	8	0.733
NZ_CP018809_1	1.4\|1376783\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376783-1376812	30	NZ_CP054832	Staphylococcus saprophyticus strain UTI-045 plasmid pUTI-045-1, complete sequence	8005-8034	8	0.733
NZ_CP018809_1	1.4\|1376783\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376783-1376812	30	NZ_CP054832	Staphylococcus saprophyticus strain UTI-045 plasmid pUTI-045-1, complete sequence	12614-12643	8	0.733
NZ_CP018809_1	1.4\|1376783\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376783-1376812	30	NZ_CP054436	Staphylococcus saprophyticus strain UTI-035 plasmid pUTI-035-2, complete sequence	33813-33842	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NZ_CP013280	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence	76969-76998	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NZ_CP039726	Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence	86015-86044	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NZ_CP009350	Bacillus thuringiensis HD1002 plasmid 4, complete sequence	105799-105828	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NC_018510	Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence	189861-189890	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NZ_CP026078	Staphylococcus aureus strain FDAARGOS_7 plasmid unnamed	2676-2705	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NZ_KY465818	Staphylococcus aureus subsp. aureus strain CC1 plasmid p140355, complete sequence	33152-33181	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NZ_KM521836	Staphylococcus epidermidis strain 12-00322 plasmid p12-00322, complete sequence	5404-5433	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NZ_KR230047	Staphylococcus epidermidis strain SP1 plasmid pSP01, complete sequence	5541-5570	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NZ_KT780704	Staphylococcus aureus subsp. aureus RN4220 plasmid pRM27, complete sequence	5088-5117	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NZ_KT780705	Staphylococcus aureus subsp. aureus RN4220 plasmid pGO400, complete sequence	5088-5117	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NZ_KT373969	Staphylococcus pseudintermedius strain HR547/11 plasmid pKM01, complete sequence	3187-3216	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NZ_KU882681	Staphylococcus lugdunensis strain Tlug15G-4 plasmid pT15G-1, complete sequence	7171-7200	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP030382	Staphylococcus aureus strain ER03761.3 plasmid unnamed1, complete sequence	34801-34830	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP030491	Staphylococcus aureus strain ER02837.3 plasmid unnamed1, complete sequence	34800-34829	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP030606	Staphylococcus aureus strain ER02693.3 plasmid unnamed1, complete sequence	11902-11931	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NC_013653	Staphylococcus aureus plasmid pPR9, complete sequence	27854-27883	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP030388	Staphylococcus aureus strain ER01062.3 plasmid unnamed2, complete sequence	23254-23283	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP030655	Staphylococcus aureus strain ER04448.3 plasmid unnamed1, complete sequence	27854-27883	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NC_007792	Staphylococcus aureus subsp. aureus USA300_FPR3757 plasmid pUSA03, complete sequence	12865-12894	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP030522	Staphylococcus aureus strain ER01564.3 plasmid unnamed2, complete sequence	30954-30983	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NC_005054	Staphylococcus aureus plasmid pLW043, complete sequence	7883-7912	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NZ_CP014419	Staphylococcus aureus strain USA300-SUR15 plasmid pUSA08-1-SUR15, complete sequence	27864-27893	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP030554	Staphylococcus aureus strain PS00003.3 plasmid unnamed1, complete sequence	34787-34816	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP030614	Staphylococcus aureus strain ER01560.3 plasmid unnamed1, complete sequence	39417-39446	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP030618	Staphylococcus aureus strain ER04440.3 plasmid unnamed1, complete sequence	34984-35013	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP030671	Staphylococcus aureus strain ER00951.3 plasmid unnamed2, complete sequence	8970-8999	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NC_012547	Staphylococcus aureus plasmid pGO1, complete sequence	26950-26979	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NC_005024	Staphylococcus aureus plasmid pSK41, complete sequence	26950-26979	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NC_013320	Staphylococcus aureus plasmid SAP014A, complete sequence	40586-40615	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NC_013342	Staphylococcus aureus plasmid SAP079A, complete sequence	31827-31856	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NC_013343	Staphylococcus aureus plasmid SAP080A, complete sequence	6054-6083	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NC_010279	Staphylococcus aureus plasmid pV030-8, complete sequence	4416-4445	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP030556	Staphylococcus aureus strain ER03750.3 plasmid unnamed1, complete sequence	28666-28695	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NC_018967	Staphylococcus aureus plasmid p18813-P03, complete sequence	4317-4346	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP030639	Staphylococcus aureus strain ER04165.3 plasmid unnamed1, complete sequence	34994-35023	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP030600	Staphylococcus aureus strain ER00658.3 plasmid unnamed1, complete sequence	19576-19605	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NZ_AP017321	Staphylococcus aureus strain MI plasmid pMI, complete sequence	41989-42018	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	AP012550	Staphylococcus aureus plasmid pN315G DNA, complete sequence, strain: N315G	23626-23655	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NZ_CP026963	Staphylococcus aureus strain FDAARGOS_6 plasmid unnamed1	30282-30311	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP030429	Staphylococcus aureus strain ER03760.3 plasmid unnamed1, complete sequence	34802-34831	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP030648	Staphylococcus aureus strain ER03556.3 plasmid unnamed1, complete sequence	32896-32925	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NC_020535	Staphylococcus aureus subsp. aureus ST228 plasmid pI5S5, complete sequence	12858-12887	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP030407	Staphylococcus aureus strain PS00002.3 plasmid unnamed1, complete sequence	34799-34828	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP030559	Staphylococcus aureus strain ER01457.3 plasmid unnamed1, complete sequence	10183-10212	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP030483	Staphylococcus aureus strain ER03913.3 plasmid unnamed2, complete sequence	25069-25098	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NZ_CP040620	Staphylococcus aureus strain J01 plasmid pJ01-01, complete sequence	17340-17369	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NZ_MH587578	Staphylococcus aureus strain WG1647 plasmid pWBG615, complete sequence	10394-10423	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP030591	Staphylococcus aureus strain ER02989.3 plasmid unnamed1, complete sequence	1458-1487	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP030453	Staphylococcus aureus strain PS00001.3 plasmid unnamed1, complete sequence	34797-34826	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NZ_KP670395	Staphylococcus schleiferi strain 5909-02 plasmid p5909-02, complete sequence	17764-17793	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NC_013338	Staphylococcus aureus plasmid SAP068A, complete sequence	43829-43858	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NC_013339	Staphylococcus aureus plasmid SAP069A, complete sequence	14611-14640	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	NC_013344	Staphylococcus aureus plasmid SAP082A, complete sequence	10809-10838	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP013960	Staphylococcus aureus strain V605 plasmid pV605, complete sequence	35123-35152	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP030538	Staphylococcus aureus strain ER02094.3 plasmid unnamed2, complete sequence	28461-28490	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP030435	Staphylococcus aureus strain ER00610.3 plasmid unnamed2, complete sequence	35413-35442	8	0.733
NZ_CP018809_1	1.7\|1376981\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376981-1377010	30	CP030526	Staphylococcus aureus strain ER02703.3 plasmid unnamed1, complete sequence	33406-33435	8	0.733
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	MK268686	Enterococcus phage vB_EfaH_EF1TV, complete genome	68446-68475	8	0.733
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	AP018715	Enterococcus phage phiM1EF22 DNA, complete sequence	31458-31487	8	0.733
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	MK721192	Enterococcus phage vB_EfaM_Ef2.3, complete genome	71417-71446	8	0.733
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	CAJDJZ010000002	Enterococcus phage vB_EfaH_149 genome assembly, contig: phage149-genome, whole genome shotgun sequence	33279-33308	8	0.733
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NC_029026	Enterococcus phage EFLK1, complete genome	97909-97938	8	0.733
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	AP018714	Enterococcus phage phiEF17H DNA, complete sequence	33259-33288	8	0.733
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	MK693030	Enterococcus phage vB_EfaM_Ef2.1, complete genome	67162-67191	8	0.733
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NC_009904	Enterococcus phage phiEF24C, complete genome	30713-30742	8	0.733
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	AP009390	Enterococcus phage phiEF24C DNA, complete genome	30713-30742	8	0.733
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	MN854830	Enterococcus phage PBEF129, complete genome	67366-67395	8	0.733
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	KJ801817	Enterococcus phage ECP3, complete genome	65248-65277	8	0.733
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	AB609718	Enterococcus phage phiEF24C-P2 DNA, complete genome	30713-30742	8	0.733
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NC_022778	Clostridium tetani 12124569 plasmid p12124569, complete sequence	5136-5165	8	0.733
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NZ_LR214939	Mycoplasma salivarium strain NCTC10113 plasmid 2	181758-181787	8	0.733
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	1201668-1201697	8	0.733
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NC_004565	Clostridium tetani E88 plasmid pE88, complete sequence	10141-10170	8	0.733
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	KC139528	Salmonella phage FSL SP-010 hypothetical proteins, lysin, and hypothetical proteins genes, complete cds; and tRNA-Pro, tRNA-Glu, tRNA-Met, tRNA-Asn, tRNA-Tyr, tRNA-Asp, tRNA-Lys, tRNA-Met, and tRNA-Ile genes, complete sequence	3033-3062	8	0.733
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	KC139543	Salmonella phage FSL SP-012 putative tail fiber protein gene, partial cds; hypothetical proteins, putative baseplate component, hypothetical protein, putative baseplate assembly protein, hypothetical proteins, structural protein, hypothetical proteins, major capsid protein, structural protein, putative prohead protease, hypothetical proteins, terminase large subunit, and hypothetical protein genes, complete cds; tRNA-Cys, tRNA-OTHER, tRNA-Phe, tRNA-OTHER, tRNA-Gln, tRNA-Leu, and tRNA-Gln genes, complete sequence; hypothetical protein gene, complete cds; tRNA-Arg, tRNA-Leu, tRNA-Val, tRNA-Thr, tRNA-Gly, tRNA-Ala, tRNA-Lys, tRNA-Leu, tRNA-OTHER, tRNA-Ile, tRNA-Met, tRNA-Lys, tRNA-Asp, tRNA-Tyr, tRNA-Asn, tRNA-Met, tRNA-Glu, and tRNA-Pro genes, complete sequence; and hypothetical proteins, lysin, and hypothetical proteins genes, complete cds	34197-34226	8	0.733
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	MN694536	Marine virus AFVG_250M991, complete genome	29064-29093	8	0.733
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	KR014248	Escherichia phage vB_EcoM_AYO145A, complete genome	17571-17600	8	0.733
NZ_CP018809_1	1.8\|1377047\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377047-1377076	30	NC_027337	Escherichia phage vB_EcoM-VpaE1, complete genome	16379-16408	8	0.733
NZ_CP018809_1	1.9\|1377113\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377113-1377142	30	CP016195	Bacillus thuringiensis serovar coreanensis strain ST7 plasmid pST7-1, complete sequence	98817-98846	8	0.733
NZ_CP018809_1	1.18\|1377707\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377707-1377736	30	MK170447	Methanosarcina virus MetMV, complete genome	37288-37317	8	0.733
NZ_CP018809_1	1.20\|1377839\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377839-1377868	30	NZ_KX258624	Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence	122797-122826	8	0.733
NZ_CP018809_1	1.22\|1377971\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377971-1378000	30	NZ_CP045196	Acinetobacter indicus strain TQ23 plasmid p23TQ-37k, complete sequence	9267-9296	8	0.733
NZ_CP018809_1	1.22\|1377971\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377971-1378000	30	AP013408	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C105A-MedDCM-OCT-S27-C54	27094-27123	8	0.733
NZ_CP018809_1	1.22\|1377971\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377971-1378000	30	AP013409	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C105A-MedDCM-OCT-S28-C49	11027-11056	8	0.733
NZ_CP018809_1	1.22\|1377971\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377971-1378000	30	MK250019	Prevotella phage Lak-A2, complete genome	188129-188158	8	0.733
NZ_CP018809_1	1.27\|1376718\|30\|NZ_CP018809\|PILER-CR	1376718-1376747	30	NZ_AP017309	Leptolyngbya sp. NIES-3755 plasmid plasmid1 DNA, complete genome	268058-268087	8	0.733
NZ_CP018809_1	1.27\|1376718\|30\|NZ_CP018809\|PILER-CR	1376718-1376747	30	NZ_CP051678	Spirosoma sp. CJU-R4 plasmid unnamed1, complete sequence	177251-177280	8	0.733
NZ_CP018809_1	1.28\|1376784\|30\|NZ_CP018809\|PILER-CR	1376784-1376813	30	NZ_CP039285	Leptospira interrogans strain FMAS_AW1 plasmid pLiSL2, complete sequence	16625-16654	8	0.733
NZ_CP018809_1	1.28\|1376784\|30\|NZ_CP018809\|PILER-CR	1376784-1376813	30	NZ_CP054832	Staphylococcus saprophyticus strain UTI-045 plasmid pUTI-045-1, complete sequence	8005-8034	8	0.733
NZ_CP018809_1	1.28\|1376784\|30\|NZ_CP018809\|PILER-CR	1376784-1376813	30	NZ_CP054832	Staphylococcus saprophyticus strain UTI-045 plasmid pUTI-045-1, complete sequence	12614-12643	8	0.733
NZ_CP018809_1	1.28\|1376784\|30\|NZ_CP018809\|PILER-CR	1376784-1376813	30	NZ_CP054436	Staphylococcus saprophyticus strain UTI-035 plasmid pUTI-035-2, complete sequence	33813-33842	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NZ_CP013280	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence	76969-76998	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NZ_CP039726	Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence	86015-86044	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NZ_CP009350	Bacillus thuringiensis HD1002 plasmid 4, complete sequence	105799-105828	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NC_018510	Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence	189861-189890	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NZ_CP026078	Staphylococcus aureus strain FDAARGOS_7 plasmid unnamed	2676-2705	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NZ_KY465818	Staphylococcus aureus subsp. aureus strain CC1 plasmid p140355, complete sequence	33152-33181	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NZ_KM521836	Staphylococcus epidermidis strain 12-00322 plasmid p12-00322, complete sequence	5404-5433	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NZ_KR230047	Staphylococcus epidermidis strain SP1 plasmid pSP01, complete sequence	5541-5570	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NZ_KT780704	Staphylococcus aureus subsp. aureus RN4220 plasmid pRM27, complete sequence	5088-5117	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NZ_KT780705	Staphylococcus aureus subsp. aureus RN4220 plasmid pGO400, complete sequence	5088-5117	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NZ_KT373969	Staphylococcus pseudintermedius strain HR547/11 plasmid pKM01, complete sequence	3187-3216	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NZ_KU882681	Staphylococcus lugdunensis strain Tlug15G-4 plasmid pT15G-1, complete sequence	7171-7200	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP030382	Staphylococcus aureus strain ER03761.3 plasmid unnamed1, complete sequence	34801-34830	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP030491	Staphylococcus aureus strain ER02837.3 plasmid unnamed1, complete sequence	34800-34829	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP030606	Staphylococcus aureus strain ER02693.3 plasmid unnamed1, complete sequence	11902-11931	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NC_013653	Staphylococcus aureus plasmid pPR9, complete sequence	27854-27883	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP030388	Staphylococcus aureus strain ER01062.3 plasmid unnamed2, complete sequence	23254-23283	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP030655	Staphylococcus aureus strain ER04448.3 plasmid unnamed1, complete sequence	27854-27883	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NC_007792	Staphylococcus aureus subsp. aureus USA300_FPR3757 plasmid pUSA03, complete sequence	12865-12894	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP030522	Staphylococcus aureus strain ER01564.3 plasmid unnamed2, complete sequence	30954-30983	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NC_005054	Staphylococcus aureus plasmid pLW043, complete sequence	7883-7912	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NZ_CP014419	Staphylococcus aureus strain USA300-SUR15 plasmid pUSA08-1-SUR15, complete sequence	27864-27893	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP030554	Staphylococcus aureus strain PS00003.3 plasmid unnamed1, complete sequence	34787-34816	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP030614	Staphylococcus aureus strain ER01560.3 plasmid unnamed1, complete sequence	39417-39446	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP030618	Staphylococcus aureus strain ER04440.3 plasmid unnamed1, complete sequence	34984-35013	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP030671	Staphylococcus aureus strain ER00951.3 plasmid unnamed2, complete sequence	8970-8999	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NC_012547	Staphylococcus aureus plasmid pGO1, complete sequence	26950-26979	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NC_005024	Staphylococcus aureus plasmid pSK41, complete sequence	26950-26979	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NC_013320	Staphylococcus aureus plasmid SAP014A, complete sequence	40586-40615	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NC_013342	Staphylococcus aureus plasmid SAP079A, complete sequence	31827-31856	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NC_013343	Staphylococcus aureus plasmid SAP080A, complete sequence	6054-6083	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NC_010279	Staphylococcus aureus plasmid pV030-8, complete sequence	4416-4445	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP030556	Staphylococcus aureus strain ER03750.3 plasmid unnamed1, complete sequence	28666-28695	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NC_018967	Staphylococcus aureus plasmid p18813-P03, complete sequence	4317-4346	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP030639	Staphylococcus aureus strain ER04165.3 plasmid unnamed1, complete sequence	34994-35023	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP030600	Staphylococcus aureus strain ER00658.3 plasmid unnamed1, complete sequence	19576-19605	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NZ_AP017321	Staphylococcus aureus strain MI plasmid pMI, complete sequence	41989-42018	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	AP012550	Staphylococcus aureus plasmid pN315G DNA, complete sequence, strain: N315G	23626-23655	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NZ_CP026963	Staphylococcus aureus strain FDAARGOS_6 plasmid unnamed1	30282-30311	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP030429	Staphylococcus aureus strain ER03760.3 plasmid unnamed1, complete sequence	34802-34831	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP030648	Staphylococcus aureus strain ER03556.3 plasmid unnamed1, complete sequence	32896-32925	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NC_020535	Staphylococcus aureus subsp. aureus ST228 plasmid pI5S5, complete sequence	12858-12887	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP030407	Staphylococcus aureus strain PS00002.3 plasmid unnamed1, complete sequence	34799-34828	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP030559	Staphylococcus aureus strain ER01457.3 plasmid unnamed1, complete sequence	10183-10212	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP030483	Staphylococcus aureus strain ER03913.3 plasmid unnamed2, complete sequence	25069-25098	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NZ_CP040620	Staphylococcus aureus strain J01 plasmid pJ01-01, complete sequence	17340-17369	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NZ_MH587578	Staphylococcus aureus strain WG1647 plasmid pWBG615, complete sequence	10394-10423	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP030591	Staphylococcus aureus strain ER02989.3 plasmid unnamed1, complete sequence	1458-1487	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP030453	Staphylococcus aureus strain PS00001.3 plasmid unnamed1, complete sequence	34797-34826	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NZ_KP670395	Staphylococcus schleiferi strain 5909-02 plasmid p5909-02, complete sequence	17764-17793	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NC_013338	Staphylococcus aureus plasmid SAP068A, complete sequence	43829-43858	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NC_013339	Staphylococcus aureus plasmid SAP069A, complete sequence	14611-14640	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	NC_013344	Staphylococcus aureus plasmid SAP082A, complete sequence	10809-10838	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP013960	Staphylococcus aureus strain V605 plasmid pV605, complete sequence	35123-35152	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP030538	Staphylococcus aureus strain ER02094.3 plasmid unnamed2, complete sequence	28461-28490	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP030435	Staphylococcus aureus strain ER00610.3 plasmid unnamed2, complete sequence	35413-35442	8	0.733
NZ_CP018809_1	1.31\|1376982\|30\|NZ_CP018809\|PILER-CR	1376982-1377011	30	CP030526	Staphylococcus aureus strain ER02703.3 plasmid unnamed1, complete sequence	33406-33435	8	0.733
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	MK268686	Enterococcus phage vB_EfaH_EF1TV, complete genome	68446-68475	8	0.733
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	AP018715	Enterococcus phage phiM1EF22 DNA, complete sequence	31458-31487	8	0.733
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	MK721192	Enterococcus phage vB_EfaM_Ef2.3, complete genome	71417-71446	8	0.733
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	CAJDJZ010000002	Enterococcus phage vB_EfaH_149 genome assembly, contig: phage149-genome, whole genome shotgun sequence	33279-33308	8	0.733
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NC_029026	Enterococcus phage EFLK1, complete genome	97909-97938	8	0.733
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	AP018714	Enterococcus phage phiEF17H DNA, complete sequence	33259-33288	8	0.733
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	MK693030	Enterococcus phage vB_EfaM_Ef2.1, complete genome	67162-67191	8	0.733
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NC_009904	Enterococcus phage phiEF24C, complete genome	30713-30742	8	0.733
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	AP009390	Enterococcus phage phiEF24C DNA, complete genome	30713-30742	8	0.733
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	MN854830	Enterococcus phage PBEF129, complete genome	67366-67395	8	0.733
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	KJ801817	Enterococcus phage ECP3, complete genome	65248-65277	8	0.733
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	AB609718	Enterococcus phage phiEF24C-P2 DNA, complete genome	30713-30742	8	0.733
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NC_022778	Clostridium tetani 12124569 plasmid p12124569, complete sequence	5136-5165	8	0.733
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NZ_LR214939	Mycoplasma salivarium strain NCTC10113 plasmid 2	181758-181787	8	0.733
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	1201668-1201697	8	0.733
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NC_004565	Clostridium tetani E88 plasmid pE88, complete sequence	10141-10170	8	0.733
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	KC139528	Salmonella phage FSL SP-010 hypothetical proteins, lysin, and hypothetical proteins genes, complete cds; and tRNA-Pro, tRNA-Glu, tRNA-Met, tRNA-Asn, tRNA-Tyr, tRNA-Asp, tRNA-Lys, tRNA-Met, and tRNA-Ile genes, complete sequence	3033-3062	8	0.733
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	KC139543	Salmonella phage FSL SP-012 putative tail fiber protein gene, partial cds; hypothetical proteins, putative baseplate component, hypothetical protein, putative baseplate assembly protein, hypothetical proteins, structural protein, hypothetical proteins, major capsid protein, structural protein, putative prohead protease, hypothetical proteins, terminase large subunit, and hypothetical protein genes, complete cds; tRNA-Cys, tRNA-OTHER, tRNA-Phe, tRNA-OTHER, tRNA-Gln, tRNA-Leu, and tRNA-Gln genes, complete sequence; hypothetical protein gene, complete cds; tRNA-Arg, tRNA-Leu, tRNA-Val, tRNA-Thr, tRNA-Gly, tRNA-Ala, tRNA-Lys, tRNA-Leu, tRNA-OTHER, tRNA-Ile, tRNA-Met, tRNA-Lys, tRNA-Asp, tRNA-Tyr, tRNA-Asn, tRNA-Met, tRNA-Glu, and tRNA-Pro genes, complete sequence; and hypothetical proteins, lysin, and hypothetical proteins genes, complete cds	34197-34226	8	0.733
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	MN694536	Marine virus AFVG_250M991, complete genome	29064-29093	8	0.733
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	KR014248	Escherichia phage vB_EcoM_AYO145A, complete genome	17571-17600	8	0.733
NZ_CP018809_1	1.32\|1377048\|30\|NZ_CP018809\|PILER-CR	1377048-1377077	30	NC_027337	Escherichia phage vB_EcoM-VpaE1, complete genome	16379-16408	8	0.733
NZ_CP018809_1	1.33\|1377114\|30\|NZ_CP018809\|PILER-CR	1377114-1377143	30	CP016195	Bacillus thuringiensis serovar coreanensis strain ST7 plasmid pST7-1, complete sequence	98817-98846	8	0.733
NZ_CP018809_1	1.42\|1377708\|30\|NZ_CP018809\|PILER-CR	1377708-1377737	30	MK170447	Methanosarcina virus MetMV, complete genome	37288-37317	8	0.733
NZ_CP018809_1	1.44\|1377840\|30\|NZ_CP018809\|PILER-CR	1377840-1377869	30	NZ_KX258624	Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence	122797-122826	8	0.733
NZ_CP018809_1	1.46\|1377972\|30\|NZ_CP018809\|PILER-CR	1377972-1378001	30	NZ_CP045196	Acinetobacter indicus strain TQ23 plasmid p23TQ-37k, complete sequence	9267-9296	8	0.733
NZ_CP018809_1	1.46\|1377972\|30\|NZ_CP018809\|PILER-CR	1377972-1378001	30	AP013408	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C105A-MedDCM-OCT-S27-C54	27094-27123	8	0.733
NZ_CP018809_1	1.46\|1377972\|30\|NZ_CP018809\|PILER-CR	1377972-1378001	30	AP013409	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C105A-MedDCM-OCT-S28-C49	11027-11056	8	0.733
NZ_CP018809_1	1.46\|1377972\|30\|NZ_CP018809\|PILER-CR	1377972-1378001	30	MK250019	Prevotella phage Lak-A2, complete genome	188129-188158	8	0.733
NZ_CP018809_1	1.4\|1376783\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1376783-1376812	30	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1252755-1252784	9	0.7
NZ_CP018809_1	1.10\|1377179\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377179-1377208	30	NZ_CP024012	Acinetobacter sp. LoGeW2-3 plasmid unnamed1, complete sequence	98002-98031	9	0.7
NZ_CP018809_1	1.11\|1377245\|30\|NZ_CP018809\|CRISPRCasFinder,CRT	1377245-1377274	30	NC_013793	Bacillus pseudofirmus OF4 plasmid pBpOF4-02, complete sequence	44039-44068	9	0.7
NZ_CP018809_1	1.28\|1376784\|30\|NZ_CP018809\|PILER-CR	1376784-1376813	30	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1252755-1252784	9	0.7
NZ_CP018809_1	1.34\|1377180\|30\|NZ_CP018809\|PILER-CR	1377180-1377209	30	NZ_CP024012	Acinetobacter sp. LoGeW2-3 plasmid unnamed1, complete sequence	98002-98031	9	0.7
NZ_CP018809_1	1.35\|1377246\|30\|NZ_CP018809\|PILER-CR	1377246-1377275	30	NC_013793	Bacillus pseudofirmus OF4 plasmid pBpOF4-02, complete sequence	44039-44068	9	0.7

1. spacer 1.9|1377113|30|NZ_CP018809|CRISPRCasFinder,CRT matches to EU871039 (Lactobacillus phage Lv-1, complete genome) position: , mismatch: 0, identity: 1.0

agccatctaatgcttcaggcttgatatatt	CRISPR spacer
agccatctaatgcttcaggcttgatatatt	Protospacer
******************************

2. spacer 1.33|1377114|30|NZ_CP018809|PILER-CR matches to EU871039 (Lactobacillus phage Lv-1, complete genome) position: , mismatch: 0, identity: 1.0

agccatctaatgcttcaggcttgatatatt	CRISPR spacer
agccatctaatgcttcaggcttgatatatt	Protospacer
******************************

3. spacer 1.19|1377773|30|NZ_CP018809|CRISPRCasFinder,CRT matches to EU871039 (Lactobacillus phage Lv-1, complete genome) position: , mismatch: 4, identity: 0.867

ttaaaaattacagtcaaggcatactttggt	CRISPR spacer
ctgaaaattacagtcaaagcatactttggc	Protospacer
.*.**************.***********.

4. spacer 1.21|1377905|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MN693707 (Marine virus AFVG_250M784, complete genome) position: , mismatch: 4, identity: 0.867

-ttgacgtaatgacctaattcgtgtcctgct	CRISPR spacer
gttcacg-aatgacctgattcgtctcctgct	Protospacer
 ** *** ********.****** *******

5. spacer 1.43|1377774|30|NZ_CP018809|PILER-CR matches to EU871039 (Lactobacillus phage Lv-1, complete genome) position: , mismatch: 4, identity: 0.867

ttaaaaattacagtcaaggcatactttggt	CRISPR spacer
ctgaaaattacagtcaaagcatactttggc	Protospacer
.*.**************.***********.

6. spacer 1.45|1377906|30|NZ_CP018809|PILER-CR matches to MN693707 (Marine virus AFVG_250M784, complete genome) position: , mismatch: 4, identity: 0.867

-ttgacgtaatgacctaattcgtgtcctgct	CRISPR spacer
gttcacg-aatgacctgattcgtctcctgct	Protospacer
 ** *** ********.****** *******

7. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MT074454 (Salmonella phage ende, complete genome) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatacg	Protospacer
*.*********** *********** *  *

8. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MG065692 (UNVERIFIED: Campylobacter phage C13, complete genome) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaggctgaaaaagcatatg	Protospacer
*.*********** *********** *  *

9. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to KY775453 (Salmonella phage Stp1 contig.00003 genomic sequence) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatatg	Protospacer
*.*********** *********** *  *

10. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MK972716 (Salmonella phage SE8, complete genome) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatacg	Protospacer
*.*********** *********** *  *

11. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_047754 (Escherichia phage APCEc03, complete genome) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatatg	Protospacer
*.*********** *********** *  *

12. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MK373799 (Escherichia phage vB_EcoS_EASG3, complete genome) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatacg	Protospacer
*.*********** *********** *  *

13. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MK373797 (Escherichia phage vB_EcoS_HASG4, complete genome) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatacg	Protospacer
*.*********** *********** *  *

14. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MN445182 (Salmonella phage vB_SalS_SA001, complete genome) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatatg	Protospacer
*.*********** *********** *  *

15. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to AJ604531 (Bacteriophage 5 tRNA gene region) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatatg	Protospacer
*.*********** *********** *  *

16. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to KY114934 (Salmonella phage SP01, complete genome) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatatg	Protospacer
*.*********** *********** *  *

17. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MK972715 (Salmonella phage SE11, complete genome) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatacg	Protospacer
*.*********** *********** *  *

18. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to LN887948 (Escherichia phage slur09 genome assembly slu09, chromosome : 1) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatatg	Protospacer
*.*********** *********** *  *

19. spacer 1.21|1377905|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP017104 (Rhizobium gallicum strain IE4872 plasmid pRgalIE4872c, complete sequence) position: , mismatch: 5, identity: 0.833

ttgacg-taatgacctaattcgtgtcctgct	CRISPR spacer
-tgatgatattgacctagttcgtgtcctgca	Protospacer
 ***.* ** *******.************

20. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to MT074454 (Salmonella phage ende, complete genome) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatacg	Protospacer
*.*********** *********** *  *

21. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to MG065692 (UNVERIFIED: Campylobacter phage C13, complete genome) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaggctgaaaaagcatatg	Protospacer
*.*********** *********** *  *

22. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to KY775453 (Salmonella phage Stp1 contig.00003 genomic sequence) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatatg	Protospacer
*.*********** *********** *  *

23. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to MK972716 (Salmonella phage SE8, complete genome) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatacg	Protospacer
*.*********** *********** *  *

24. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NC_047754 (Escherichia phage APCEc03, complete genome) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatatg	Protospacer
*.*********** *********** *  *

25. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to MK373799 (Escherichia phage vB_EcoS_EASG3, complete genome) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatacg	Protospacer
*.*********** *********** *  *

26. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to MK373797 (Escherichia phage vB_EcoS_HASG4, complete genome) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatacg	Protospacer
*.*********** *********** *  *

27. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to MN445182 (Salmonella phage vB_SalS_SA001, complete genome) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatatg	Protospacer
*.*********** *********** *  *

28. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to AJ604531 (Bacteriophage 5 tRNA gene region) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatatg	Protospacer
*.*********** *********** *  *

29. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to KY114934 (Salmonella phage SP01, complete genome) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatatg	Protospacer
*.*********** *********** *  *

30. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to MK972715 (Salmonella phage SE11, complete genome) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatacg	Protospacer
*.*********** *********** *  *

31. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to LN887948 (Escherichia phage slur09 genome assembly slu09, chromosome : 1) position: , mismatch: 5, identity: 0.833

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatatg	Protospacer
*.*********** *********** *  *

32. spacer 1.45|1377906|30|NZ_CP018809|PILER-CR matches to NZ_CP017104 (Rhizobium gallicum strain IE4872 plasmid pRgalIE4872c, complete sequence) position: , mismatch: 5, identity: 0.833

ttgacg-taatgacctaattcgtgtcctgct	CRISPR spacer
-tgatgatattgacctagttcgtgtcctgca	Protospacer
 ***.* ** *******.************

33. spacer 1.5|1376849|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MN013077 (Klebsiella phage vB_KaeM_KaOmega, complete genome) position: , mismatch: 6, identity: 0.8

tagctcatcggcaatttcctgcaaaaattt	CRISPR spacer
tgtttcatcggcactctcctgcaaaaattg	Protospacer
*. .********* *.*************

34. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_018265 (Melissococcus plutonius DAT561 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
ggtcaaaaaatgatgctaaaaaagcattag	Protospacer
.  * ************.******* ****

35. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_018265 (Melissococcus plutonius DAT561 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
ggtcaaaaaatgatgctaaaaaagcattag	Protospacer
.  * ************.******* ****

36. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP006684 (Melissococcus plutonius S1 plasmid pMEPL_178, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
ggtcaaaaaatgatgctaaaaaagcattag	Protospacer
.  * ************.******* ****

37. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP006684 (Melissococcus plutonius S1 plasmid pMEPL_178, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
ggtcaaaaaatgatgctaaaaaagcattag	Protospacer
.  * ************.******* ****

38. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_AP021886 (Melissococcus plutonius strain DAT1033 plasmid pMP1, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
ggtcaaaaaatgatgctaaaaaagcattag	Protospacer
.  * ************.******* ****

39. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_AP021886 (Melissococcus plutonius strain DAT1033 plasmid pMP1, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
ggtcaaaaaatgatgctaaaaaagcattag	Protospacer
.  * ************.******* ****

40. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_AP018525 (Melissococcus plutonius strain DAT585 plasmid pMP1, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
ggtcaaaaaatgatgctaaaaaagcattag	Protospacer
.  * ************.******* ****

41. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_AP018525 (Melissococcus plutonius strain DAT585 plasmid pMP1, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
ggtcaaaaaatgatgctaaaaaagcattag	Protospacer
.  * ************.******* ****

42. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to LR597659 (Escherichia phage T5_ev212 genome assembly, chromosome: 1) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatatt	Protospacer
*.*********** *********** *

43. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
acactaaaaaaaatgctgaaaaactttcgg	Protospacer
********** .*********** .**..*

44. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
acactaaaaaaaatgctgaaaaactttcgg	Protospacer
********** .*********** .**..*

45. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
acactaaaaaaaatgctgaaaaactttcgg	Protospacer
********** .*********** .**..*

46. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
acactaaaaaaaatgctgaaaaactttcgg	Protospacer
********** .*********** .**..*

47. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
acactaaaaaaaatgctgaaaaaatttcgg	Protospacer
********** .***********..**..*

48. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
acactaaaaaaaatgctgaaaaactttcgg	Protospacer
********** .*********** .**..*

49. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
acactaaaaaaaatgctgaaaaactttcgg	Protospacer
********** .*********** .**..*

50. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MG592614 (Vibrio phage 1.248.O._10N.261.54.F1, partial genome) position: , mismatch: 6, identity: 0.8

acacta-aaaatgatgctgaaaaagctttag	CRISPR spacer
-cgttagaaaatgatgatgacaaagctttaa	Protospacer
 *..** ********* *** *********.

51. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MT311645 (Salmonella phage vB_Sen-E22, complete genome) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaagaagcatacg	Protospacer
*.*********** ******.**** *  *

52. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MG592477 (Vibrio phage 1.105.O._10N.286.49.B4, partial genome) position: , mismatch: 6, identity: 0.8

acacta-aaaatgatgctgaaaaagctttag	CRISPR spacer
-cgttagaaaatgatgatgacaaagctttaa	Protospacer
 *..** ********* *** *********.

53. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MG592622 (Vibrio phage 1.256.O._10N.286.45.F8, partial genome) position: , mismatch: 6, identity: 0.8

acacta-aaaatgatgctgaaaaagctttag	CRISPR spacer
-cgttagaaaatgatgatgacaaagctttaa	Protospacer
 *..** ********* *** *********.

54. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MN956514 (Salmonella phage L6jm, complete genome) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaagaagcatatg	Protospacer
*.*********** ******.**** *  *

55. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MH102285 (Salmonella phage vB_SenS_PHB06, partial genome) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaagaagcatacg	Protospacer
*.*********** ******.**** *  *

56. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_047881 (Shigella phage SSP1, complete genome) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaagaagcatatg	Protospacer
*.*********** ******.**** *  *

57. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MN026741 (Salmonella phage Th1, complete genome) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaagaagcatacg	Protospacer
*.*********** ******.**** *  *

58. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MG592647 (Vibrio phage 1.278.O._10N.286.54.E8, partial genome) position: , mismatch: 6, identity: 0.8

acacta-aaaatgatgctgaaaaagctttag	CRISPR spacer
-cgttagaaaatgatgatgacaaagctttaa	Protospacer
 *..** ********* *** *********.

59. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MG592608 (Vibrio phage 1.243.O._10N.261.54.B5, partial genome) position: , mismatch: 6, identity: 0.8

acacta-aaaatgatgctgaaaaagctttag	CRISPR spacer
-cgttagaaaatgatgatgacaaagctttaa	Protospacer
 *..** ********* *** *********.

60. spacer 1.11|1377245|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

ttacatgtatgtatgcagattaaaatagag	CRISPR spacer
ttacatgtatgtatggagataaaaagcaat	Protospacer
*************** **** ****  .*

61. spacer 1.11|1377245|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

ttacatgtatgtatgcagattaaaatagag	CRISPR spacer
ttacatgtatgtatggagataaaaagcaat	Protospacer
*************** **** ****  .*

62. spacer 1.18|1377707|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MT080586 (UNVERIFIED: Staphylococcus phage vB_SauM_EW2, complete genome) position: , mismatch: 6, identity: 0.8

gacgcagacaatatagcaaaagcagtttta	CRISPR spacer
tacgcagaaaatatagcaaaagaagaattt	Protospacer
 ******* ************* **  **

63. spacer 1.18|1377707|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MT080594 (UNVERIFIED: Staphylococcus phage vB_SauM_EW4, complete genome) position: , mismatch: 6, identity: 0.8

gacgcagacaatatagcaaaagcagtttta	CRISPR spacer
tacgcagaaaatatagcaaaagaagaattt	Protospacer
 ******* ************* **  **

64. spacer 1.18|1377707|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MT080582 (UNVERIFIED: Staphylococcus phage vB_SauM_EW1, complete genome) position: , mismatch: 6, identity: 0.8

gacgcagacaatatagcaaaagcagtttta	CRISPR spacer
tacgcagaaaatatagcaaaagaagaattt	Protospacer
 ******* ************* **  **

65. spacer 1.29|1376850|30|NZ_CP018809|PILER-CR matches to MN013077 (Klebsiella phage vB_KaeM_KaOmega, complete genome) position: , mismatch: 6, identity: 0.8

tagctcatcggcaatttcctgcaaaaattt	CRISPR spacer
tgtttcatcggcactctcctgcaaaaattg	Protospacer
*. .********* *.*************

66. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NC_018265 (Melissococcus plutonius DAT561 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
ggtcaaaaaatgatgctaaaaaagcattag	Protospacer
.  * ************.******* ****

67. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NC_018265 (Melissococcus plutonius DAT561 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
ggtcaaaaaatgatgctaaaaaagcattag	Protospacer
.  * ************.******* ****

68. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NZ_CP006684 (Melissococcus plutonius S1 plasmid pMEPL_178, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
ggtcaaaaaatgatgctaaaaaagcattag	Protospacer
.  * ************.******* ****

69. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NZ_CP006684 (Melissococcus plutonius S1 plasmid pMEPL_178, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
ggtcaaaaaatgatgctaaaaaagcattag	Protospacer
.  * ************.******* ****

70. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NZ_AP021886 (Melissococcus plutonius strain DAT1033 plasmid pMP1, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
ggtcaaaaaatgatgctaaaaaagcattag	Protospacer
.  * ************.******* ****

71. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NZ_AP021886 (Melissococcus plutonius strain DAT1033 plasmid pMP1, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
ggtcaaaaaatgatgctaaaaaagcattag	Protospacer
.  * ************.******* ****

72. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NZ_AP018525 (Melissococcus plutonius strain DAT585 plasmid pMP1, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
ggtcaaaaaatgatgctaaaaaagcattag	Protospacer
.  * ************.******* ****

73. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NZ_AP018525 (Melissococcus plutonius strain DAT585 plasmid pMP1, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
ggtcaaaaaatgatgctaaaaaagcattag	Protospacer
.  * ************.******* ****

74. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to LR597659 (Escherichia phage T5_ev212 genome assembly, chromosome: 1) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaaaaagcatatt	Protospacer
*.*********** *********** *

75. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
acactaaaaaaaatgctgaaaaactttcgg	Protospacer
********** .*********** .**..*

76. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
acactaaaaaaaatgctgaaaaactttcgg	Protospacer
********** .*********** .**..*

77. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
acactaaaaaaaatgctgaaaaactttcgg	Protospacer
********** .*********** .**..*

78. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
acactaaaaaaaatgctgaaaaactttcgg	Protospacer
********** .*********** .**..*

79. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
acactaaaaaaaatgctgaaaaaatttcgg	Protospacer
********** .***********..**..*

80. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
acactaaaaaaaatgctgaaaaactttcgg	Protospacer
********** .*********** .**..*

81. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
acactaaaaaaaatgctgaaaaactttcgg	Protospacer
********** .*********** .**..*

82. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to MG592614 (Vibrio phage 1.248.O._10N.261.54.F1, partial genome) position: , mismatch: 6, identity: 0.8

acacta-aaaatgatgctgaaaaagctttag	CRISPR spacer
-cgttagaaaatgatgatgacaaagctttaa	Protospacer
 *..** ********* *** *********.

83. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to MT311645 (Salmonella phage vB_Sen-E22, complete genome) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaagaagcatacg	Protospacer
*.*********** ******.**** *  *

84. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to MG592477 (Vibrio phage 1.105.O._10N.286.49.B4, partial genome) position: , mismatch: 6, identity: 0.8

acacta-aaaatgatgctgaaaaagctttag	CRISPR spacer
-cgttagaaaatgatgatgacaaagctttaa	Protospacer
 *..** ********* *** *********.

85. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to MG592622 (Vibrio phage 1.256.O._10N.286.45.F8, partial genome) position: , mismatch: 6, identity: 0.8

acacta-aaaatgatgctgaaaaagctttag	CRISPR spacer
-cgttagaaaatgatgatgacaaagctttaa	Protospacer
 *..** ********* *** *********.

86. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to MN956514 (Salmonella phage L6jm, complete genome) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaagaagcatatg	Protospacer
*.*********** ******.**** *  *

87. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to MH102285 (Salmonella phage vB_SenS_PHB06, partial genome) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaagaagcatacg	Protospacer
*.*********** ******.**** *  *

88. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NC_047881 (Shigella phage SSP1, complete genome) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaagaagcatatg	Protospacer
*.*********** ******.**** *  *

89. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to MN026741 (Salmonella phage Th1, complete genome) position: , mismatch: 6, identity: 0.8

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atactaaaaatgaagctgaagaagcatacg	Protospacer
*.*********** ******.**** *  *

90. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to MG592647 (Vibrio phage 1.278.O._10N.286.54.E8, partial genome) position: , mismatch: 6, identity: 0.8

acacta-aaaatgatgctgaaaaagctttag	CRISPR spacer
-cgttagaaaatgatgatgacaaagctttaa	Protospacer
 *..** ********* *** *********.

91. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to MG592608 (Vibrio phage 1.243.O._10N.261.54.B5, partial genome) position: , mismatch: 6, identity: 0.8

acacta-aaaatgatgctgaaaaagctttag	CRISPR spacer
-cgttagaaaatgatgatgacaaagctttaa	Protospacer
 *..** ********* *** *********.

92. spacer 1.35|1377246|30|NZ_CP018809|PILER-CR matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

ttacatgtatgtatgcagattaaaatagag	CRISPR spacer
ttacatgtatgtatggagataaaaagcaat	Protospacer
*************** **** ****  .*

93. spacer 1.35|1377246|30|NZ_CP018809|PILER-CR matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

ttacatgtatgtatgcagattaaaatagag	CRISPR spacer
ttacatgtatgtatggagataaaaagcaat	Protospacer
*************** **** ****  .*

94. spacer 1.42|1377708|30|NZ_CP018809|PILER-CR matches to MT080586 (UNVERIFIED: Staphylococcus phage vB_SauM_EW2, complete genome) position: , mismatch: 6, identity: 0.8

gacgcagacaatatagcaaaagcagtttta	CRISPR spacer
tacgcagaaaatatagcaaaagaagaattt	Protospacer
 ******* ************* **  **

95. spacer 1.42|1377708|30|NZ_CP018809|PILER-CR matches to MT080594 (UNVERIFIED: Staphylococcus phage vB_SauM_EW4, complete genome) position: , mismatch: 6, identity: 0.8

gacgcagacaatatagcaaaagcagtttta	CRISPR spacer
tacgcagaaaatatagcaaaagaagaattt	Protospacer
 ******* ************* **  **

96. spacer 1.42|1377708|30|NZ_CP018809|PILER-CR matches to MT080582 (UNVERIFIED: Staphylococcus phage vB_SauM_EW1, complete genome) position: , mismatch: 6, identity: 0.8

gacgcagacaatatagcaaaagcagtttta	CRISPR spacer
tacgcagaaaatatagcaaaagaagaattt	Protospacer
 ******* ************* **  **

97. spacer 1.4|1376783|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MH576972 (Gordonia phage Beyoncage, complete genome) position: , mismatch: 7, identity: 0.767

ttagaaacattaatcttattgtctttagcc	CRISPR spacer
ggtccaacaggaatcttattgtctttagcc	Protospacer
     ****  *******************

98. spacer 1.4|1376783|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MT771348 (Gordonia phage BiteSize, complete genome) position: , mismatch: 7, identity: 0.767

ttagaaacattaatcttattgtctttagcc	CRISPR spacer
ggtccaacaggaatcttattgtctttagcc	Protospacer
     ****  *******************

99. spacer 1.4|1376783|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MT771345 (Gordonia phage Sienna, complete genome) position: , mismatch: 7, identity: 0.767

ttagaaacattaatcttattgtctttagcc	CRISPR spacer
ggtccaacaggaatcttattgtctttagcc	Protospacer
     ****  *******************

100. spacer 1.4|1376783|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MH271313 (Gordonia phage Suzy, complete genome) position: , mismatch: 7, identity: 0.767

ttagaaacattaatcttattgtctttagcc	CRISPR spacer
ggtccaacaggaatcttattgtctttagcc	Protospacer
     ****  *******************

101. spacer 1.4|1376783|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_031001 (Gordonia phage Terapin, complete genome) position: , mismatch: 7, identity: 0.767

ttagaaacattaatcttattgtctttagcc	CRISPR spacer
ggtccaacaggaatcttattgtctttagcc	Protospacer
     ****  *******************

102. spacer 1.4|1376783|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MH025890 (Gordonia phage Djokovic, complete genome) position: , mismatch: 7, identity: 0.767

ttagaaacattaatcttattgtctttagcc	CRISPR spacer
ggtccaacaggaatcttattgtctttagcc	Protospacer
     ****  *******************

103. spacer 1.5|1376849|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP012189 (Lactobacillus paracasei strain CAUH35 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

tagctcatcggcaatttcctgcaaaaattt	CRISPR spacer
gcgctgatcgtcaatttcctgcaaaaaggg	Protospacer
  *** **** ****************

104. spacer 1.5|1376849|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_013544 (Lactobacillus paracasei subsp. paracasei plasmid pCD02, complete sequence) position: , mismatch: 7, identity: 0.767

tagctcatcggcaatttcctgcaaaaattt	CRISPR spacer
tgactaatcgtcaatttcctgcaaaagggt	Protospacer
*..** **** ***************.  *

105. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MK448933 (Streptococcus phage Javan420, complete genome) position: , mismatch: 7, identity: 0.767

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
ttgttaaaaataatgctgaaaaagctaaag	Protospacer
 ...*******.**************  **

106. spacer 1.9|1377113|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP024772 (Bacillus thuringiensis LM1212 plasmid pLM1, complete sequence) position: , mismatch: 7, identity: 0.767

agccatctaatgcttcaggcttgatatatt	CRISPR spacer
catcaaaaaatgcttcaggcttgatatatg	Protospacer
 ..**   *********************

107. spacer 1.9|1377113|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP041074 (Bacillus tropicus strain LM1212-W3 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

agccatctaatgcttcaggcttgatatatt	CRISPR spacer
catcaaaaaatgcttcaggcttgatatatg	Protospacer
 ..**   *********************

108. spacer 1.18|1377707|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_MK323041 (Acinetobacter seifertii strain Asp-1069 plasmid pAs1069_b, complete sequence) position: , mismatch: 7, identity: 0.767

gacgcagacaatatagcaaaagcagtttta	CRISPR spacer
gagagatccaatacagcaaaagcagttttt	Protospacer
** . *  *****.***************

109. spacer 1.28|1376784|30|NZ_CP018809|PILER-CR matches to MH576972 (Gordonia phage Beyoncage, complete genome) position: , mismatch: 7, identity: 0.767

ttagaaacattaatcttattgtctttagcc	CRISPR spacer
ggtccaacaggaatcttattgtctttagcc	Protospacer
     ****  *******************

110. spacer 1.28|1376784|30|NZ_CP018809|PILER-CR matches to MT771348 (Gordonia phage BiteSize, complete genome) position: , mismatch: 7, identity: 0.767

ttagaaacattaatcttattgtctttagcc	CRISPR spacer
ggtccaacaggaatcttattgtctttagcc	Protospacer
     ****  *******************

111. spacer 1.28|1376784|30|NZ_CP018809|PILER-CR matches to MT771345 (Gordonia phage Sienna, complete genome) position: , mismatch: 7, identity: 0.767

ttagaaacattaatcttattgtctttagcc	CRISPR spacer
ggtccaacaggaatcttattgtctttagcc	Protospacer
     ****  *******************

112. spacer 1.28|1376784|30|NZ_CP018809|PILER-CR matches to MH271313 (Gordonia phage Suzy, complete genome) position: , mismatch: 7, identity: 0.767

ttagaaacattaatcttattgtctttagcc	CRISPR spacer
ggtccaacaggaatcttattgtctttagcc	Protospacer
     ****  *******************

113. spacer 1.28|1376784|30|NZ_CP018809|PILER-CR matches to NC_031001 (Gordonia phage Terapin, complete genome) position: , mismatch: 7, identity: 0.767

ttagaaacattaatcttattgtctttagcc	CRISPR spacer
ggtccaacaggaatcttattgtctttagcc	Protospacer
     ****  *******************

114. spacer 1.28|1376784|30|NZ_CP018809|PILER-CR matches to MH025890 (Gordonia phage Djokovic, complete genome) position: , mismatch: 7, identity: 0.767

ttagaaacattaatcttattgtctttagcc	CRISPR spacer
ggtccaacaggaatcttattgtctttagcc	Protospacer
     ****  *******************

115. spacer 1.29|1376850|30|NZ_CP018809|PILER-CR matches to NZ_CP012189 (Lactobacillus paracasei strain CAUH35 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

tagctcatcggcaatttcctgcaaaaattt	CRISPR spacer
gcgctgatcgtcaatttcctgcaaaaaggg	Protospacer
  *** **** ****************

116. spacer 1.29|1376850|30|NZ_CP018809|PILER-CR matches to NC_013544 (Lactobacillus paracasei subsp. paracasei plasmid pCD02, complete sequence) position: , mismatch: 7, identity: 0.767

tagctcatcggcaatttcctgcaaaaattt	CRISPR spacer
tgactaatcgtcaatttcctgcaaaagggt	Protospacer
*..** **** ***************.  *

117. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to MK448933 (Streptococcus phage Javan420, complete genome) position: , mismatch: 7, identity: 0.767

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
ttgttaaaaataatgctgaaaaagctaaag	Protospacer
 ...*******.**************  **

118. spacer 1.33|1377114|30|NZ_CP018809|PILER-CR matches to NZ_CP024772 (Bacillus thuringiensis LM1212 plasmid pLM1, complete sequence) position: , mismatch: 7, identity: 0.767

agccatctaatgcttcaggcttgatatatt	CRISPR spacer
catcaaaaaatgcttcaggcttgatatatg	Protospacer
 ..**   *********************

119. spacer 1.33|1377114|30|NZ_CP018809|PILER-CR matches to NZ_CP041074 (Bacillus tropicus strain LM1212-W3 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

agccatctaatgcttcaggcttgatatatt	CRISPR spacer
catcaaaaaatgcttcaggcttgatatatg	Protospacer
 ..**   *********************

120. spacer 1.42|1377708|30|NZ_CP018809|PILER-CR matches to NZ_MK323041 (Acinetobacter seifertii strain Asp-1069 plasmid pAs1069_b, complete sequence) position: , mismatch: 7, identity: 0.767

gacgcagacaatatagcaaaagcagtttta	CRISPR spacer
gagagatccaatacagcaaaagcagttttt	Protospacer
** . *  *****.***************

121. spacer 1.3|1376717|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_AP017309 (Leptolyngbya sp. NIES-3755 plasmid plasmid1 DNA, complete genome) position: , mismatch: 8, identity: 0.733

atcttttctgcaactgcccattctggtagt	CRISPR spacer
cgctttgctgcaattgcccattctgcgatc	Protospacer
  **** ******.***********  * .

122. spacer 1.3|1376717|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP051678 (Spirosoma sp. CJU-R4 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

atcttttctgcaactgcccattctggtagt	CRISPR spacer
ctggaggctgcaactgccctttctggtggt	Protospacer
 *     ************ *******.**

123. spacer 1.4|1376783|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP039285 (Leptospira interrogans strain FMAS_AW1 plasmid pLiSL2, complete sequence) position: , mismatch: 8, identity: 0.733

ttagaaacattaatcttattgtctttagcc	CRISPR spacer
ttagaattattaatcttattgtcaacattg	Protospacer
****** .***************  .* .

124. spacer 1.4|1376783|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP054832 (Staphylococcus saprophyticus strain UTI-045 plasmid pUTI-045-1, complete sequence) position: , mismatch: 8, identity: 0.733

ttagaaacattaatcttattgtctttagcc	CRISPR spacer
acaattacatttatgttattgtctttagct	Protospacer
 .*.  ***** ** **************.

125. spacer 1.4|1376783|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP054832 (Staphylococcus saprophyticus strain UTI-045 plasmid pUTI-045-1, complete sequence) position: , mismatch: 8, identity: 0.733

ttagaaacattaatcttattgtctttagcc	CRISPR spacer
acaattacatttatgttattgtctttagct	Protospacer
 .*.  ***** ** **************.

126. spacer 1.4|1376783|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP054436 (Staphylococcus saprophyticus strain UTI-035 plasmid pUTI-035-2, complete sequence) position: , mismatch: 8, identity: 0.733

ttagaaacattaatcttattgtctttagcc	CRISPR spacer
acaattacattaatgttattttctttagct	Protospacer
 .*.  ******** ***** ********.

127. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP013280 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
agcaagcttgacaaagaaattgaaaacttc	Protospacer
*. **********.***********..  .

128. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP039726 (Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
agcaagcttgacaaagaaattgaaaacttc	Protospacer
*. **********.***********..  .

129. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP009350 (Bacillus thuringiensis HD1002 plasmid 4, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
agcaagcttgacaaagaaattgaaaacttc	Protospacer
*. **********.***********..  .

130. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_018510 (Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
agcaagcttgacaaagaaattgaaaacttc	Protospacer
*. **********.***********..  .

131. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP026078 (Staphylococcus aureus strain FDAARGOS_7 plasmid unnamed) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

132. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_KY465818 (Staphylococcus aureus subsp. aureus strain CC1 plasmid p140355, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

133. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_KM521836 (Staphylococcus epidermidis strain 12-00322 plasmid p12-00322, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

134. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_KR230047 (Staphylococcus epidermidis strain SP1 plasmid pSP01, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

135. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_KT780704 (Staphylococcus aureus subsp. aureus RN4220 plasmid pRM27, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

136. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_KT780705 (Staphylococcus aureus subsp. aureus RN4220 plasmid pGO400, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

137. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_KT373969 (Staphylococcus pseudintermedius strain HR547/11 plasmid pKM01, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

138. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_KU882681 (Staphylococcus lugdunensis strain Tlug15G-4 plasmid pT15G-1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

139. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP030382 (Staphylococcus aureus strain ER03761.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

140. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP030491 (Staphylococcus aureus strain ER02837.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

141. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP030606 (Staphylococcus aureus strain ER02693.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

142. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_013653 (Staphylococcus aureus plasmid pPR9, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

143. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP030388 (Staphylococcus aureus strain ER01062.3 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

144. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP030655 (Staphylococcus aureus strain ER04448.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

145. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_007792 (Staphylococcus aureus subsp. aureus USA300_FPR3757 plasmid pUSA03, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

146. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP030522 (Staphylococcus aureus strain ER01564.3 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

147. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_005054 (Staphylococcus aureus plasmid pLW043, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

148. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP014419 (Staphylococcus aureus strain USA300-SUR15 plasmid pUSA08-1-SUR15, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gccactattaaaagagaaattgaaagtagt	Protospacer
.  *   **.* ******************

149. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP030554 (Staphylococcus aureus strain PS00003.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

150. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP030614 (Staphylococcus aureus strain ER01560.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

151. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP030618 (Staphylococcus aureus strain ER04440.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

152. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP030671 (Staphylococcus aureus strain ER00951.3 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

153. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_012547 (Staphylococcus aureus plasmid pGO1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

154. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_005024 (Staphylococcus aureus plasmid pSK41, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

155. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_013320 (Staphylococcus aureus plasmid SAP014A, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

156. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_013342 (Staphylococcus aureus plasmid SAP079A, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

157. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_013343 (Staphylococcus aureus plasmid SAP080A, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

158. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_010279 (Staphylococcus aureus plasmid pV030-8, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

159. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP030556 (Staphylococcus aureus strain ER03750.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

160. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_018967 (Staphylococcus aureus plasmid p18813-P03, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

161. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP030639 (Staphylococcus aureus strain ER04165.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

162. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP030600 (Staphylococcus aureus strain ER00658.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

163. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_AP017321 (Staphylococcus aureus strain MI plasmid pMI, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

164. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to AP012550 (Staphylococcus aureus plasmid pN315G DNA, complete sequence, strain: N315G) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

165. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP026963 (Staphylococcus aureus strain FDAARGOS_6 plasmid unnamed1) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

166. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP030429 (Staphylococcus aureus strain ER03760.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

167. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP030648 (Staphylococcus aureus strain ER03556.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

168. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_020535 (Staphylococcus aureus subsp. aureus ST228 plasmid pI5S5, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

169. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP030407 (Staphylococcus aureus strain PS00002.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

170. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP030559 (Staphylococcus aureus strain ER01457.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

171. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP030483 (Staphylococcus aureus strain ER03913.3 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

172. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP040620 (Staphylococcus aureus strain J01 plasmid pJ01-01, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

173. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_MH587578 (Staphylococcus aureus strain WG1647 plasmid pWBG615, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

174. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP030591 (Staphylococcus aureus strain ER02989.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

175. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP030453 (Staphylococcus aureus strain PS00001.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

176. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_KP670395 (Staphylococcus schleiferi strain 5909-02 plasmid p5909-02, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

177. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_013338 (Staphylococcus aureus plasmid SAP068A, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

178. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_013339 (Staphylococcus aureus plasmid SAP069A, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

179. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_013344 (Staphylococcus aureus plasmid SAP082A, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

180. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP013960 (Staphylococcus aureus strain V605 plasmid pV605, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

181. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP030538 (Staphylococcus aureus strain ER02094.3 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

182. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP030435 (Staphylococcus aureus strain ER00610.3 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

183. spacer 1.7|1376981|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP030526 (Staphylococcus aureus strain ER02703.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

184. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MK268686 (Enterococcus phage vB_EfaH_EF1TV, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

185. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to AP018715 (Enterococcus phage phiM1EF22 DNA, complete sequence) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

186. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MK721192 (Enterococcus phage vB_EfaM_Ef2.3, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

187. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CAJDJZ010000002 (Enterococcus phage vB_EfaH_149 genome assembly, contig: phage149-genome, whole genome shotgun sequence) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

188. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_029026 (Enterococcus phage EFLK1, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

189. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to AP018714 (Enterococcus phage phiEF17H DNA, complete sequence) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

190. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MK693030 (Enterococcus phage vB_EfaM_Ef2.1, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

191. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_009904 (Enterococcus phage phiEF24C, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

192. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to AP009390 (Enterococcus phage phiEF24C DNA, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

193. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MN854830 (Enterococcus phage PBEF129, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

194. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to KJ801817 (Enterococcus phage ECP3, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

195. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to AB609718 (Enterococcus phage phiEF24C-P2 DNA, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

196. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_022778 (Clostridium tetani 12124569 plasmid p12124569, complete sequence) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
cacctaaaaatgatacagaaaaagctcaat	Protospacer
   ***********.* *********. *

197. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_LR214939 (Mycoplasma salivarium strain NCTC10113 plasmid 2) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
tgaaagcaaatggtgctgaaaaacctttag	Protospacer
  *  . *****.********** ******

198. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
gaactaagaatcatgctgaaaaagccctga	Protospacer
. *****.*** *************..*..

199. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_004565 (Clostridium tetani E88 plasmid pE88, complete sequence) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
cacctaaaaatgatacagaaaaagctcaat	Protospacer
   ***********.* *********. *

200. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to KC139528 (Salmonella phage FSL SP-010 hypothetical proteins, lysin, and hypothetical proteins genes, complete cds; and tRNA-Pro, tRNA-Glu, tRNA-Met, tRNA-Asn, tRNA-Tyr, tRNA-Asp, tRNA-Lys, tRNA-Met, and tRNA-Ile genes, complete sequence) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgttgtgaatgatgttgaaaaagctttaa	Protospacer
*...*. .*******.*************.

201. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to KC139543 (Salmonella phage FSL SP-012 putative tail fiber protein gene, partial cds; hypothetical proteins, putative baseplate component, hypothetical protein, putative baseplate assembly protein, hypothetical proteins, structural protein, hypothetical proteins, major capsid protein, structural protein, putative prohead protease, hypothetical proteins, terminase large subunit, and hypothetical protein genes, complete cds; tRNA-Cys, tRNA-OTHER, tRNA-Phe, tRNA-OTHER, tRNA-Gln, tRNA-Leu, and tRNA-Gln genes, complete sequence; hypothetical protein gene, complete cds; tRNA-Arg, tRNA-Leu, tRNA-Val, tRNA-Thr, tRNA-Gly, tRNA-Ala, tRNA-Lys, tRNA-Leu, tRNA-OTHER, tRNA-Ile, tRNA-Met, tRNA-Lys, tRNA-Asp, tRNA-Tyr, tRNA-Asn, tRNA-Met, tRNA-Glu, and tRNA-Pro genes, complete sequence; and hypothetical proteins, lysin, and hypothetical proteins genes, complete cds) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgttgtgaatgatgttgaaaaagctttaa	Protospacer
*...*. .*******.*************.

202. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MN694536 (Marine virus AFVG_250M991, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
gaactataaaagatgctgaaaaagcaggcg	Protospacer
. **** *** **************    *

203. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to KR014248 (Escherichia phage vB_EcoM_AYO145A, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgttgtgaatgatgttgaaaaagctttaa	Protospacer
*...*. .*******.*************.

204. spacer 1.8|1377047|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_027337 (Escherichia phage vB_EcoM-VpaE1, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgttgtgaatgatgttgaaaaagctttaa	Protospacer
*...*. .*******.*************.

205. spacer 1.9|1377113|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP016195 (Bacillus thuringiensis serovar coreanensis strain ST7 plasmid pST7-1, complete sequence) position: , mismatch: 8, identity: 0.733

agccatctaatgcttcaggcttgatatatt	CRISPR spacer
catcaaaaaatgcttcaggcttaatatatg	Protospacer
 ..**   **************.******

206. spacer 1.18|1377707|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MK170447 (Methanosarcina virus MetMV, complete genome) position: , mismatch: 8, identity: 0.733

gacgcagacaatatagcaaaagcagtttta	CRISPR spacer
aacgaagactatatagcaaaagcatggaaa	Protospacer
.*** **** **************     *

207. spacer 1.20|1377839|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_KX258624 (Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence) position: , mismatch: 8, identity: 0.733

aacagttggattactaccgcaaaaagtatc	CRISPR spacer
agagtatggattaataccgcaaaaagtaat	Protospacer
*. .  ******* ************** .

208. spacer 1.22|1377971|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP045196 (Acinetobacter indicus strain TQ23 plasmid p23TQ-37k, complete sequence) position: , mismatch: 8, identity: 0.733

aagcaagctgaagctgtaaatgaagtaata	CRISPR spacer
tatggagctgaagctgtaaatgtagttaag	Protospacer
 *  .***************** *** * .

209. spacer 1.22|1377971|30|NZ_CP018809|CRISPRCasFinder,CRT matches to AP013408 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C105A-MedDCM-OCT-S27-C54) position: , mismatch: 8, identity: 0.733

aagcaagctgaagctgtaaatgaagtaata	CRISPR spacer
gcaaaagctgatactgtaaatgaagtagca	Protospacer
. . ******* .**************..*

210. spacer 1.22|1377971|30|NZ_CP018809|CRISPRCasFinder,CRT matches to AP013409 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C105A-MedDCM-OCT-S28-C49) position: , mismatch: 8, identity: 0.733

aagcaagctgaagctgtaaatgaagtaata	CRISPR spacer
gcaaaagctgatactgtaaatgaagtagca	Protospacer
. . ******* .**************..*

211. spacer 1.22|1377971|30|NZ_CP018809|CRISPRCasFinder,CRT matches to MK250019 (Prevotella phage Lak-A2, complete genome) position: , mismatch: 8, identity: 0.733

aagcaagctgaagctgtaaatgaagtaata	CRISPR spacer
ttattaccagaaactgtaaatgaagtaata	Protospacer
  .. * * ***.*****************

212. spacer 1.27|1376718|30|NZ_CP018809|PILER-CR matches to NZ_AP017309 (Leptolyngbya sp. NIES-3755 plasmid plasmid1 DNA, complete genome) position: , mismatch: 8, identity: 0.733

atcttttctgcaactgcccattctggtagt	CRISPR spacer
cgctttgctgcaattgcccattctgcgatc	Protospacer
  **** ******.***********  * .

213. spacer 1.27|1376718|30|NZ_CP018809|PILER-CR matches to NZ_CP051678 (Spirosoma sp. CJU-R4 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

atcttttctgcaactgcccattctggtagt	CRISPR spacer
ctggaggctgcaactgccctttctggtggt	Protospacer
 *     ************ *******.**

214. spacer 1.28|1376784|30|NZ_CP018809|PILER-CR matches to NZ_CP039285 (Leptospira interrogans strain FMAS_AW1 plasmid pLiSL2, complete sequence) position: , mismatch: 8, identity: 0.733

ttagaaacattaatcttattgtctttagcc	CRISPR spacer
ttagaattattaatcttattgtcaacattg	Protospacer
****** .***************  .* .

215. spacer 1.28|1376784|30|NZ_CP018809|PILER-CR matches to NZ_CP054832 (Staphylococcus saprophyticus strain UTI-045 plasmid pUTI-045-1, complete sequence) position: , mismatch: 8, identity: 0.733

ttagaaacattaatcttattgtctttagcc	CRISPR spacer
acaattacatttatgttattgtctttagct	Protospacer
 .*.  ***** ** **************.

216. spacer 1.28|1376784|30|NZ_CP018809|PILER-CR matches to NZ_CP054832 (Staphylococcus saprophyticus strain UTI-045 plasmid pUTI-045-1, complete sequence) position: , mismatch: 8, identity: 0.733

ttagaaacattaatcttattgtctttagcc	CRISPR spacer
acaattacatttatgttattgtctttagct	Protospacer
 .*.  ***** ** **************.

217. spacer 1.28|1376784|30|NZ_CP018809|PILER-CR matches to NZ_CP054436 (Staphylococcus saprophyticus strain UTI-035 plasmid pUTI-035-2, complete sequence) position: , mismatch: 8, identity: 0.733

ttagaaacattaatcttattgtctttagcc	CRISPR spacer
acaattacattaatgttattttctttagct	Protospacer
 .*.  ******** ***** ********.

218. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NZ_CP013280 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
agcaagcttgacaaagaaattgaaaacttc	Protospacer
*. **********.***********..  .

219. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NZ_CP039726 (Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
agcaagcttgacaaagaaattgaaaacttc	Protospacer
*. **********.***********..  .

220. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NZ_CP009350 (Bacillus thuringiensis HD1002 plasmid 4, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
agcaagcttgacaaagaaattgaaaacttc	Protospacer
*. **********.***********..  .

221. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NC_018510 (Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
agcaagcttgacaaagaaattgaaaacttc	Protospacer
*. **********.***********..  .

222. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NZ_CP026078 (Staphylococcus aureus strain FDAARGOS_7 plasmid unnamed) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

223. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NZ_KY465818 (Staphylococcus aureus subsp. aureus strain CC1 plasmid p140355, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

224. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NZ_KM521836 (Staphylococcus epidermidis strain 12-00322 plasmid p12-00322, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

225. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NZ_KR230047 (Staphylococcus epidermidis strain SP1 plasmid pSP01, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

226. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NZ_KT780704 (Staphylococcus aureus subsp. aureus RN4220 plasmid pRM27, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

227. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NZ_KT780705 (Staphylococcus aureus subsp. aureus RN4220 plasmid pGO400, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

228. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NZ_KT373969 (Staphylococcus pseudintermedius strain HR547/11 plasmid pKM01, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

229. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NZ_KU882681 (Staphylococcus lugdunensis strain Tlug15G-4 plasmid pT15G-1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

230. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP030382 (Staphylococcus aureus strain ER03761.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

231. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP030491 (Staphylococcus aureus strain ER02837.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

232. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP030606 (Staphylococcus aureus strain ER02693.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

233. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NC_013653 (Staphylococcus aureus plasmid pPR9, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

234. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP030388 (Staphylococcus aureus strain ER01062.3 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

235. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP030655 (Staphylococcus aureus strain ER04448.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

236. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NC_007792 (Staphylococcus aureus subsp. aureus USA300_FPR3757 plasmid pUSA03, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

237. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP030522 (Staphylococcus aureus strain ER01564.3 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

238. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NC_005054 (Staphylococcus aureus plasmid pLW043, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

239. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NZ_CP014419 (Staphylococcus aureus strain USA300-SUR15 plasmid pUSA08-1-SUR15, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gccactattaaaagagaaattgaaagtagt	Protospacer
.  *   **.* ******************

240. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP030554 (Staphylococcus aureus strain PS00003.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

241. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP030614 (Staphylococcus aureus strain ER01560.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

242. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP030618 (Staphylococcus aureus strain ER04440.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

243. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP030671 (Staphylococcus aureus strain ER00951.3 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

244. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NC_012547 (Staphylococcus aureus plasmid pGO1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

245. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NC_005024 (Staphylococcus aureus plasmid pSK41, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

246. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NC_013320 (Staphylococcus aureus plasmid SAP014A, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

247. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NC_013342 (Staphylococcus aureus plasmid SAP079A, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

248. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NC_013343 (Staphylococcus aureus plasmid SAP080A, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

249. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NC_010279 (Staphylococcus aureus plasmid pV030-8, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

250. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP030556 (Staphylococcus aureus strain ER03750.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

251. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NC_018967 (Staphylococcus aureus plasmid p18813-P03, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

252. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP030639 (Staphylococcus aureus strain ER04165.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

253. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP030600 (Staphylococcus aureus strain ER00658.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

254. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NZ_AP017321 (Staphylococcus aureus strain MI plasmid pMI, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

255. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to AP012550 (Staphylococcus aureus plasmid pN315G DNA, complete sequence, strain: N315G) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

256. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NZ_CP026963 (Staphylococcus aureus strain FDAARGOS_6 plasmid unnamed1) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

257. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP030429 (Staphylococcus aureus strain ER03760.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

258. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP030648 (Staphylococcus aureus strain ER03556.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

259. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NC_020535 (Staphylococcus aureus subsp. aureus ST228 plasmid pI5S5, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

260. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP030407 (Staphylococcus aureus strain PS00002.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

261. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP030559 (Staphylococcus aureus strain ER01457.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

262. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP030483 (Staphylococcus aureus strain ER03913.3 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

263. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NZ_CP040620 (Staphylococcus aureus strain J01 plasmid pJ01-01, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

264. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NZ_MH587578 (Staphylococcus aureus strain WG1647 plasmid pWBG615, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

265. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP030591 (Staphylococcus aureus strain ER02989.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

266. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP030453 (Staphylococcus aureus strain PS00001.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

267. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NZ_KP670395 (Staphylococcus schleiferi strain 5909-02 plasmid p5909-02, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

268. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NC_013338 (Staphylococcus aureus plasmid SAP068A, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

269. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NC_013339 (Staphylococcus aureus plasmid SAP069A, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

270. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to NC_013344 (Staphylococcus aureus plasmid SAP082A, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

271. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP013960 (Staphylococcus aureus strain V605 plasmid pV605, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

272. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP030538 (Staphylococcus aureus strain ER02094.3 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

273. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP030435 (Staphylococcus aureus strain ER00610.3 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

274. spacer 1.31|1376982|30|NZ_CP018809|PILER-CR matches to CP030526 (Staphylococcus aureus strain ER02703.3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aagaagcttgacagagaaattgaaagtagt	CRISPR spacer
gcaacaattaaaagagaaattgaaagtagt	Protospacer
. .* . **.* ******************

275. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to MK268686 (Enterococcus phage vB_EfaH_EF1TV, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

276. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to AP018715 (Enterococcus phage phiM1EF22 DNA, complete sequence) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

277. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to MK721192 (Enterococcus phage vB_EfaM_Ef2.3, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

278. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to CAJDJZ010000002 (Enterococcus phage vB_EfaH_149 genome assembly, contig: phage149-genome, whole genome shotgun sequence) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

279. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NC_029026 (Enterococcus phage EFLK1, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

280. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to AP018714 (Enterococcus phage phiEF17H DNA, complete sequence) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

281. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to MK693030 (Enterococcus phage vB_EfaM_Ef2.1, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

282. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NC_009904 (Enterococcus phage phiEF24C, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

283. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to AP009390 (Enterococcus phage phiEF24C DNA, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

284. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to MN854830 (Enterococcus phage PBEF129, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

285. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to KJ801817 (Enterococcus phage ECP3, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

286. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to AB609718 (Enterococcus phage phiEF24C-P2 DNA, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgctaaaaatgatgctgaaaatgcaaata	Protospacer
*..******************* **    .

287. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NC_022778 (Clostridium tetani 12124569 plasmid p12124569, complete sequence) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
cacctaaaaatgatacagaaaaagctcaat	Protospacer
   ***********.* *********. *

288. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NZ_LR214939 (Mycoplasma salivarium strain NCTC10113 plasmid 2) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
tgaaagcaaatggtgctgaaaaacctttag	Protospacer
  *  . *****.********** ******

289. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
gaactaagaatcatgctgaaaaagccctga	Protospacer
. *****.*** *************..*..

290. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NC_004565 (Clostridium tetani E88 plasmid pE88, complete sequence) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
cacctaaaaatgatacagaaaaagctcaat	Protospacer
   ***********.* *********. *

291. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to KC139528 (Salmonella phage FSL SP-010 hypothetical proteins, lysin, and hypothetical proteins genes, complete cds; and tRNA-Pro, tRNA-Glu, tRNA-Met, tRNA-Asn, tRNA-Tyr, tRNA-Asp, tRNA-Lys, tRNA-Met, and tRNA-Ile genes, complete sequence) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgttgtgaatgatgttgaaaaagctttaa	Protospacer
*...*. .*******.*************.

292. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to KC139543 (Salmonella phage FSL SP-012 putative tail fiber protein gene, partial cds; hypothetical proteins, putative baseplate component, hypothetical protein, putative baseplate assembly protein, hypothetical proteins, structural protein, hypothetical proteins, major capsid protein, structural protein, putative prohead protease, hypothetical proteins, terminase large subunit, and hypothetical protein genes, complete cds; tRNA-Cys, tRNA-OTHER, tRNA-Phe, tRNA-OTHER, tRNA-Gln, tRNA-Leu, and tRNA-Gln genes, complete sequence; hypothetical protein gene, complete cds; tRNA-Arg, tRNA-Leu, tRNA-Val, tRNA-Thr, tRNA-Gly, tRNA-Ala, tRNA-Lys, tRNA-Leu, tRNA-OTHER, tRNA-Ile, tRNA-Met, tRNA-Lys, tRNA-Asp, tRNA-Tyr, tRNA-Asn, tRNA-Met, tRNA-Glu, and tRNA-Pro genes, complete sequence; and hypothetical proteins, lysin, and hypothetical proteins genes, complete cds) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgttgtgaatgatgttgaaaaagctttaa	Protospacer
*...*. .*******.*************.

293. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to MN694536 (Marine virus AFVG_250M991, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
gaactataaaagatgctgaaaaagcaggcg	Protospacer
. **** *** **************    *

294. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to KR014248 (Escherichia phage vB_EcoM_AYO145A, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgttgtgaatgatgttgaaaaagctttaa	Protospacer
*...*. .*******.*************.

295. spacer 1.32|1377048|30|NZ_CP018809|PILER-CR matches to NC_027337 (Escherichia phage vB_EcoM-VpaE1, complete genome) position: , mismatch: 8, identity: 0.733

acactaaaaatgatgctgaaaaagctttag	CRISPR spacer
atgttgtgaatgatgttgaaaaagctttaa	Protospacer
*...*. .*******.*************.

296. spacer 1.33|1377114|30|NZ_CP018809|PILER-CR matches to CP016195 (Bacillus thuringiensis serovar coreanensis strain ST7 plasmid pST7-1, complete sequence) position: , mismatch: 8, identity: 0.733

agccatctaatgcttcaggcttgatatatt	CRISPR spacer
catcaaaaaatgcttcaggcttaatatatg	Protospacer
 ..**   **************.******

297. spacer 1.42|1377708|30|NZ_CP018809|PILER-CR matches to MK170447 (Methanosarcina virus MetMV, complete genome) position: , mismatch: 8, identity: 0.733

gacgcagacaatatagcaaaagcagtttta	CRISPR spacer
aacgaagactatatagcaaaagcatggaaa	Protospacer
.*** **** **************     *

298. spacer 1.44|1377840|30|NZ_CP018809|PILER-CR matches to NZ_KX258624 (Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence) position: , mismatch: 8, identity: 0.733

aacagttggattactaccgcaaaaagtatc	CRISPR spacer
agagtatggattaataccgcaaaaagtaat	Protospacer
*. .  ******* ************** .

299. spacer 1.46|1377972|30|NZ_CP018809|PILER-CR matches to NZ_CP045196 (Acinetobacter indicus strain TQ23 plasmid p23TQ-37k, complete sequence) position: , mismatch: 8, identity: 0.733

aagcaagctgaagctgtaaatgaagtaata	CRISPR spacer
tatggagctgaagctgtaaatgtagttaag	Protospacer
 *  .***************** *** * .

300. spacer 1.46|1377972|30|NZ_CP018809|PILER-CR matches to AP013408 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C105A-MedDCM-OCT-S27-C54) position: , mismatch: 8, identity: 0.733

aagcaagctgaagctgtaaatgaagtaata	CRISPR spacer
gcaaaagctgatactgtaaatgaagtagca	Protospacer
. . ******* .**************..*

301. spacer 1.46|1377972|30|NZ_CP018809|PILER-CR matches to AP013409 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C105A-MedDCM-OCT-S28-C49) position: , mismatch: 8, identity: 0.733

aagcaagctgaagctgtaaatgaagtaata	CRISPR spacer
gcaaaagctgatactgtaaatgaagtagca	Protospacer
. . ******* .**************..*

302. spacer 1.46|1377972|30|NZ_CP018809|PILER-CR matches to MK250019 (Prevotella phage Lak-A2, complete genome) position: , mismatch: 8, identity: 0.733

aagcaagctgaagctgtaaatgaagtaata	CRISPR spacer
ttattaccagaaactgtaaatgaagtaata	Protospacer
  .. * * ***.*****************

303. spacer 1.4|1376783|30|NZ_CP018809|CRISPRCasFinder,CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.7

ttagaaacattaatcttattgtctttagcc	CRISPR spacer
cagtaaagattaatattattgtctttacta	Protospacer
. . *** ****** ************ .

304. spacer 1.10|1377179|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NZ_CP024012 (Acinetobacter sp. LoGeW2-3 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

ttgtgcaatatccttattacgtattgtctt	CRISPR spacer
aaaaaagatttccttatcacgtattgtctt	Protospacer
  . . .** *******.************

305. spacer 1.11|1377245|30|NZ_CP018809|CRISPRCasFinder,CRT matches to NC_013793 (Bacillus pseudofirmus OF4 plasmid pBpOF4-02, complete sequence) position: , mismatch: 9, identity: 0.7

ttacatgtatgtatgcagattaaaatagag	CRISPR spacer
caacatgtatgtatgcagtttataagccct	Protospacer
. **************** *** **

306. spacer 1.28|1376784|30|NZ_CP018809|PILER-CR matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.7

ttagaaacattaatcttattgtctttagcc	CRISPR spacer
cagtaaagattaatattattgtctttacta	Protospacer
. . *** ****** ************ .

307. spacer 1.34|1377180|30|NZ_CP018809|PILER-CR matches to NZ_CP024012 (Acinetobacter sp. LoGeW2-3 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

ttgtgcaatatccttattacgtattgtctt	CRISPR spacer
aaaaaagatttccttatcacgtattgtctt	Protospacer
  . . .** *******.************

308. spacer 1.35|1377246|30|NZ_CP018809|PILER-CR matches to NC_013793 (Bacillus pseudofirmus OF4 plasmid pBpOF4-02, complete sequence) position: , mismatch: 9, identity: 0.7

ttacatgtatgtatgcagattaaaatagag	CRISPR spacer
caacatgtatgtatgcagtttataagccct	Protospacer
. **************** *** **

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

118711 : 124267

Staphylococcus_phage(66.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006585402.1\|118711_119770_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	1.5e-41	34.6
WP_006585401.1\|119762_120368_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	5.3e-31	39.9
WP_006585400.1\|120370_121546_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.6e-95	46.1
WP_006588303.1\|121563_122028_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	2.8e-24	40.9
WP_006585399.1\|122195_123197_+	D-2-hydroxyacid dehydrogenase	M1H502	Paramecium_bursaria_Chlorella_virus	3.2e-49	35.0
WP_006588304.1\|123547_124267_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	8.3e-23	29.9

DBSCAN-SWA_2

448071 : 455481

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006585146.1\|448071_448623_+	DUF4065 domain-containing protein	Q9AZG0	Lactococcus_phage	1.1e-27	46.4
WP_006585145.1\|448619_449018_+	type II toxin-antitoxin system death-on-curing family toxin	A0A1B3AYM0	Gordonia_phage	3.9e-06	46.2
WP_006588116.1\|449289_449889_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_006588115.1\|449899_450430_+	nucleoside deaminase	A0A0B5J096	Pandoravirus	1.2e-07	42.9
WP_006588114.1\|450588_452370_+	DNA polymerase III subunit gamma/tau	E7DN81	Pneumococcus_phage	4.9e-48	41.2
WP_006585142.1\|452410_452740_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_006585141.1\|452739_453339_+	recombination protein RecR	NA	NA	NA	NA
WP_006585140.1\|453335_453575_+	YaaL family protein	NA	NA	NA	NA
WP_006585139.1\|453665_454313_+	dTMP kinase	M1PSC7	Streptococcus_phage	2.7e-57	54.8
WP_006585138.1\|454312_454633_+	hypothetical protein	NA	NA	NA	NA
WP_006585136.1\|454632_455481_+	DNA polymerase III subunit delta	M1NSC1	Streptococcus_phage	7.3e-18	28.3

DBSCAN-SWA_3

656197 : 665044

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075362447.1\|656197_659047_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	8.9e-302	55.0
WP_006584988.1\|659134_660010_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	2.0e-07	28.6
WP_006584987.1\|660019_661057_+	uridine diphosphate-N-acetylglucosamine-binding protein YvcK	A1IMD5	Streptococcus_phage	1.1e-89	51.1
WP_006587943.1\|661049_661988_+	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	3.1e-46	35.1
WP_006587942.1\|662127_663342_+	hypothetical protein	NA	NA	NA	NA
WP_021350558.1\|663408_664401_+	D-2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	5.7e-46	34.6
WP_006584983.1\|664462_665044_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	3.6e-53	54.2

DBSCAN-SWA_4

931510 : 1011068

Lactobacillus_phage(75.0%)

terminase,plate,transposase,head,portal,holin,tail,capsid,protease,tRNA,integrase

attL 969115:969139|attR 1008056:1008080

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006584480.1\|931510_932689_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_006584770.1\|933560_934466_-	YitT family protein	M1Q1P6	Streptococcus_phage	6.3e-52	36.9
WP_006584769.1\|934551_935742_+\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	1.6e-50	34.7
WP_143739499.1\|935886_935952_+	hypothetical protein	NA	NA	NA	NA
WP_006587784.1\|936006_936672_-	hemolysin III family protein	NA	NA	NA	NA
WP_006584768.1\|936819_937662_+	DegV family protein	A0A1X9I5J4	Streptococcus_phage	3.7e-06	23.6
WP_006584767.1\|937769_937994_+	YozE family protein	NA	NA	NA	NA
WP_006588582.1\|938040_939636_+	sodium:proton antiporter	NA	NA	NA	NA
WP_006584764.1\|939756_940599_+	ribosome biogenesis GTPase YlqF	NA	NA	NA	NA
WP_075362460.1\|940595_941354_+	ribonuclease HII	G9E3X7	Emiliania_huxleyi_virus	7.7e-27	40.5
WP_006584762.1\|941402_941831_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_006584761.1\|942339_943269_+	hypothetical protein	NA	NA	NA	NA
WP_006584760.1\|943340_944183_+	DNA-protecting protein DprA	S6BFL3	Thermus_phage	1.3e-27	36.8
WP_006588265.1\|944345_946433_+	type I DNA topoisomerase	A0A1V0SCS0	Indivirus	3.9e-97	37.1
WP_006588266.1\|946532_947852_+\|tRNA	methylenetetrahydrofolate--tRNA-(uracil(54)- C(5))-methyltransferase (FADH(2)-oxidizing) TrmFO	NA	NA	NA	NA
WP_006584758.1\|947844_948753_+	tyrosine recombinase XerC	A0A1P8DJJ6	Virus_Rctr41k	3.2e-19	29.1
WP_006584757.1\|948755_949286_+\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_006584756.1\|949286_950669_+\|protease	ATP-dependent protease ATPase subunit HslU	W6AS21	Erwinia_phage	2.6e-41	27.8
WP_006588267.1\|950682_951567_+	aldose 1-epimerase family protein	NA	NA	NA	NA
WP_006588268.1\|951633_952254_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_006588269.1\|952338_954282_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	1.5e-114	40.7
WP_006584754.1\|954294_956775_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	2.9e-91	31.0
WP_006584753.1\|956841_957777_+	manganese-dependent inorganic pyrophosphatase	NA	NA	NA	NA
WP_006584752.1\|957861_958446_+	peptidylprolyl isomerase	A0A1V0S9I2	Catovirus	3.2e-25	42.8
WP_006587990.1\|958502_960203_-	fibronectin/fibrinogen-binding protein	M1HQM6	Paramecium_bursaria_Chlorella_virus	1.7e-10	45.7
WP_006584751.1\|960489_960903_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_006584750.1\|960976_961858_+	DegV family protein	A0A0N9SI50	Staphylococcus_phage	6.6e-06	29.0
WP_006587991.1\|961957_962203_+	hypothetical protein	NA	NA	NA	NA
WP_006584748.1\|962280_962748_+	DNA starvation/stationary phase protection protein	NA	NA	NA	NA
WP_006584747.1\|962946_963612_+	hypothetical protein	NA	NA	NA	NA
WP_006584746.1\|963757_965260_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_006584745.1\|965294_965663_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_006584480.1\|965811_966990_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_006584744.1\|967262_968318_-	tyrosine recombinase XerS	NA	NA	NA	NA
969115:969139	attL	NA	NA	NA	NA
WP_075362461.1\|969324_969741_-	hypothetical protein	NA	NA	NA	NA
WP_048597999.1\|969870_970275_-	hypothetical protein	NA	NA	NA	NA
WP_075362462.1\|970279_970477_-	hypothetical protein	B8R668	Lactobacillus_phage	4.3e-22	91.5
WP_075362463.1\|970488_970920_-	hypothetical protein	B8R667	Lactobacillus_phage	2.1e-77	97.2
WP_081377440.1\|971164_971392_-	hypothetical protein	B8R666	Lactobacillus_phage	9.9e-31	95.9
WP_155772335.1\|971541_971691_-	hypothetical protein	NA	NA	NA	NA
WP_075362465.1\|971880_973005_-	glycosyl hydrolase family 25	B8R665	Lactobacillus_phage	1.0e-208	92.8
WP_048587925.1\|973020_973413_-\|holin	holin	B8R664	Lactobacillus_phage	4.8e-57	93.1
WP_075362466.1\|973402_973585_-	hypothetical protein	NA	NA	NA	NA
WP_006588840.1\|973590_973824_-	hypothetical protein	B8R663	Lactobacillus_phage	2.4e-32	100.0
WP_006588841.1\|973842_974235_-	hypothetical protein	B8R662	Lactobacillus_phage	2.4e-69	100.0
WP_006588842.1\|974200_974386_-	XkdX family protein	NA	NA	NA	NA
WP_006588843.1\|974385_974850_-	hypothetical protein	B8R661	Lactobacillus_phage	4.0e-79	100.0
WP_048598118.1\|974873_976787_-\|plate	BppU family phage baseplate upper protein	B8R660	Lactobacillus_phage	7.2e-239	99.4
WP_048598115.1\|976740_976974_-	hypothetical protein	NA	NA	NA	NA
WP_015995099.1\|976958_979742_-\|tail	fiber tail protein	B8R659	Lactobacillus_phage	0.0e+00	100.0
WP_075362467.1\|979738_980479_-\|tail	phage tail protein	B8R658	Lactobacillus_phage	1.0e-116	99.5
WP_075362468.1\|980465_985148_-	tape measure protein	B8R657	Lactobacillus_phage	0.0e+00	91.0
WP_048587919.1\|985321_985936_-\|tail	tail protein	B8R656	Lactobacillus_phage	4.5e-94	87.3
WP_048587918.1\|986021_986651_-\|tail	tail protein	B8R655	Lactobacillus_phage	3.0e-109	94.7
WP_048598139.1\|986650_987040_-	DUF806 family protein	B8R654	Lactobacillus_phage	1.2e-60	92.1
WP_034535677.1\|987026_987485_-	hypothetical protein	B8R653	Lactobacillus_phage	1.0e-74	90.1
WP_006588853.1\|987477_987849_-\|head	phage head closure protein	B8R652	Lactobacillus_phage	3.6e-62	96.7
WP_048587916.1\|987832_988132_-	hypothetical protein	A0A0M7RDR5	Lactobacillus_phage	2.3e-11	39.6
WP_075362469.1\|988151_990005_-\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	1.6e-304	96.9
WP_006588856.1\|990101_991271_-\|portal	phage portal protein	B8R650	Lactobacillus_phage	9.5e-210	98.4
WP_075362470.1\|991280_993185_-\|terminase	terminase large subunit	B8R649	Lactobacillus_phage	0.0e+00	99.1
WP_006584719.1\|993184_993643_-\|terminase	phage terminase small subunit P27 family	B8R648	Lactobacillus_phage	6.1e-80	98.0
WP_048597960.1\|993857_994322_-	hypothetical protein	B8R694	Lactobacillus_phage	4.5e-86	98.1
WP_048597951.1\|994330_995458_-	SAM-dependent DNA methyltransferase	B8R693	Lactobacillus_phage	2.7e-217	98.1
WP_015995128.1\|996122_996527_-	hypothetical protein	B8R691	Lactobacillus_phage	1.0e-70	100.0
WP_144798809.1\|996432_996888_-	ArpU family transcriptional regulator	B8R690	Lactobacillus_phage	9.4e-81	99.3
WP_075362472.1\|997102_997345_-	hypothetical protein	B8R688	Lactobacillus_phage	9.9e-37	98.8
WP_015995124.1\|997334_998117_-	hypothetical protein	B8R687	Lactobacillus_phage	9.4e-129	100.0
WP_015995123.1\|998124_998436_-	hypothetical protein	B8R686	Lactobacillus_phage	3.9e-54	100.0
WP_048597949.1\|998432_998852_-	RusA family crossover junction endodeoxyribonuclease	B8R685	Lactobacillus_phage	2.5e-48	100.0
WP_075362473.1\|998841_999447_-	hypothetical protein	B8R684	Lactobacillus_phage	1.9e-108	95.5
WP_075362520.1\|999456_999912_-	single-stranded DNA-binding protein	B8R683	Lactobacillus_phage	3.7e-77	96.7
WP_075362474.1\|999926_1000733_-	ATP-binding protein	B8R682	Lactobacillus_phage	4.5e-134	88.5
WP_075362521.1\|1000716_1001151_-	hypothetical protein	B8R681	Lactobacillus_phage	5.6e-75	89.6
WP_075362475.1\|1001153_1001903_-	Rep protein	B8R680	Lactobacillus_phage	7.2e-102	91.6
WP_075362476.1\|1002011_1002221_-	hypothetical protein	B8R679	Lactobacillus_phage	7.2e-28	84.1
WP_048597938.1\|1002238_1002571_-	DUF771 domain-containing protein	B8R678	Lactobacillus_phage	1.9e-59	98.2
WP_048597937.1\|1002573_1003098_-	hypothetical protein	B8R677	Lactobacillus_phage	4.9e-89	92.0
WP_048597935.1\|1003090_1003417_-	hypothetical protein	NA	NA	NA	NA
WP_048597933.1\|1003598_1003811_+	hypothetical protein	Q9T1I9	Lactobacillus_phage	1.2e-06	44.1
WP_048597931.1\|1003848_1004103_-	hypothetical protein	NA	NA	NA	NA
WP_075362477.1\|1004290_1005130_-	phage repressor protein/antirepressor Ant	B8R674	Lactobacillus_phage	5.9e-129	84.6
WP_006584696.1\|1005131_1005377_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_006588012.1\|1005539_1006217_+	helix-turn-helix domain-containing protein	B8R672	Lactobacillus_phage	8.6e-62	67.1
WP_006584695.1\|1006299_1006830_+	hypothetical protein	NA	NA	NA	NA
WP_006588013.1\|1006916_1008020_+\|integrase	tyrosine-type recombinase/integrase	B8R670	Lactobacillus_phage	4.8e-163	78.8
WP_006588015.1\|1008745_1009669_-	DUF4065 domain-containing protein	Q9AZG0	Lactococcus_phage	1.2e-45	35.0
1008056:1008080	attR	NA	NA	NA	NA
WP_006584480.1\|1009889_1011068_+\|transposase	IS256 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

1035509 : 1107643

Lactobacillus_phage(25.0%)

transposase,integrase

attL 1027233:1027249|attR 1084499:1084515

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1027233:1027249	attL	NA	NA	NA	NA
WP_006584480.1\|1035509_1036688_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_075362480.1\|1037346_1038534_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_006588596.1\|1038577_1039501_+\|integrase	site-specific integrase	A8ATM2	Listeria_phage	6.4e-84	49.0
WP_075362522.1\|1039537_1040743_-	type I restriction endonuclease subunit S	NA	NA	NA	NA
WP_006588599.1\|1040837_1042490_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	2.1e-130	50.1
WP_075362481.1\|1042508_1045730_-	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	5.4e-21	22.3
WP_006584667.1\|1045935_1046145_+	hypothetical protein	NA	NA	NA	NA
WP_006584666.1\|1046172_1046412_+	DUF2922 domain-containing protein	NA	NA	NA	NA
WP_006584665.1\|1046760_1047123_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_006584664.1\|1047270_1048416_-	glycerate kinase	W6LM47	Streptococcus_phage	2.0e-34	34.4
WP_006584663.1\|1048530_1049499_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_006588059.1\|1049514_1049667_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_006584661.1\|1049937_1051749_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	Q76DQ7	Chlorella_virus	2.8e-91	37.2
WP_006584660.1\|1052063_1052711_+	pyroglutamyl-peptidase I	NA	NA	NA	NA
WP_006584659.1\|1052795_1054538_+	1-deoxy-D-xylulose-5-phosphate synthase	NA	NA	NA	NA
WP_006584658.1\|1054704_1055595_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006588601.1\|1055776_1057564_+	FAD-binding protein	A0A2P0ZL82	Lactobacillus_phage	1.6e-06	23.0
WP_006588602.1\|1057560_1058454_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_075362482.1\|1058675_1060484_+	FAD-binding protein	A0A2P0ZL82	Lactobacillus_phage	7.2e-07	39.7
WP_006584655.1\|1060497_1061913_+	DASS family sodium-coupled anion symporter	NA	NA	NA	NA
WP_006588056.1\|1062342_1063044_-	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	8.1e-31	31.7
WP_006584654.1\|1063045_1063420_-	PTS-dependent dihydroxyacetone kinase phosphotransferase subunit DhaM	NA	NA	NA	NA
WP_006584653.1\|1063419_1064001_-	dihydroxyacetone kinase subunit L	NA	NA	NA	NA
WP_006588055.1\|1064014_1065010_-	dihydroxyacetone kinase subunit DhaK	NA	NA	NA	NA
WP_006584652.1\|1065114_1065651_-	hypothetical protein	NA	NA	NA	NA
WP_006588054.1\|1065684_1065897_-	hypothetical protein	NA	NA	NA	NA
WP_006588053.1\|1065921_1066770_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_075362483.1\|1066971_1072914_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_006584480.1\|1073476_1074655_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_075362484.1\|1074676_1075678_-	hydroxyacid dehydrogenase	M1HBE3	Paramecium_bursaria_Chlorella_virus	7.3e-17	25.8
WP_006584648.1\|1075695_1076550_-	nitrate reductase	NA	NA	NA	NA
WP_006588181.1\|1076564_1078064_-	YfcC family protein	NA	NA	NA	NA
WP_006588180.1\|1078089_1079028_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_006588179.1\|1079156_1080803_+	transcriptional regulator	NA	NA	NA	NA
WP_006584644.1\|1080849_1081830_-	ornithine cyclodeaminase family protein	NA	NA	NA	NA
WP_006588178.1\|1081831_1082698_-	anion permease	NA	NA	NA	NA
WP_006584642.1\|1082801_1084109_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_006588177.1\|1084120_1085482_-	glycoside hydrolase family 1 protein	A0A0B5JD41	Pandoravirus	1.8e-26	24.7
1084499:1084515	attR	NA	NA	NA	NA
WP_006584641.1\|1085601_1086309_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_006584480.1\|1086377_1087556_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_006588365.1\|1087780_1088767_-	D-ribose ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_006584639.1\|1088785_1089742_-	ribose ABC transporter permease	NA	NA	NA	NA
WP_006584638.1\|1089743_1091222_-	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.0e-16	28.0
WP_006584637.1\|1091243_1091639_-	D-ribose pyranase	NA	NA	NA	NA
WP_006584636.1\|1091638_1092565_-	ribokinase	NA	NA	NA	NA
WP_006584635.1\|1092764_1093778_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_006584634.1\|1093802_1094780_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_006588366.1\|1094877_1096344_-	FAD-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	4.2e-13	22.6
WP_075362485.1\|1096473_1096929_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006584632.1\|1097398_1098853_-	DASS family sodium-coupled anion symporter	NA	NA	NA	NA
WP_006584631.1\|1099291_1099471_-	CsbD family protein	NA	NA	NA	NA
WP_075362486.1\|1099572_1100451_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006588369.1\|1100854_1102540_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_006588370.1\|1102677_1103853_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_006584627.1\|1104811_1105846_-	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_006584626.1\|1105947_1106391_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_006584625.1\|1106551_1106779_-	hypothetical protein	NA	NA	NA	NA
WP_006588034.1\|1106803_1107643_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA

DBSCAN-SWA_6

1423985 : 1435807

Klosneuvirus(14.29%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006585697.1\|1423985_1426622_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	3.0e-62	33.0
WP_006588237.1\|1426848_1428207_-	DEAD/DEAH box helicase	A0A1B1IS59	uncultured_Mediterranean_phage	5.2e-50	31.4
WP_006585695.1\|1428199_1429159_-	bifunctional oligoribonuclease/PAP phosphatase NrnA	G3MA01	Bacillus_virus	1.5e-14	26.3
WP_006588817.1\|1429218_1430334_-	DNA polymerase IV	O64031	Bacillus_phage	7.1e-13	23.8
WP_075362507.1\|1430333_1431782_-	glucose-6-phosphate dehydrogenase	M4SIY3	Cyanophage	3.6e-57	31.7
WP_006585692.1\|1431872_1432247_-	preprotein translocase subunit YajC	NA	NA	NA	NA
WP_006585691.1\|1432315_1433329_-	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	6.2e-08	30.8
WP_006588236.1\|1433357_1433939_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_075362508.1\|1433941_1435807_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	6.9e-61	33.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage