CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP018931	Bacillus cereus strain ISSFR-3F chromosome, complete genome	6 crisprs	cas3,DEDDh,c2c9_V-U4,csa3,cas14j,WYL,DinG,cas14k	19	5	6	0
NZ_CP018932	Bacillus cereus strain ISSFR-3F plasmid unnamed, complete sequence	0 crisprs	RT,csa3	0	0	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP018931_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018931_1

817086-817850

TypeI-A?,TypeV-U4

Consensus_repeat	Method
NAACNGGAAANACNGGNN	CRT

16 spacers

The CRISPR arrays of NZ_CP018931_1

>merge|NZ_CP018931|1|817086-817850|CRT
TGACAGGAAGTACGGGTCCAACAGGAGAAACGGGAGGAACAGGAAGCACTGGGGTAACCGGAAACACAGGTCCAACGGGAAGTACGGGAGCAACGGGAAACACGGGTCCAACAGGAAGTACTGGGGTAACAGGAAGTACGGGTCCGACAGGAGAAACGGGTCCAACAGGAAACACAGGTCCAACAGGAAGTACGGGAGCAACAGGAAGCACTGGGGTAACCGGAAACACAGGTCCAACAGGAAGTACGGGAGCAACGGGAGCAACAGGAAGCACCGGGGTAACCGGAAACACGGGAGCAACAGGAAGCACGGGAGTAACAGGAGCAACCGGAGAAACAGGTCCAACGGGAAACACGGGAGCAACCGGAGAAACGGGTCCAACCGGAAGCACCGGGGTAACAGGAAATACGGGAGCAACCGGAGAAACAGGTCCAACAGGAAATACGGGAGTGACGGGAAATACCGGTCCGACAGGAGAAACGGGAGCAACAGGAGCAACAGGAGAAACAGGTCCAACAGGAGAAACGGGAGTGACAGGAAGTACGGGTCCAACAGGAGAAACGGGAGTAACAGGAAGTACTGGGGTAACAGGAAGTACGGGTCCAACAGGAGAAACGGGAGCAACAGGAAGTACGGGAGCAACCGGAAACACAGGAGCAACAGGAAGCATGGGAGTAACCGGAAACACAGGTCCAACCGGAAGCACCGGGGTAACCGGAAACACGGGTTCGACGGGAAGTACGGGAGTGACGGGAAGCACAGGTC

>NZ_CP018931|1|1|817086-817850|CRT
TGACAGGAAGTACGGGTC	CAACAGGAGAAACGGGAGGAACAGGAAGCACTGGGG
TAACCGGAAACACAGGTC	CAACGGGAAGTACGGGAG
CAACGGGAAACACGGGTC	CAACAGGAAGTACTGGGGTAACAGGAAGTACGGGTCCGACAGGAGAAACGGGTC
CAACAGGAAACACAGGTC	CAACAGGAAGTACGGGAGCAACAGGAAGCACTGGGG
TAACCGGAAACACAGGTC	CAACAGGAAGTACGGGAGCAACGGGAGCAACAGGAAGCACCGGGG
TAACCGGAAACACGGGAG	CAACAGGAAGCACGGGAGTAACAGGAGCAACCGGAGAAACAGGTC
CAACGGGAAACACGGGAG	CAACCGGAGAAACGGGTCCAACCGGAAGCACCGGGG
TAACAGGAAATACGGGAG	CAACCGGAGAAACAGGTC
CAACAGGAAATACGGGAG	TGACGGGAAATACCGGTC
CGACAGGAGAAACGGGAG	CAACAGGAGCAACAGGAGAAACAGGTC
CAACAGGAGAAACGGGAG	TGACAGGAAGTACGGGTC
CAACAGGAGAAACGGGAG	TAACAGGAAGTACTGGGGTAACAGGAAGTACGGGTC
CAACAGGAGAAACGGGAG	CAACAGGAAGTACGGGAG
CAACCGGAAACACAGGAG	CAACAGGAAGCATGGGAG
TAACCGGAAACACAGGTC	CAACCGGAAGCACCGGGG
TAACCGGAAACACGGGTT	CGACGGGAAGTACGGGAG
TGACGGGAAGCACAGGTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018931.1\|WP_075396125.1\|812461_813586_+\|homoserine-O-acetyltransferase	unknown	unknown	gnl\|CDD\|235859
NZ_CP018931.1\|WP_000141221.1\|814018_814324_+\|rhodanese-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|238089
NZ_CP018931.1\|WP_001158088.1\|820457_821471_+\|molybdopterin-synthase-adenylyltransferase-MoeB	unknown	unknown	gnl\|CDD\|183547
NZ_CP018931.1\|WP_075396120.1\|825970_826756_+\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|181585
NZ_CP018931.1\|WP_075396122.1\|822078_823368_+\|molybdopterin-molybdotransferase-MoeA	unknown	unknown	gnl\|CDD\|238452
NZ_CP018931.1\|WP_075396121.1\|823849_824314_+\|molybdopterin-synthase-catalytic-subunit-MoaE	unknown	unknown	gnl\|CDD\|223391
NZ_CP018931.1\|WP_075396126.1\|810065_812309_-\|spore-germination-protein-GerIA	unknown	unknown	gnl\|CDD\|377020
NZ_CP018931.1\|WP_075396123.1\|819427_820441_+\|GTP-3',8-cyclase-MoaA	unknown	unknown	gnl\|CDD\|274250
NZ_CP018931.1\|WP_000732107.1\|824643_825063_+\|DUF3888-domain-containing-protein	unknown	unknown	gnl\|CDD\|379024
NZ_CP018931.1\|WP_000180554.1\|807010_807433_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|212152
NZ_CP018931.1\|WP_075396128.1\|807898_808978_-\|Ger(x)C-family-spore-germination-protein	unknown	unknown	gnl\|CDD\|274338
NZ_CP018931.1\|WP_000038783.1\|807622_807808_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018931.1\|WP_000171893.1\|813635_813818_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018931.1\|WP_075396127.1\|808953_810048_-\|GerAB/ArcD/ProY-family-transporter	unknown	unknown	gnl\|CDD\|281794
NZ_CP018931.1\|WP_000094141.1\|821509_821995_-\|cyclic-pyranopterin-monophosphate-synthase-MoaC	unknown	unknown	gnl\|CDD\|236483
NZ_CP018931.1\|WP_001110865.1\|814646_814970_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018931.1\|WP_139316695.1\|823331_823853_+\|molybdopterin-guanine-dinucleotide-biosynthesis-protein-B	unknown	unknown	gnl\|CDD\|349770
NZ_CP018931.1\|WP_000350858.1\|825099_825957_+\|glucose-uptake-protein-GlcU	unknown	unknown	gnl\|CDD\|227309
NZ_CP018931.1\|WP_000621794.1\|824316_824550_+\|molybdopterin-converting-factor-subunit-1	unknown	unknown	gnl\|CDD\|340452
NZ_CP018931.1\|WP_000512463.1\|814401_814626_+\|spore-germination-protein	unknown	unknown	gnl\|CDD\|371190

Protein	Function_ID	Function_description	E-value
NZ_CP018931.1\|WP_075396125.1\|812461_813586_+\|homoserine-O-acetyltransferase	gnl\|CDD\|235859	PRK06765, PRK06765, homoserine O-acetyltransferase; Provisional.	0
NZ_CP018931.1\|WP_000141221.1\|814018_814324_+\|rhodanese-like-domain-containing-protein	gnl\|CDD\|238089	cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and certain stress proteins such as senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions (no active site cysteine) are also seen in dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases, where they are believed to play a regulatory role in multidomain proteins.	6.77882e-23
NZ_CP018931.1\|WP_001158088.1\|820457_821471_+\|molybdopterin-synthase-adenylyltransferase-MoeB	gnl\|CDD\|183547	PRK12475, PRK12475, thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional.	0
NZ_CP018931.1\|WP_075396120.1\|825970_826756_+\|glucose-1-dehydrogenase	gnl\|CDD\|181585	PRK08936, PRK08936, glucose-1-dehydrogenase; Provisional.	0
NZ_CP018931.1\|WP_075396122.1\|822078_823368_+\|molybdopterin-molybdotransferase-MoeA	gnl\|CDD\|238452	cd00887, MoeA, MoeA family. Members of this family are involved in biosynthesis of the molybdenum cofactor (MoCF), an essential cofactor of a diverse group of redox enzymes. MoCF biosynthesis is an evolutionarily conserved pathway present in eubacteria, archaea and eukaryotes. MoCF contains a tricyclic pyranopterin, termed molybdopterin (MPT). MoeA, together with MoaB, is responsible for the metal incorporation into MPT, the third step in MoCF biosynthesis. The plant homolog Cnx1 is a MoeA-MogA fusion protein. The mammalian homolog gephyrin is a MogA-MoeA fusion protein, that plays a critical role in postsynaptic anchoring of inhibitory glycine receptors and major GABAa receptor subtypes.	9.34988e-162
NZ_CP018931.1\|WP_075396121.1\|823849_824314_+\|molybdopterin-synthase-catalytic-subunit-MoaE	gnl\|CDD\|223391	COG0314, MoaE, Molybdopterin converting factor, large subunit [Coenzyme metabolism].	5.92036e-56
NZ_CP018931.1\|WP_000094141.1\|821509_821995_-\|cyclic-pyranopterin-monophosphate-synthase-MoaC	gnl\|CDD\|236483	PRK09364, moaC, cyclic pyranopterin monophosphate synthase MoaC.	2.81096e-97
NZ_CP018931.1\|WP_075396126.1\|810065_812309_-\|spore-germination-protein-GerIA	gnl\|CDD\|377020	pfam03323, GerA, Bacillus/Clostridium GerA spore germination protein.	0
NZ_CP018931.1\|WP_075396123.1\|819427_820441_+\|GTP-3',8-cyclase-MoaA	gnl\|CDD\|274250	TIGR02666, Cyclic_pyranopterin_monophosphate_synthase, molybdenum cofactor biosynthesis protein A, bacterial. The model for this family describes molybdenum cofactor biosynthesis protein A, or MoaA, as found in bacteria. It does not include the family of probable functional equivalent proteins from the archaea. MoaA works together with MoaC to synthesize precursor Z from guanine. [Biosynthesis of cofactors, prosthetic groups, and carriers, Molybdopterin].	5.13381e-154
NZ_CP018931.1\|WP_000732107.1\|824643_825063_+\|DUF3888-domain-containing-protein	gnl\|CDD\|379024	pfam13027, DUF3888, Protein of unknown function (DUF3888). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 111 and 149 amino acids in length.	6.20359e-07
NZ_CP018931.1\|WP_000180554.1\|807010_807433_-\|hypothetical-protein	gnl\|CDD\|212152	cd11545, NTP-PPase_YP_001813558, Nucleoside Triphosphate Pyrophosphohydrolase (EC 3.6.1.8) MazG-like domain found in Exiguobacterium sibiricum YP_001813558.1 protein and its bacterial homologs. This family contains a putative NTP_PPase (YP_001813558.1) from Exiguobacterium sibiricum and its bacterial homologs. Unlike normal dimeric dUTPase-like proteins with a central four-helix bundle forming the active site, YP_001813558.1 displays a very unusual interlaced segment-swapped dimer that might be important for it to adapt to an extremely cold environment. Moreover, structural analysis and comparisons indicate that YP_001813558.1 potentially prefers to hydrolyze dCTPs or its derivatives.	1.24419e-63
NZ_CP018931.1\|WP_075396128.1\|807898_808978_-\|Ger(x)C-family-spore-germination-protein	gnl\|CDD\|274338	TIGR02887, Spore_germination_protein_B3, germination protein, Ger(x)C family. Members of this protein family are restricted to endospore-forming members of the Firmicutes lineage of bacteria, including the genera Bacillus, Clostridium, Thermoanaerobacter, Carboxydothermus, etc. Members are nearly all predicted lipoproteins and belong to probable transport operons, some of which have been characterized as crucial to germination in response to alanine. Members typically have been gene symbols gerKC, gerAC, gerYC, etc. [Transport and binding proteins, Amino acids, peptides and amines, Cellular processes, Sporulation and germination].	3.60393e-98
NZ_CP018931.1\|WP_075396127.1\|808953_810048_-\|GerAB/ArcD/ProY-family-transporter	gnl\|CDD\|281794	pfam03845, Spore_permease, Spore germination protein.	3.32044e-95
NZ_CP018931.1\|WP_139316695.1\|823331_823853_+\|molybdopterin-guanine-dinucleotide-biosynthesis-protein-B	gnl\|CDD\|349770	cd03116, MobB, molybdopterin-guanine dinucleotide biosynthesis protein B. Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes. In Escherichia coli, the synthesis of Moco involves genes from several loci: moa, mob, mod, moe and mog. The mob locus contains mobA and mobB genes. MobB catalyzes the attachment of the guanine dinucleotide to molybdopterin.	1.73793e-41
NZ_CP018931.1\|WP_000350858.1\|825099_825957_+\|glucose-uptake-protein-GlcU	gnl\|CDD\|227309	COG4975, GlcU, Putative glucose uptake permease [Carbohydrate transport and metabolism].	1.17813e-118
NZ_CP018931.1\|WP_000621794.1\|824316_824550_+\|molybdopterin-converting-factor-subunit-1	gnl\|CDD\|340452	cd00754, Ubl_MoaD, ubiquitin-like (Ubl) domain found in molybdenum cofactor biosynthesis protein D (MoaD) and similar proteins. MoaD, also termed molybdopterin synthase sulfur carrier subunit, or MPT synthase subunit 1, or MPT synthase small subunit, or molybdopterin-converting factor small subunit, or molybdopterin-converting factor subunit 1, is a conserved small sulfur carrier protein that has beta-grasp ubiquitin-like (Ubl) fold involved in biosynthesis of the molybdenum cofactor (Moco), an essential cofactor of a diverse group of redox enzymes. MoaD is activated in an ATP-dependent manner by sulfurtransferases similar to the activation mechanism of ubiquitin-activating enzyme E1.	3.20312e-19
NZ_CP018931.1\|WP_000512463.1\|814401_814626_+\|spore-germination-protein	gnl\|CDD\|371190	pfam10676, gerPA, Spore germination protein gerPA/gerPF. This is a bacterial family of proteins that are required for the formation of functionally normal spores. Proteins in this family may be involved in establishing normal coat structure and/or permeability which could control the access of germinants to their receptor.	3.97675e-14

>NZ_CP018931.1|WP_001110865.1|814646_814970_+|hypothetical-protein
MPAHIKEFVIVNNTGNIFTGDNLSDTSFTATKSYSGSMGCTWIDVVTVIGTETKLCLQPGDSVTTTYTRGTPAGTVTGTNMGQSVNTSGIAQAVPNTDNMDSTAGLP
>NZ_CP018931.1|WP_000512463.1|814401_814626_+|spore-germination-protein
MGINLRKVKIINNTGAVNVGDCYDISPLAVAKVYAGAGGSSAAIFLNGKRQPEAVIRTSVFLPPLATSTRTLGS
>NZ_CP018931.1|WP_000141221.1|814018_814324_+|rhodanese-like-domain-containing-protein
MTEVKTITTEEVQERLENGETLFLVDVREDEEVATGKIPEAVHIKMGDIPNKVDFFDKKNEYIFICRSGMRSENVCHYLNEQGFKTVNMVGGMLQYEGETK
>NZ_CP018931.1|WP_000171893.1|813635_813818_-|hypothetical-protein
MTLFLFIMSIVFLLAAIIALSMKNNKKIKSPQEMSFLFLLLSIAFFGIAIATYIFRLQIM
>NZ_CP018931.1|WP_075396125.1|812461_813586_+|homoserine-O-acetyltransferase
MQIVKKEKFILKEYTFENGRTIPVQMGYETYGTLNRERSNVILICHYFSATSHAAGKYTAHDEESGWWDGLIGPGKAIDTNEYFVICTDNLCNVQVKNPHVITTGPKSINPKTGDEYAMDFPVFTFLDVARMQCELMKDMGIARLHAVMGPSAGGMIAQQWAVHYPHMVERMIGVITNPQNPIITSVNVAQNAIEAIRLDPSWRGGKYGEEQPMKGLQLANRMMFMNAFDEHFYETTFPRNSIEVEPYEKVSSLTSFEKEINKLIYRSIELVDANSWMYTAKAVLLHDIAHGFSSLEEALSNVEANVLMIPCKQDLLQPSRYNYKMVDLLQKQGKYAEVYEIESINGHMAGVFDIHLFEKKVYEFLNRKVSSFV
>NZ_CP018931.1|WP_075396126.1|810065_812309_-|spore-germination-protein-GerIA
MIWNWLRKKKKSNTTEKNETDNSEQKPNNQEDDNKEQTRSTKHNKGNNSEQKKEEHKESSQDKQQNQSNQNQQQSAKQDESSQEQQNHSKQNDSDQGQQQHSKQDDSNQGQQNHSKQDDSNQGQQNHSKQDDSNQGQQNHSKQNDSDQGQQQHSKQGDSNQGQQNHSKQDDSNQGQQNHSKQNDSDQVQQQHSKQDESSQEQQNHSKQDDSDQDHSSQDKQQSSKQDDLAQDKQQHSKQDNSDQDKQQNSKGNSIYDFSKPEKDRIHSLQDLIEKLKKSSDFVNYHTSDDETMPYWISYYRPSLDGEKLQKYLMPTLLERPNASLEELKEHIPMSGITITNDLQKIEDMVLKGHAIVQVNQQDQKCMLANIAIDNYRAPTPPLNESTVIGPQEGFVEDIDTNINLVRKRLPVLDLQTKEMIVGEFSKTKVVMMYLDNLAEKDNVDFLEESLRALEYDQINDSAYIQELMGEKSIFPLYINTERTDRVTKALIDGKIAIFVDGSPSVLLTPVSYFDFFISPEDYNVSWMYATFSRVLRLIAVLFSICATPLYVAVLNYHYELIPSDLLETLILSRAQVPFPPLIEALFLELAIDLLREAGARLPMKVGQTLGIVGGIVIGQASVQAGLTSNILLIIVALSALASFITPIYKMGNAVRLLRFPFLIFAEIGGLFGISLGFIFLFTHLFRLTSLRKPYALFYPTRQQSVKDSWIRFPLTMIDTRDVQARPQHVKKATKGISTKHRSDFDD
>NZ_CP018931.1|WP_075396127.1|808953_810048_-|GerAB/ArcD/ProY-family-transporter
MSKVQEKYQISPIFVFFLIHGAQFGAGVLGFARITAKAAGYDGWIGVLITGLCIHLLIWMMYFLLKETNGNLIDLQRQTFGKWIGNIFNIIFAAYFLIVSISVIRTYVEIIQVWMFPTASTWMLTLFLCLVSYYIVSSGFRVITGICVISVGGTLGYLFLSLFVLKYSHWDNLLPIFTHSFSDILKSAQVSIYSMTGFEIYLMVYPFVKKPMQSHKYAQLGALFSNLLYLFSTLLAFAFFSEKQLLKTIWAQLSMTQVIQLPFIERLEYIAISGYALVIISSFILPLWAATRATHEIFRVKQRGVLIAFIFITLIVSQLLTNRHDINNFISNASKGSFWLIYVYIPILFIIVWVKRKWKKSKAN
>NZ_CP018931.1|WP_075396128.1|807898_808978_-|Ger(x)C-family-spore-germination-protein
MEKIKSKLMLISCIALFSLTGCLQKNIIDDVHLIQGTVFDVAKDNKIKVTFVCPIQQKGNKVQVFEGTANAVKQVKADTSLESSQPFASGQMRVALFTTRIAKKGMVASFDTLIRDVNIGNALYVALLDGNGTELLKGKYTTSSNVAIYIKKMLEHNMKTGPLPTDNLHIGAFRYYQEGQDYYIPILKKHVDKIKITGIGLFKKDKYVGKIAEKDMFVFKGLLEEHKLDSHEFKADPGYVMINNIRSVPTYDIKIKNGKPSFSIHVKLDARIQEVSKQINLENAKNTKKIEKVVQKQLNTQAAKLIKQFKSLGVDPLGLGAKYKQHYRPFKLEEWKQMYKDVPVTIKYTVNITNSGVIE
>NZ_CP018931.1|WP_000038783.1|807622_807808_-|hypothetical-protein
MSKKLVKPILNGILFLGVFLFAHTYLKNVSFTRYLLVVIPMLLVGMFGIDLILSILIKKEE
>NZ_CP018931.1|WP_000180554.1|807010_807433_-|hypothetical-protein
MTNEKGLDKGYELVAKMHEVFGHPVTNTPTKLTEERAKIRASFMQEELEEFLEATTVEDQYDALIDLIYFAFGTFAEMGVRPDKGFEIVNNANMAKLFPDGKPRFREGDGKILKPEGWQAPEPQLRAEIERQRQEAEKNC
>NZ_CP018931.1|WP_075396123.1|819427_820441_+|GTP-3',8-cyclase-MoaA
MQEMVTDFFGRPLQDLRISVIDRCNFRCTYCMPAEVFGPDYAFLKDEFLLTFDEIERLAKLFVSIGVRKIRLTGGEPLLRKDLAKLIARLVKIDGLLDIGLTTNAIHLTKQAKVLKEAGLHRVNVSLDAIDDDVFKAINGRNINTKPVIKGIMAAKEAGLDVKVNMVVKKGMNDHQVLPMAAYFKEQGIPLRFIEFMDVGSTNGWNFDQVVTKRELIEMIHRVYPLEPAEAHYFGEVAKRYRYVGTNVEVGFITSVSESFCSSCTRARISADGKFYTCLFATEGLDMRELLRAKLSDDELLSVIQDVWMNRKDRYSDERTEESAKNRPKIEMSYIGG
>NZ_CP018931.1|WP_001158088.1|820457_821471_+|molybdopterin-synthase-adenylyltransferase-MoeB
MQERYSRQILFSGVGEEGQRKIREKHVLIIGAGALGAANAEAIVRAGVGKITIADRDYVEWSNLQRQQLYTEEDAKQYKPKAVAAAEHLKAINSEVEINPVVTDVTVQEMEELVKGVDLILDATDNFETRLLINDISQKYNIPWIYGGCVGSYGVTYTIVPGKTPCFRCLMEHPASGATCDTAGIIQPAVQLVVAHQITEALKILVEDFEALRETMLSFDLWNNQQMAFKVNRQKKDTCLSCGRLRTYPSLTFEAQTKTEVLCGRNTVQIRPGVRNEFNLEEIKKRLKRSVDVKATPYLVSFLVEEFRFVLFTDGRAFIHGTNDINVAKRLYTRYIG
>NZ_CP018931.1|WP_000094141.1|821509_821995_-|cyclic-pyranopterin-monophosphate-synthase-MoaC
MSSFTHFNDQGRAKMVDISDKKATVRTAIACSSIVVTKEIYDKISHNEIGKGDVLAVAQIAGIMAAKRTSDIIPMCHPLLLKGVDVSFDWKQSDEQYRLLIEVKVKTEGSTGVEMEALTAASATALTVYDMCKAVDKGMIIGETYLLEKTGGKSGDYTRKS
>NZ_CP018931.1|WP_075396122.1|822078_823368_+|molybdopterin-molybdotransferase-MoeA
MVEKRIPIQVAEAVERVMEYAKIGEIEEVSITESYGRILGEDVVSDHDVPHFDRSPYDGFAIRAEDTKEANQENAIEFEVIGEIGAGSVFTEEVGSFQAVRIMTGAAIPADCNAVVMLELTEGFEKNGKTYMKLKRPFHSGDNVSFKGEDIKQNQVLVKKGAVINPGVAALLATFGYSNVKVVKQPVVGIVTTGSELLEVHESLQPGKIRNSNSYMIAAQIMKAGGKVRYYGQLADELDACFTAVQSAIEEVDILITTGGVSVGDYDYLPAIYERLQANVLFNKIAMRPGSVTTVAEVDGKLLFGLSGNPSACYVGFELFVHPVIKTYLYAKEPHVYRADAILQKDFPKPNPFTRFVRAKVTIVDGALHAMPVGLDKSSAVSSLADANAFIVLPGGTRGFETGMKVSVLLLEHAEGCDWPWAKPLQSYK
>NZ_CP018931.1|WP_139316695.1|823331_823853_+|molybdopterin-guanine-dinucleotide-biosynthesis-protein-B
MAVGKAPSILQIVGYQNSGKTTLVEKIVHVLTESEMKVATIKHHGHGGFPEVAQKDSERHRKAGAIVSSVEGAGLLSLSSLREEWSLQEIIRLYEFFEVDTILIEGYKKESYPKVVLLRSAEDVELLQKVENIVAVITWYDAPANLREEYKVFHITEEKLYIDWFLQTVRSAK
>NZ_CP018931.1|WP_075396121.1|823849_824314_+|molybdopterin-synthase-catalytic-subunit-MoaE
MTNTYYEVIDTEISIEEVAKRVIRRECGAVTTFIGTVREFTKGRRTLYLEYVVYKTMAEKMLEKIGSEVKEKWPGTHVAITHRIGTLQISDIAVVVAVSTPHRKAAYEANEYIMERIKQIVPIWKKEFWEDGDSWIGDQLEKTPYPAGEPGKEL
>NZ_CP018931.1|WP_000621794.1|824316_824550_+|molybdopterin-converting-factor-subunit-1
MIRVLLFANLQEEAGRSELQIEKESITVAELKDVVAKEYNVPVTEPIMVAINEEYANEEDTIQSGDVVALIPPVSGG
>NZ_CP018931.1|WP_000732107.1|824643_825063_+|DUF3888-domain-containing-protein
MKKLCVMLTMICSIFSFFPSYSLAKESNEQLLESALLNRYYSVIRQVTEDQYECASVINIKRLGKNGEFVPRYEVTLQFLTFQGAHNPPNDKVTLTLEDYLDHVRIKKVEREKNVSGALAEKICEREKEKIKAHSTDSE
>NZ_CP018931.1|WP_000350858.1|825099_825957_+|glucose-uptake-protein-GlcU
MDIFLAILPAIFWGSIVLFNVKLGGGPYSQTLGTTFGALIFSIVVYIFMKPVLTPTVIGVGIVSGLFWALGQANQLKSIDLMGVSRTMPISTGLQLVSTTLFGVIVFHEWSTTISVVLGVLALVCIIIGVILTSLQSEEEKNAEQAGNFKRGIIILLISTVGYLVYVVVIRLFNVDGWSALLPQAVGMVLGGILLTFKHHPFNKYAIRNIIPGLIWAAGNMFLFISQPRVGVATSFSLSQMGIIISTLGGILILGERKTKRQLTGIVVGIVFIIAAGIMLGIAKS
>NZ_CP018931.1|WP_075396120.1|825970_826756_+|glucose-1-dehydrogenase
MYSDLAGKVVVITGSATGLGRAMGIRFAKEKAKVVINYRSRESEAHDVLEEIKKVGGEAIAVKGDVTVESDVVNLIQSAAKEFGTLDVMINNAGIENAVPSHEMPLEDWNKVINTNLTGAFLGSREAIKYFVEYDIKGSIINMSSVHEKIPWPLFVHYAASKGGMKLMTETLAMEYAPKGIRVNNIGPGAINTPINAEKFADPKKRADVESMIPMGYIGKPEEIAAVATWLASSEASYVTGITLFADGGMTLYPSFQAGRG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP018931_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018931_2

863055-863162

Orphan

Consensus_repeat	Method
GATATATTCAAAAAATCGCTGATATA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP018931_2

>merge|NZ_CP018931|2|863055-863162|CRISPRCasFinder
GATATATTCAAAAAATCGCTGATATATTTCGAGTTGTGGTCGATATATTTAAAAAATCGCTGATATATTTCGAGTTGCGGTTGATATATTCAAAAAATCGCTGATATA

>NZ_CP018931|2|1|863055-863162|CRISPRCasFinder
GATATATTCAAAAAATCGCTGATATA	TTTCGAGTTGTGGTCGATATATTTAAAAAATCGCTGATATATTTCGAGTTGCGGTT
GATATATTCAAAAAATCGCTGATATA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018931.1\|WP_001010626.1\|858504_858909_+\|PH-domain-containing-protein	unknown	unknown	gnl\|CDD\|369049
NZ_CP018931.1\|WP_001998456.1\|860832_861390_+\|DUF948-domain-containing-protein	unknown	unknown	gnl\|CDD\|227109
NZ_CP018931.1\|WP_072180245.1\|857936_858428_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP018931.1\|WP_075396110.1\|868308_869763_+\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP018931.1\|WP_075396112.1\|864857_865094_-\|DUF3949-domain-containing-protein	unknown	unknown	gnl\|CDD\|315735
NZ_CP018931.1\|WP_000757111.1\|859103_859538_+\|lipoprotein	unknown	unknown	unknown
NZ_CP018931.1\|WP_000738007.1\|861832_862849_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377863
NZ_CP018931.1\|WP_000878347.1\|858905_859088_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018931.1\|WP_000636599.1\|865622_865895_+\|DUF3917-domain-containing-protein	unknown	unknown	gnl\|CDD\|372449
NZ_CP018931.1\|WP_000267002.1\|865945_866344_-\|large-conductance-mechanosensitive-channel-protein-MscL	unknown	unknown	gnl\|CDD\|184416
NZ_CP018931.1\|WP_001057490.1\|861389_861716_+\|bacillithiol-system-redox-active-protein-YtxJ	unknown	unknown	gnl\|CDD\|378538
NZ_CP018931.1\|WP_000654739.1\|859574_860690_-\|aminopeptidase	unknown	unknown	gnl\|CDD\|225191
NZ_CP018931.1\|WP_075396114.1\|857391_857940_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP018931.1\|WP_075396113.1\|863460_864459_+\|catabolite-control-protein-A	unknown	unknown	gnl\|CDD\|130546
NZ_CP018931.1\|WP_000219465.1\|855882_857193_+\|UDP-N-acetylmuramate--L-alanine-ligase	unknown	unknown	gnl\|CDD\|234757
NZ_CP018931.1\|WP_001982862.1\|869764_870454_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP018931.1\|WP_001982812.1\|864493_864856_-\|DUF4288-domain-containing-protein	unknown	unknown	gnl\|CDD\|379479
NZ_CP018931.1\|WP_000475143.1\|867478_868159_-\|ankyrin-repeat-domain-containing-protein	unknown	unknown	gnl\|CDD\|293786
NZ_CP018931.1\|WP_000389134.1\|865175_865472_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018931.1\|WP_075396111.1\|866472_867399_-\|Gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223745

Protein	Function_ID	Function_description	E-value
NZ_CP018931.1\|WP_075396111.1\|866472_867399_-\|Gfo/Idh/MocA-family-oxidoreductase	gnl\|CDD\|223745	COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only].	9.92316e-49
NZ_CP018931.1\|WP_001010626.1\|858504_858909_+\|PH-domain-containing-protein	gnl\|CDD\|369049	pfam06713, bPH_4, Bacterial PH domain. This family consists of several hypothetical proteins specific to Oceanobacillus and Bacillus species. Members of this family are typically around 130 residues in length. The function of this family is unknown. Members of this family have a PH domain like structure.	1.11445e-09
NZ_CP018931.1\|WP_072180245.1\|857936_858428_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.10804e-16
NZ_CP018931.1\|WP_075396110.1\|868308_869763_+\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	3.34509e-60
NZ_CP018931.1\|WP_000738007.1\|861832_862849_+\|hypothetical-protein	gnl\|CDD\|377863	pfam07537, CamS, CamS sex pheromone cAM373 precursor. This family includes CamS, from which Staphylococcus aureus sex pheromone staph-cAM373 is processed.	1.43217e-62
NZ_CP018931.1\|WP_001998456.1\|860832_861390_+\|DUF948-domain-containing-protein	gnl\|CDD\|227109	COG4768, COG4768, Uncharacterized protein containing a divergent version of the methyl-accepting chemotaxis-like domain [General function prediction only].	4.44562e-36
NZ_CP018931.1\|WP_075396112.1\|864857_865094_-\|DUF3949-domain-containing-protein	gnl\|CDD\|315735	pfam13133, DUF3949, Protein of unknown function (DUF3949). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 69 and 87 amino acids in length.	1.26116e-24
NZ_CP018931.1\|WP_000636599.1\|865622_865895_+\|DUF3917-domain-containing-protein	gnl\|CDD\|372449	pfam13055, DUF3917, Protein of unknown function (DUF3917). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length.	5.28169e-24
NZ_CP018931.1\|WP_000267002.1\|865945_866344_-\|large-conductance-mechanosensitive-channel-protein-MscL	gnl\|CDD\|184416	PRK13955, mscL, large conductance mechanosensitive channel protein MscL.	5.31746e-77
NZ_CP018931.1\|WP_001057490.1\|861389_861716_+\|bacillithiol-system-redox-active-protein-YtxJ	gnl\|CDD\|378538	pfam11009, DUF2847, Protein of unknown function (DUF2847). Some members in this bacterial family of proteins with unknown function are annotated as YtxJ, a putative general stress protein. This cannot be confirmed.	4.38943e-48
NZ_CP018931.1\|WP_000654739.1\|859574_860690_-\|aminopeptidase	gnl\|CDD\|225191	COG2309, AmpS, Leucyl aminopeptidase (aminopeptidase T) [Amino acid transport and metabolism].	2.90365e-128
NZ_CP018931.1\|WP_001982812.1\|864493_864856_-\|DUF4288-domain-containing-protein	gnl\|CDD\|379479	pfam14119, DUF4288, Domain of unknown function (DUF4288). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 120 amino acids in length.	2.70128e-19
NZ_CP018931.1\|WP_075396113.1\|863460_864459_+\|catabolite-control-protein-A	gnl\|CDD\|130546	TIGR01481, catabolite_control_protein_A, catabolite control protein A. Catabolite control protein A is a LacI family global transcriptional regulator found in Gram-positive bacteria. CcpA is involved in repressing carbohydrate utilization genes [ex: alpha-amylase (amyE), acetyl-coenzyme A synthase (acsA)] and in activating genes involved in transporting excess carbon from the cell [ex: acetate kinase (ackA), alpha-acetolactate synthase (alsS)]. Additionally, disruption of CcpA in Bacillus megaterium, Staphylococcus xylosus, Lactobacillus casei and Lactocacillus pentosus also decreases growth rate, which suggests CcpA is involved in the regulation of other metabolic pathways. [Regulatory functions, DNA interactions].	0
NZ_CP018931.1\|WP_000219465.1\|855882_857193_+\|UDP-N-acetylmuramate--L-alanine-ligase	gnl\|CDD\|234757	PRK00421, murC, UDP-N-acetylmuramate--L-alanine ligase; Provisional.	0
NZ_CP018931.1\|WP_000475143.1\|867478_868159_-\|ankyrin-repeat-domain-containing-protein	gnl\|CDD\|293786	sd00045, ANK, ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.	2.20235e-25
NZ_CP018931.1\|WP_001982862.1\|869764_870454_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	1.29328e-84
NZ_CP018931.1\|WP_075396114.1\|857391_857940_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	1.23943e-26

>NZ_CP018931.1|WP_000738007.1|861832_862849_+|hypothetical-protein
MKKMALSFAVVSLLLGACSNDTISKKDEVIQKDTKEKSMIPRTAVSKDYYRTVIPLKEQKVINTANITTNSKLDLAEYENGLMNIAKEQFDTENHVLQLNQYIPEKLVDELVAKVKAPVLTNIIEQDYFGKQNSNELSLSGVIIGLAMSSSVSNEEAMSKGTEVANQLIEAIHKNDKYNKSPITFAIFKQESTSSLKNGTYIASATVQKNDTNLGNWNAIEEKAYSYPSDEFTQAHGEDNTKIDDFAKEMKGFSPGDFIPVNAKVSYKKNQMDTLNMNIVIKYNGKTELMALTQLAAQIMLEQLPKDAKVQLQIKSENKIEAIVIKEKNSDKPFVSFL
>NZ_CP018931.1|WP_001057490.1|861389_861716_+|bacillithiol-system-redox-active-protein-YtxJ
MNMTKVETIEELEVLVEKNEPYVLFKHSTTCPISHGAYTEFQAYCSEERAVPAYYLYVQDARDVSNRVAEQYSIKHESPQVLYIKDGMVVWNTSHWNIKKDALEENIK
>NZ_CP018931.1|WP_001998456.1|860832_861390_+|DUF948-domain-containing-protein
MYNRGKYEKDKGSDEMQVLLYVSAAIIAVAFAVLVVYVCRTLLSVQKTLENVASTLEGLEKQMQGISVETEQLLHKTNALADDIQQKSQSLNKVVSGVDGIGTTIHSLNTKLRNVSESVTDEIENNADKVAQVVQWSSAAIEVYNHYRATRQEKKVEKEERKLERLEKKAEKKEKRSRLRMRGES
>NZ_CP018931.1|WP_000654739.1|859574_860690_-|aminopeptidase
MKDPRIEKLAYNLINYSIRLQKGEKVLIENFGLQKELVTALVKEAYAAGGFPFVSLKDHQVDRSLLMGATEEHFEQIAAYEASVMKDMDAYIGLRSGDNINEQADVPSERMQIHGQTVGKKVHRDIRVPKTRWVVLRYPNASMAQLAKMSTEAFEDFYFEVCNLDYGKMDKAMDSLVTLMNKTDKVRLTGPGTDLTFSIKDIPAIKCSGHLNIPDGEVYSAPVRDSVNGTVSYNTPSPYNGYTFENVQLKFENGQIVEATANDTERINKIFDTDEGARYVGEFAIGVNPYILHPMGDILFDEKIDGSFHFTPGQAYDDAWNGNNSNIHWDLVCIQRPEYGGGEIYFDDVLIRKDGRFVVPELEALNPENLK
>NZ_CP018931.1|WP_000757111.1|859103_859538_+|lipoprotein
MKKVLMLFVLLLTASILLIGCSTKKEKAGMNLEKAQKVEIESLTDSSEKKVITDKKEIEKLFEVMKMDKWEMQSAPLDTPQGKTFKMYQEDTTKLSESSKDKKELHEIGTMTVYKDVPYVEVEMKNKKMSFKVPEDVAKDLLKY
>NZ_CP018931.1|WP_000878347.1|858905_859088_+|hypothetical-protein
MKYVKPLFCLEILFVIVGCTRVYTKWNLPLYVPIVIGTIAVALLYYFHFQQTKSEKSRSM
>NZ_CP018931.1|WP_001010626.1|858504_858909_+|PH-domain-containing-protein
MNFPIQRSKSVVIFVCLTLAFMFIYPIVILFTNKAHWMSALIGMGLCFIVNVPLVWEVFIKKHKVENGVLKYGILNDDIVLKEIRIIRQVGRSLEITTNSYKVHLLAMPQHMKQFLSLVEKENPHVKIEMVGKK
>NZ_CP018931.1|WP_072180245.1|857936_858428_+|GNAT-family-N-acetyltransferase
MNEKIRIVPYEGTFQEEIVDLIVHIQQKEYNVPITKEEQPDLLEIETFYQKDHGNFWVAIYDGKVVGTVALLDIENHQVALRKMFVKKEFRGKEWGASHMLLQKAISWAEDKKLKDIYLGTTVKFLAAHRFYEKNGFQSVNIDELPKNFPVLQVDKKFYRYIV
>NZ_CP018931.1|WP_075396114.1|857391_857940_+|GNAT-family-N-acetyltransferase
MFTLRVDDEIELQLLEKHHKEELYQLINQNRNHLRRWLPWVDGTKSADAYNEICTMWLKKFAEGDGFESGIRYKGKLVGMVGIHPVSWGKKAASLGYYLAEDAGGKGIMTRSVKAVLHYAFENLKLNKMEIRCGVENVKSRAIPERLEFKLDGILRDEEWLYDHFHDIAVYSLLASEWKEIR
>NZ_CP018931.1|WP_000219465.1|855882_857193_+|UDP-N-acetylmuramate--L-alanine-ligase
MTVYHFVGIKGTGMSSLAQILHDMKHTVQGSDYEKRFFTQTALEKRNISILPFDKSNVKEGQVIIAGNAFPDTHEEIVAAKELNIPVHRYHHFLGDLMNQYTSVAVTGAHGKTSTTGLLAHVMQGAHPTSYLIGDGTGHGVENSKYFVFEACEYRRHFLSYNPDYAIMTNIDFDHPDYFTDINDVFSAFQEMALQVKKGIIACGDDEELQKIQAKVPVIFYGFGEDNDFQARNIQKRTDGTIFDVFVRNTYYDTFKITGYGNHSVLNALAVIALCHYENVDVEAVKHQLTTFEGVKRRFNEKPMGEQVIIDDYAHHPTEINATIEAARQKHPEREIVAVFQPHTFSRTEKFLDEFAESLSKADQVYLCDIFGSARENKGELTIEDLQKRIDGAELITDTTTDVLKKHKNGVLIFMGAGDIQKFEAAYVKEVQVAEK
>NZ_CP018931.1|WP_075396113.1|863460_864459_+|catabolite-control-protein-A
MNVTIYDVAREANVSMATVSRVVNGNPNVKPTTRKKVLEAIDRLGYRPNAVARGLASKKTTTVGVIIPDISNTFYAELARGIEDIATMYKYNIILSNSDQNKEKEFHLLNTMLGKQVDGIVFMGEDITDIHAEEFKKSPVPIVLAASFDEQNETPSVNIDYTQAAYDAMKHFIEQGHKRIGFVSGPFIDKAGSAKKLQGYKKALEEAGISYDENLVIDGDYTYDSGIEAFEKLWGLDEKPSAIFVSSDEMALGVIHAAQDAGLNVPTDVEVLGFDNTRLALMVRPQLSTVVQPMYDIGAVAMRLLTKYMNKEKVEDHTVILPHRIQFRDSTK
>NZ_CP018931.1|WP_001982812.1|864493_864856_-|DUF4288-domain-containing-protein
MYAVKLLFESVHSGEPDPTKMDEHYEENHDTLFEESIILVKAHSLEEAHALSEQIAIQSEHTYDNMDGEQITWTFRKVLHVFELDNAPFETGKELYARFLHVKKNETVDTIVQTYYPEYK
>NZ_CP018931.1|WP_075396112.1|864857_865094_-|DUF3949-domain-containing-protein
MIWISLIVLAYFIILVPIQYNYIKILKEKQKKLNVSQNELYDNMSYEESQVHYHYQSNVFTIPASLVASIIYRVKHAA
>NZ_CP018931.1|WP_000389134.1|865175_865472_-|hypothetical-protein
MEDDIVGYFKQVERYDYIIIDLDKKFFYMEVVQLKTNITSLKISLNLDKDETIIAGNVKQYDPSRLEQFIQNFKHTAQTCLEHNLRSPEELFAFWKGN
>NZ_CP018931.1|WP_000636599.1|865622_865895_+|DUF3917-domain-containing-protein
MIVLWIITLCMTAIFAYMTLKQNGLKRFVPGSILAGIALITYVTSIFIESVSVDMSTSLMFMGITLFASSIMVLMVAGIILFIHMNSETL
>NZ_CP018931.1|WP_000267002.1|865945_866344_-|large-conductance-mechanosensitive-channel-protein-MscL
MWNEFKKFAFKGNVIDLAVGVVIGAAFGKIVSSLVKDIITPLLGMVLGGVDFTDLKITFGKSSIMYGNFIQTIFDFLIIAAAIFMFVKVFNKLTSKREEEKEEEIPEPTKEEELLSEIRDLLKQQNSSKDRA
>NZ_CP018931.1|WP_075396111.1|866472_867399_-|Gfo/Idh/MocA-family-oxidoreductase
MNKPNIGMIGLGSIAQKAYLPTLTKETDWNFVGAFTPNAEKRKQICQQYRIQDFHSIETLASECDAIFVHSSTASHYEIVSELLKKGIDVYVDKPLAATVEQAEKLVELSEKYNRKLMVGFNRRFVPMYVAAKEQAHHISWIRIEKHRTNKVGPYTYDFTMLDDYLHIVDTARWLANDELNVVHNMMQINEKNELLYGHHTYTTANGLLLSTAMHRNAGTNLEQIELVTAGKIIRVKNMNTFEVEQENSVSQSGSPSWETTLKQRGFEDAVHHFIDCVHGDTKPLVDGLEGLKTQQMLQSLLNDINKN
>NZ_CP018931.1|WP_000475143.1|867478_868159_-|ankyrin-repeat-domain-containing-protein
MFKKTLSMICCVIFLQGCSQEQEVKKEMTNMETALLTATEKQETNTVISLLKKGADINITDNKGRTPLMIATYKNDVKTAKALIDAGADVNIQDDMKNNPFLYAGAEGYLDILKLTIDAGADPSLTNRYGGTALIPASEHGYIDVIKELLTRTNIDVNHVNNLGWTALMEAIVLSNGNETQQQVIRLLIEHGADINIPDNDGVTPLEHARAHNFEEIEKILLEGHK
>NZ_CP018931.1|WP_075396110.1|868308_869763_+|HAMP-domain-containing-histidine-kinase
MSIKTRFLFSYIAVILVSITLILIAGFLIVFSITGDLEAVKNFYKSSYIQKPLTSEEENAYIELKTAAKKHQSQLLDESFVSSLEKEGVKIVVRKGETISYATKVFESVALKEALPKFESANINSRGTTELGDTFYRYVKFDFYFPQEEEGSIFVLKKQSSFVDLTQKLFPILFVSLLLLAILLIGLLSYLVSRSVIKPIFVLKDATGKIKEGNLDFQIPVTSHDEIGQLNQGFEEMRKKLKESIEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANTPEKMDKYLTTIHTKARHMDTLIDELFLFSKLDLNRVPFQFETVELNMFMQELIEEMQMDLSKEGIEVNLQLHASPLYVKADCEKINRVISNLIHNSVKYMDKEEKKITVTVWSDNNKVIVKAMDNGSGIESDTLPYIFERFYRAEQSRNSSTGGSGLGLAIAKQIIEEHGGNIWAESELGEGTSIFFSLEKVEKCGE
>NZ_CP018931.1|WP_001982862.1|869764_870454_+|response-regulator-transcription-factor
MKRILLIEDEVSIAELQRDYLEINDFQVDVEHSGETGLQMALQEDYDLIILDIMLPKMNGFEICKQIRAIKDIPILLVSAKKEDIDKIRGLGLGADDYITKPFSPSELVARVKAHISRYERLLGNVSKQRDTLYIHGISIDQRARKVFINNEEIAFTTKEFDLLTFFVTNPNQVLNKEQLFERIWGLDSAGDLATVVVHIRKLREKIERDPAHPQYIETVWGAGYRFNV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP018931_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018931_3

1790785-1791188

Orphan

Consensus_repeat	Method
CCAGTAGCACCTGTGTTACCTTGAAC	CRT

8 spacers

The CRISPR arrays of NZ_CP018931_3

>merge|NZ_CP018931|3|1790785-1791188|CRT
CCAGTAGCACCTGTGTTACCTTGAACGCCTTGAGGTCCAGTAGCGCCAGTAGCACCTGTGTTACCTTGAACACCCTGAGGTCCAGTAGCGCCAGTAGCACCTGTGTTACCTTGAACACCCTGAGGTCCAGTAGCACCTGTAGCACCAGTAGCACCTGTGTTACCTTGAACGCCTTGAGGTCCAGTAGCGCCAGTAGCACCTGTGTTACCTTGAACACCCTGAGGTCCAGTAGCACCTGTAGCACCAGTAGCACCTGTGTTACCTTGAACGCCTTGAGGTCCAGTAGCGCCAGTAGCACCTGCTGGTCCTTGAGCGCCTTGAGGTCCAGTGGCACCAGTAGCACCCGTGTTACCTTGAACGCCTTGAGGTCCAGTAGCGCCAGTAGCACCCGCTGGTCCTTGAGC

>NZ_CP018931|3|2|1790785-1791188|CRT
CCAGTAGCACCTGTGTTACCTTGAAC	GCCTTGAGGTCCAGTAGCG
CCAGTAGCACCTGTGTTACCTTGAAC	ACCCTGAGGTCCAGTAGCG
CCAGTAGCACCTGTGTTACCTTGAAC	ACCCTGAGGTCCAGTAGCACCTGTAGCA
CCAGTAGCACCTGTGTTACCTTGAAC	GCCTTGAGGTCCAGTAGCG
CCAGTAGCACCTGTGTTACCTTGAAC	ACCCTGAGGTCCAGTAGCACCTGTAGCA
CCAGTAGCACCTGTGTTACCTTGAAC	GCCTTGAGGTCCAGTAGCG
CCAGTAGCACCTGCTGGTCCTTGAGC	GCCTTGAGGTCCAGTGGCA
CCAGTAGCACCCGTGTTACCTTGAAC	GCCTTGAGGTCCAGTAGCG
CCAGTAGCACCCGCTGGTCCTTGAGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018931.1\|WP_000391400.1\|1795228_1796503_+\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NZ_CP018931.1\|WP_000312272.1\|1794512_1795136_-\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NZ_CP018931.1\|WP_000228316.1\|1780385_1780928_+\|DUF420-domain-containing-protein	unknown	unknown	gnl\|CDD\|225204
NZ_CP018931.1\|WP_000135328.1\|1798380_1799715_+\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NZ_CP018931.1\|WP_080496846.1\|1800496_1800838_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018931.1\|WP_000957281.1\|1782366_1783119_+\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NZ_CP018931.1\|WP_001989514.1\|1779732_1780074_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018931.1\|WP_000504940.1\|1787667_1788621_+\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NZ_CP018931.1\|WP_000438185.1\|1793286_1794243_+\|stage-V-sporulation-protein-K	unknown	unknown	gnl\|CDD\|163057
NZ_CP018931.1\|WP_000656783.1\|1797942_1798332_+\|transcriptional-repressor-GlnR	unknown	unknown	gnl\|CDD\|133380
NZ_CP018931.1\|WP_075395434.1\|1784040_1785897_+\|PTS-fructose-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|236740
NZ_CP018931.1\|WP_000450309.1\|1792207_1793173_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|227308
NZ_CP018931.1\|WP_001179101.1\|1781044_1782208_+\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341466
NZ_CP018931.1\|WP_075395431.1\|1796495_1797767_+\|methionine-gamma-lyase-family-protein	unknown	unknown	gnl\|CDD\|311036
NZ_CP018931.1\|WP_075395433.1\|1786245_1787178_+\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|226112
NZ_CP018931.1\|WP_000814422.1\|1787240_1787486_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018931.1\|WP_000253961.1\|1802026_1802266_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018931.1\|WP_000640848.1\|1783115_1784027_+\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|238570
NZ_CP018931.1\|WP_000813896.1\|1788642_1788867_+\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NZ_CP018931.1\|WP_080496848.1\|1799826_1800198_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271189

Protein	Function_ID	Function_description	E-value
NZ_CP018931.1\|WP_000391400.1\|1795228_1796503_+\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
NZ_CP018931.1\|WP_000312272.1\|1794512_1795136_-\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	1.58902e-60
NZ_CP018931.1\|WP_000438185.1\|1793286_1794243_+\|stage-V-sporulation-protein-K	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	1.45261e-155
NZ_CP018931.1\|WP_000135328.1\|1798380_1799715_+\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NZ_CP018931.1\|WP_000957281.1\|1782366_1783119_+\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	4.52687e-82
NZ_CP018931.1\|WP_000228316.1\|1780385_1780928_+\|DUF420-domain-containing-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	1.75148e-56
NZ_CP018931.1\|WP_000504940.1\|1787667_1788621_+\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	5.63434e-166
NZ_CP018931.1\|WP_000656783.1\|1797942_1798332_+\|transcriptional-repressor-GlnR	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.14369e-23
NZ_CP018931.1\|WP_000450309.1\|1792207_1793173_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|227308	COG4974, XerD, Site-specific recombinase XerD [DNA replication, recombination, and repair].	2.42194e-13
NZ_CP018931.1\|WP_001179101.1\|1781044_1782208_+\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341466	cd08187, BDH, Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. The butanol dehydrogenase (BDH) is involved in the final step of the butanol formation pathway in anaerobic micro-organism. Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. Activity in the reverse direction is 50-fold lower than that in the forward direction. The NADH-BDH has higher activity with longer chained aldehydes and is inhibited by metabolites containing an adenine moiety. This protein family belongs to the so-called iron-containing alcohol dehydrogenase superfamily. Since members of this superfamily use different divalent ions, preferentially iron or zinc, it has been suggested to be renamed to family III metal-dependent polyol dehydrogenases. This family also includes E. coli YqhD enzyme, an NADP-dependent dehydrogenase whose activity measurements with several alcohols demonstrate preference for alcohols longer than C3. The active site of YqhD contains a Zn metal, and a modified NADPH cofactor bearing OH groups on the saturated C5 and C6 atoms, possibly due to oxygen stress on the enzyme, which would functionally work under anaerobic conditions.	0
NZ_CP018931.1\|WP_075395431.1\|1796495_1797767_+\|methionine-gamma-lyase-family-protein	gnl\|CDD\|311036	pfam06838, Met_gamma_lyase, Methionine gamma-lyase. This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.	0
NZ_CP018931.1\|WP_075395433.1\|1786245_1787178_+\|SH3-domain-containing-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	1.85357e-35
NZ_CP018931.1\|WP_000813896.1\|1788642_1788867_+\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.4363e-41
NZ_CP018931.1\|WP_000640848.1\|1783115_1784027_+\|1-phosphofructokinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	1.78514e-142
NZ_CP018931.1\|WP_075395434.1\|1784040_1785897_+\|PTS-fructose-transporter-subunit-IIC	gnl\|CDD\|236740	PRK10712, PRK10712, PTS system fructose-specific transporter subunits IIBC; Provisional.	2.06009e-142
NZ_CP018931.1\|WP_080496848.1\|1799826_1800198_-\|site-specific-integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	5.41641e-23

>NZ_CP018931.1|WP_000813896.1|1788642_1788867_+|RNA-chaperone-Hfq
MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAISTFVPQKNVSIELE
>NZ_CP018931.1|WP_000504940.1|1787667_1788621_+|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MGEVQREKVAVIIGPTAVGKTKLSIDLAKALNGEIISGDSMQIYRTMDIGTAKVTKEEMDGIPHYMVDIKNPEESFSVAEFQERVRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREQMEKLALERGVEYVHKKLQEVDPESAERIHANNVRRVIRALEIFHTSGEKMSDQLEKQENELLYDVSLIGLTMDREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQSIQAIGYKEIYDYFEDRVSLEEAVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEKTSEILRYIEGKLQLKSNNSK
>NZ_CP018931.1|WP_000814422.1|1787240_1787486_-|hypothetical-protein
MKQSTINFSSLTKDLILATATKEQNCSQEELYFALNCLLRSFHSTLQETTLHTENKNTEYIQNQFCSAYKIITGKTIYPFQ
>NZ_CP018931.1|WP_075395433.1|1786245_1787178_+|SH3-domain-containing-protein
MKKLLGIATAAVFGLGIFAGSAKAETIVTTDVLNVRENPTVESKLVGKMLSGNKLDVINTENGWTKIKVNGKEAFVSAEFTKSTYYVTAGVLNVRAGANTDSEILGKLNKDDVIETTNQVQNEWLQFDYNGKVGYVHVPFLTGTAPVVEKKEVVTQEEAPVRVNAPVKNNKVVKNKESVKTVESSKPVAKAKPAVQQVAKSKGTSAPAGGREITVEATAYTAHPSENGTYGGRVLTAMGHDLTANPNMKVIAVDPKVIPLGSKVWVEGYGEAIAGDTGGAIKGNRIDVLVGSDGSANSWGRKSVKVKVIE
>NZ_CP018931.1|WP_075395434.1|1784040_1785897_+|PTS-fructose-transporter-subunit-IIC
MKITELLKRDTVIMNLTASNKEAVIDELVEKLNGANRLNGKAEFKEAILKRESQSTTGIGEGIAIPHAKTKAVKQPAICFGRSVSGINYESLDGQPAHLFFMIAASEGANNTHLETLSRLSTLLMDEGFRKQLLEAKDEEELLRLFDEKENEKEEEVEVAQPEGNEPYVLAVTACPTGIAHTYMAADSLKAKAAELGIAIKVETNGSTGIKNGLTKEDIERATAIIVAADKQVEMNRFAGKHVIQVPVADGIRKTEKLLNRAVKQDAPIFKGIKEDGKTESTEKEKGLGIYKHLMNGVSNMLPFVVGGGILIALAFSFGGIKAEGPLAELFMSIGGGGTGAFLFLVPILAGFIASSIADRPGFMPGVVGGFLAAHANAGFLGGLIAGFLAGYVVLGLKRLFSGLPVQLEGIKPVLLYPVFGLLITGVVMQKVVIPPVVALNEMLTGWLNGLNGTNAILLGLILGAMMAIDMGGPINKAAFTFGIAAIEAQNFGVHSAVMAGGMVPPLAIALATTFFKSKFTEAERKSGLTNYIMGASFITEGAIPFAAADPVRVIVSCVVGSSIAGALSMLFQITLPAPHGGLFVIALVNKPVLYIFSILIGAVVSALMMGIWKKKVK
>NZ_CP018931.1|WP_000640848.1|1783115_1784027_+|1-phosphofructokinase
MIYTVTLNPSIDYVVQVNSLDLGAVNRAEKDMKFPGGKGINVSRVLHRLGVENVALGFTGGFTGRFIKDVLQTEGVITNFVQVDGDSRINVKIKGQEETELNGQGPSVTNEQFEQLMKQIESMQKGDYVVLAGSVPASIPTTFYESIAAFGAEKGIRVVVDASGSALQHVVKNKPFLIKPNHHELGELFGVEISTAEDILPYGRKLIEQGVEHVIVSMAGDGALLFTAEGIYEATVPKGVVINSVGAGDSLVAGFVGKYEQTKDIEKAFQYGVATGSATAFSADLCEKEKVEELLSQVIVTKR
>NZ_CP018931.1|WP_000957281.1|1782366_1783119_+|DeoR/GlpR-transcriptional-regulator
MLTPERHQMILQLVKEQKVVKLQQLVERTESSESTIRRDLAQLEKQRLLKRVHGGAAVLTGKGQEPTMVEKSSKNIQIKQQIAKYAASVVEQGDCIYLDAGSTTFEMIPFLINKDVTVVTNGLMHIEALVENNIRAYLLGGMMKSRTKALIGAMAQESMQKYRFDKCFLGANGVHEQLGFTTPDPEEALLKQMALTLANEGYFLIDESKFSEVAFAKIANVEEANIITNHLEIDLEKYKRQTNVIEADKQ
>NZ_CP018931.1|WP_001179101.1|1781044_1782208_+|iron-containing-alcohol-dehydrogenase
MQNFVFRNPTKLIFGKGQLEQLKTEIPQFGKKVLLVYGGGSIKRNGIYDNVISILKEINAEVFELTGVEPNPRVSTVKKGIQICKDNGVEFILAVGGGSVIDCTKAIAAGSKYDGDVWDIVTKKTFASEALPFGTVLTLAATGSEMNAGSVITNWETNEKYGWGSPVTFPQFSILDPAHTASVPKDQTIYGMVDIMSHVLEQYFHHGTNTELQDRYCESVLKTVIETAPKLLSDLENYEHRETILYCGTMALNGILAMGVKGDWATHNIEHAVSAVHDIPHGGGLAILFPNWMKHVVDENVSRFKQFAIRVFDVKTDGKTDREIALEGIEALRQFWNSIEAPVTLSDYAIGENEIDVMADKAMAYGEFGNFKKLNKDDVLSIYRASL
>NZ_CP018931.1|WP_000228316.1|1780385_1780928_+|DUF420-domain-containing-protein
MVDQSTNQKSYAPIVITLSVIVNAIILFLFFGPVGYEGEVHFDVTILPMLNAIFNSFTFVFLLAALYSIIKKNVKMHRGFILAAFTTTLLFCVSYLSYHYLAPATHFGGEGFIKYVYFIILITHIILAAIIVPLALFALVFGFTNQLTRHRKIVRWTMPIWLYVSLSGVIVYLMISPYYQ
>NZ_CP018931.1|WP_001989514.1|1779732_1780074_+|hypothetical-protein
MIKKEGGMTMEEYVLELYNLLYTTEWQDIVSFLGIVFCMKIVIVYMEEQGMFYSFSSPFDMQREPLLNYAKVNYEQFPFVVFFMIRFITAIVKKKESDDEECHSTCNVANVFS
>NZ_CP018931.1|WP_000450309.1|1792207_1793173_-|tyrosine-type-recombinase/integrase
METTEFHDTIQAFSIFLLNKGRKPSTIKRYVYDIEDFGHWLEKNKKLPSSNIWATLCTKDYEDYFSDLKKNRHYSEKTMHRVFIVLNRMHHFLNIPNPLKNMEISIQPDRTLRNEDFISSDEEKRLKHIVTSLEGLSEKQRPVRPLLMDRNIAILNLLIDYGLSLQELTALTMHHVHFETNTLSIPATAGVERTISLTSEDKKQLYTYYKSIPEPVRPKYHSNDPLFVAFDFNRGTYRWVYENDAPKGLTEIAIQKMIRLEVSRANLRKGISGQHFRNTYILNLIKKETPESEIIKLAGFKSKISLKRYYQYAENGKNALS
>NZ_CP018931.1|WP_000438185.1|1793286_1794243_+|stage-V-sporulation-protein-K
MEQSMRKKNNNQINIVLNHRKKISLPAAENKTVISSETTTKHEMLQRIEEEMGKLVGMDDIKKIIKEIYAWIYVNKKRQEIGLKSEKQVLHMLFKGNPGTGKTTVARMIGKLLFEMNILSKGHLVEAERADLVGEYIGHTAQKTRDLIKKAMGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHGFVLILAGYSREMNHFLSLNPGLQSRFPFIIEFADYSVNQLLEIGKRMYEEREYQLSKEAEWKFRDHLHAVKYSSQITSFSNGRYVRNIVEKSIRTQAMRLLQEDAYDKYDLVGISSSDLMLEEETHST
>NZ_CP018931.1|WP_000312272.1|1794512_1795136_-|trimeric-intracellular-cation-channel-family-protein
MAWEIFSIIGTIAFALSGAIVAMEEDYDIFGVYILGMATAFGGGALRNLLIGYPIVAFWQQDMLFQIALLSMTIIFLFPNKLIRHWKKWENITDAIGLSAFAVQGALYAQKLNLPISATIVAAVLTGIGGGIIRDLLARRKPLVLRAEVYAFWTILAGFLIGAQIIVSDWALYTLFILIVCFRMVSIHYKWHLPHRRIDTNERSMHK
>NZ_CP018931.1|WP_000391400.1|1795228_1796503_+|GTPase-HflX
MEEKEKVILVGCQLPQDDDEKFMHSMKELASLAKTARAELLVSTTQKRPKFHPATYIGKGKLEELTMLTEELEPDVIVFNNELTPSQIRNLSSVLDARVIDRTQLILDIFAQRAKSREGKLQVELAQLQYTMPRLMGQGLSLSRLGGGIGTRGPGETKLETDRRHIRSRIDEIKKQLAVVVEHRKRYRERRKDNKVFQVSLIGYTNAGKSTLFNRLTEADTFEENLLFATLDPTTRKMPLPSGYTVLLTDTVGFIQDLPTSLIAAFRSTLEEAGEADVILHVVDSADPNYVGHEKTVKQLLSELEINHIPIITLYNKKDELHQNFIPFPKNDFLMTSAFEEKDLLHIKEAIETKMKEEMNRYQVEIPPSEGKLLTLLKTETLLTKMEFLEDKFVYDCAGYIFAHSSLNVQLKRFLVEEGENKNV
>NZ_CP018931.1|WP_075395431.1|1796495_1797767_+|methionine-gamma-lyase-family-protein
MFDRLKNGEKIAPIVKEVESQITEVHKRADEVIESNQFRVLESFRKHKISDSHFIPTTGYGYDDIGRDTLEKVYADVFGAEAGLVRPQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNIGYNAVPLTEEGLVDLGAVAAAIHSNTKMIGIQRSKGYATRPSFIISQIKEMIAFVKEIKPDVVVFVDNCYGEFIEEQEPCHVGADLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAIFTAAFLEKLGMNTSPAWNAPRTDLIQSVQFDDKDRMIAFCQAIQYASPINSHFTPYANYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDALIEKELLTIS
>NZ_CP018931.1|WP_000656783.1|1797942_1798332_+|transcriptional-repressor-GlnR
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLVSPTRTKGNRRLFSFNDVDKLLEIKDLLDQGLNMAGIKQVLLMKENQTEAVKVKEETKEISKTELRKILRDELQHTGRFNRTSLRQGDISRFFH
>NZ_CP018931.1|WP_000135328.1|1798380_1799715_+|type-I-glutamate--ammonia-ligase
MARYTKEDIFRLAKEENVKYIRLQFTDLLGVIKNVEIPVSQLTKALDNKMMFDGSSIEGFVRIEESDMYLYPDLDTWVIFPWTAEKGKVARLICDIYNADGTPFEGDPRNNLKRVLKEMEALGFSDFNLGPEPEFFLFKVDEKGNPTLELNDNGGYFDLAPMDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYANAIRSCDDIQTFKLVVKTIARKHGLHATFMPKPLYGVNGSGMHCNLSLFKNGENVFFDQNGDLQLSDDARHFIAGILKHAPAFTAVANPTVNSYKRLVPGYEAPCYVAWSAQNRSPLVRIPASRGISTRVEVRSVDPAANPYLVMATLLAAGLDGIKNKLTPPAAVDRNIYVMTKEEREEAGIVDLPATLAQALVTLQSNEVISNALGDHLLEHFIEAKEIEWDIFRTQVHQWERDQYMSLY
>NZ_CP018931.1|WP_080496848.1|1799826_1800198_-|site-specific-integrase
MYSIVTALNEQVNSPTGSLISFNQNVNSLQQEYKKAKGNIDISIFNAFSRILKKVNIPSLDIHSLRHTHAVLLLESGANLKYIQERLGHKSIEMTSNVYSHISDKINKDSISEFEKYMSNVLE
>NZ_CP018931.1|WP_080496846.1|1800496_1800838_-|hypothetical-protein
MKISNKMFILVSIGILAMLFIRGIYNSIKFGDAEYGMAYVLGQAVGGTLAWFSIIALFASLTFLIIGFINKKRKKPIFMKSAITFGISIVSLVILVVIIFVSMNIENEHKKNR
>NZ_CP018931.1|WP_000253961.1|1802026_1802266_+|hypothetical-protein
MVSLAVMIGIVVGLSQIVKTIGLQTKYVPLLNLTLGIVLGVLFNNGDIKTNVFQGSIIGLSASGLFDHTKIMKKDADVK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP018931_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018931_4

2523389-2523586

Orphan

Consensus_repeat	Method
AGGAATGAATATTCATTCCGAAA	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP018931_4

>merge|NZ_CP018931|4|2523389-2523586|CRISPRCasFinder
AGGAATGAACATTCATTCCGATGAGGGTGTGAAAAAGAAAAGTAGGAGATGATCAATCTGTACAATTAAAGGAATGAATATTCATTCCGAAATCCATAGTTTAATAGAGCTAAAAAGTAAATTAATAGAACGAGAGGAATGAATGTTCATTCCGAAAAGTTGTTTTCAAAATAATAGGAATGAATATTCATTCCGTAA

>NZ_CP018931|4|2|2523389-2523586|CRISPRCasFinder
AGGAATGAACATTCATTCCGATG	AGGGTGTGAAAAAGAAAAGTAGGAGATGATCAATCTGTACAATTAA
AGGAATGAATATTCATTCCGAAA	TCCATAGTTTAATAGAGCTAAAAAGTAAATTAATAGAACGAG
AGGAATGAATGTTCATTCCGAAA	AGTTGTTTTCAAAATAAT
AGGAATGAATATTCATTCCGTAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018931.1\|WP_000346934.1\|2532476_2533148_-\|TerC-family-protein	unknown	unknown	gnl\|CDD\|163429
NZ_CP018931.1\|WP_000923439.1\|2535747_2536431_+\|DNA-alkylation-repair-protein	unknown	unknown	gnl\|CDD\|132880
NZ_CP018931.1\|WP_000551420.1\|2534076_2534904_-\|polysaccharide-deacetylase	unknown	unknown	gnl\|CDD\|200569
NZ_CP018931.1\|WP_001106984.1\|2535121_2535382_+\|lipoprotein	unknown	unknown	gnl\|CDD\|236766
NZ_CP018931.1\|WP_000997708.1\|2510082_2510520_-\|YndM-family-protein	unknown	unknown	gnl\|CDD\|371204
NZ_CP018931.1\|WP_075395915.1\|2510670_2514183_+\|DUF4020-domain-containing-protein	unknown	unknown	gnl\|CDD\|238697
NZ_CP018931.1\|WP_001228117.1\|2518658_2519759_+\|prephenate-dehydrogenase	unknown	unknown	gnl\|CDD\|235824
NZ_CP018931.1\|WP_001273582.1\|2515014_2516091_+\|3-deoxy-7-phosphoheptulonate-synthase	unknown	unknown	gnl\|CDD\|183614
NZ_CP018931.1\|WP_000808762.1\|2530443_2532417_+\|LTA-synthase-family-protein	unknown	unknown	gnl\|CDD\|224287
NZ_CP018931.1\|WP_000633862.1\|2528301_2529927_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|237894
NZ_CP018931.1\|WP_000664621.1\|2519775_2521065_+\|3-phosphoshikimate-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|235037
NZ_CP018931.1\|WP_000646309.1\|2536447_2537149_+\|nucleotidyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|143393
NZ_CP018931.1\|WP_075395912.1\|2527075_2527924_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|180682
NZ_CP018931.1\|WP_001107293.1\|2522801_2523368_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|292911
NZ_CP018931.1\|WP_000709765.1\|2509382_2509913_+\|cysteine-hydrolase	unknown	unknown	gnl\|CDD\|238496
NZ_CP018931.1\|WP_001197261.1\|2517565_2518666_+\|histidinol-phosphate-transaminase	unknown	unknown	gnl\|CDD\|134568
NZ_CP018931.1\|WP_131369292.1\|2521354_2522512_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|226925
NZ_CP018931.1\|WP_000637710.1\|2533258_2533921_-\|DUF3841-domain-containing-protein	unknown	unknown	gnl\|CDD\|378997
NZ_CP018931.1\|WP_139316684.1\|2523621_2526738_+\|MMPL-family-transporter	unknown	unknown	gnl\|CDD\|225272
NZ_CP018931.1\|WP_071728841.1\|2516374_2517547_+\|chorismate-synthase	unknown	unknown	gnl\|CDD\|171518

Protein	Function_ID	Function_description	E-value
NZ_CP018931.1\|WP_000346934.1\|2532476_2533148_-\|TerC-family-protein	gnl\|CDD\|163429	TIGR03717, R_switched_YjbE, integral membrane protein, YjbE family. Rfam model RF00080 describes a structured RNA element called the yybP-ykoY leader, or SraF, which may precede one or several genes in a genome. Members of this highly hydrophobic protein family commonly are preceded by a yybP-ykoY leader, which may serve as a riboswitch. From the larger group of TerC homologs (pfam03741), this subfamily contains protein YjbE from Bacillus subtilis. A transport function is proposed.	8.67512e-74
NZ_CP018931.1\|WP_000923439.1\|2535747_2536431_+\|DNA-alkylation-repair-protein	gnl\|CDD\|132880	cd06561, AlkD_like, A new structural DNA glycosylase. This domain represents a new and uncharacterized structural superfamily of DNA glycosylases that form an alpha-alpha superhelix fold that are not belong to the identified five structural DNA glycosylase superfamilies (UDG, AAG/MNPG, MutM/Fpg and helix-hairpin-helix). DNA glycosylases removing alkylated base residues have been identified in all organisms investigated and may be universally present in nature. DNA glycosylases catalyze the first step in Base Excision Repair (BER) pathway by cleaving damaged DNA bases within double strand DNA to produce an abasic site. The resulting abasic site is further processed by AP endonuclease, phosphodiesterase, DNA polymerases, and DNA ligase functions to restore the DNA to an undamaged state. All glycosylase examined to date utilize a similar strategy for binding DNA and base flipping despite their structural diversity.	1.52684e-27
NZ_CP018931.1\|WP_000551420.1\|2534076_2534904_-\|polysaccharide-deacetylase	gnl\|CDD\|200569	cd10944, CE4_SmPgdA_like, Catalytic NodB homology domain of Streptococcus mutans polysaccharide deacetylase PgdA, Bacillus subtilis YheN, and similar proteins. This family is represented by a putative polysaccharide deacetylase PgdA from the oral pathogen Streptococcus mutans (SmPgdA) and Bacillus subtilis YheN (BsYheN), which are members of the carbohydrate esterase 4 (CE4) superfamily. SmPgdA is an extracellular metal-dependent polysaccharide deacetylase with a typical CE4 fold, with metal bound to a His-His-Asp triad. It possesses de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. SmPgdA plays a role in tuning cell surface properties and in interactions with (salivary) agglutinin, an essential component of the innate immune system, most likely through deacetylation of an as-yet-unidentified polysaccharide. SmPgdA shows significant homology to the catalytic domains of peptidoglycan deacetylases from Streptococcus pneumoniae (SpPgdA) and Listeria monocytogenes (LmPgdA), both of which are involved in the bacterial defense mechanism against human mucosal lysozyme. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. The biological function of BsYheN is still unknown. This family also includes many uncharacterized polysaccharide deacetylases mainly found in bacteria.	2.37912e-85
NZ_CP018931.1\|WP_001106984.1\|2535121_2535382_+\|lipoprotein	gnl\|CDD\|236766	PRK10811, rne, ribonuclease E; Reviewed.	0.000712004
NZ_CP018931.1\|WP_000997708.1\|2510082_2510520_-\|YndM-family-protein	gnl\|CDD\|371204	pfam10710, DUF2512, Protein of unknown function (DUF2512). Proteins in this family are predicted to be integral membrane proteins, and many of them are annotated as being YndM protein. They are all found in Firmicutes. The true function is not known.	3.67802e-44
NZ_CP018931.1\|WP_075395915.1\|2510670_2514183_+\|DUF4020-domain-containing-protein	gnl\|CDD\|238697	cd01406, SIR2-like, Sir2-like: Prokaryotic group of uncharacterized Sir2-like proteins which lack certain key catalytic residues and conserved zinc binding cysteines; and are members of the SIR2 superfamily of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation.	5.74856e-56
NZ_CP018931.1\|WP_001228117.1\|2518658_2519759_+\|prephenate-dehydrogenase	gnl\|CDD\|235824	PRK06545, PRK06545, prephenate dehydrogenase; Validated.	1.81613e-159
NZ_CP018931.1\|WP_001273582.1\|2515014_2516091_+\|3-deoxy-7-phosphoheptulonate-synthase	gnl\|CDD\|183614	PRK12595, PRK12595, bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed.	0
NZ_CP018931.1\|WP_000808762.1\|2530443_2532417_+\|LTA-synthase-family-protein	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	0
NZ_CP018931.1\|WP_000633862.1\|2528301_2529927_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|237894	PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional.	0
NZ_CP018931.1\|WP_000664621.1\|2519775_2521065_+\|3-phosphoshikimate-1-carboxyvinyltransferase	gnl\|CDD\|235037	PRK02427, PRK02427, 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional.	0
NZ_CP018931.1\|WP_000646309.1\|2536447_2537149_+\|nucleotidyltransferase-domain-containing-protein	gnl\|CDD\|143393	cd05403, NT_KNTase_like, Nucleotidyltransferase (NT) domain of Staphylococcus aureus kanamycin nucleotidyltransferase, and similar proteins. S. aureus KNTase is a plasmid encoded enzyme which confers resistance to a wide range of aminoglycoside antibiotics which have a 4'- or 4''-hydroxyl group in the equatorial position, such as kanamycin A. This enzyme transfers a nucleoside monophosphate group from a nucleotide (ATP,GTP, or UTP) to the 4'-hydroxyl group of kanamycin A. This enzyme is a homodimer, having two NT active sites. The nucleotide and antibiotic binding sites of each active site include residues from each monomer. Included in this subgroup is Escherichia coli AadA5 which confers resistance to the antibiotic spectinomycin and is a putative aminoglycoside-3'-adenylyltransferase. It is part of the aadA5 cassette of a class 1 integron. This subgroup also includes Haemophilus influenzae HI0073 which forms a 2:2 heterotetramer with an unrelated protein HI0074. Structurally HI0074 is related to the substrate-binding domain of S. aureus KNTase. The genes encoding HI0073 and HI0074 form an operon. Little is known about the substrate specificity or function of two-component NTs. The characterized members of this subgroup may not be representive of the function of this subgroup. This subgroup belongs to the Pol beta-like NT superfamily. In the majority of enzymes in this superfamily, two carboxylates, Dx[D/E], together with a third more distal carboxylate, co-ordinate two divalent metal cations involved in a two-metal ion mechanism of nucleotide addition. These carboxylate residues are conserved in this subgroup.	2.05551e-10
NZ_CP018931.1\|WP_075395912.1\|2527075_2527924_+\|hypothetical-protein	gnl\|CDD\|180682	PRK06761, PRK06761, hypothetical protein; Provisional.	7.34038e-147
NZ_CP018931.1\|WP_001107293.1\|2522801_2523368_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|292911	pfam16295, TetR_C_10, Tetracycline repressor, C-terminal all-alpha domain.	1.12259e-71
NZ_CP018931.1\|WP_000709765.1\|2509382_2509913_+\|cysteine-hydrolase	gnl\|CDD\|238496	cd01014, nicotinamidase_related, Nicotinamidase_ related amidohydrolases. Cysteine hydrolases of unknown function that share the catalytic triad with other amidohydrolases, like nicotinamidase, which converts nicotinamide to nicotinic acid and ammonia.	1.19855e-68
NZ_CP018931.1\|WP_001197261.1\|2517565_2518666_+\|histidinol-phosphate-transaminase	gnl\|CDD\|134568	PRK01533, PRK01533, histidinol-phosphate aminotransferase; Validated.	0
NZ_CP018931.1\|WP_131369292.1\|2521354_2522512_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|226925	COG4552, Eis, Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only].	1.09336e-71
NZ_CP018931.1\|WP_000637710.1\|2533258_2533921_-\|DUF3841-domain-containing-protein	gnl\|CDD\|378997	pfam12952, DUF3841, Domain of unknown function (DUF3841). This presumed domain is around 190 amino acids in length. As yet no function has been given to any member of the family.	2.53199e-30
NZ_CP018931.1\|WP_139316684.1\|2523621_2526738_+\|MMPL-family-transporter	gnl\|CDD\|225272	COG2409, COG2409, Predicted drug exporters of the RND superfamily [General function prediction only].	8.11188e-77
NZ_CP018931.1\|WP_071728841.1\|2516374_2517547_+\|chorismate-synthase	gnl\|CDD\|171518	PRK12463, PRK12463, chorismate synthase; Reviewed.	0

>NZ_CP018931.1|WP_001107293.1|2522801_2523368_+|TetR-family-transcriptional-regulator
MAKNKQEDIFDAAIQLFAERGYDGTTIPMIAEKAKVGAGTIYRYFENKEALVNSLFTKSVLQLSELIKTDFPVNANIREQFSHTYNRLFEFARQNADAFLFTNSHCDSYFLDEHSNEIFEDFMGFFMDLIEDGIEKGFLRPLPPIALIIIVYQPIEKLIKVMETGQLEYTEELVKELEESCWNAIRII
>NZ_CP018931.1|WP_131369292.1|2521354_2522512_+|GNAT-family-N-acetyltransferase
MNVIRLKEDKFREALRLSEYAFQYKVDEDRLQQQITKMKESHEVYGIMEGENLAAKLHLIPFHIYIGKEKFKMGGVAGVATYPEYRRSGYVKELLQHSLQTMKKDGYTVSMLHPFAVSFYRKYGWELCANLLVCHMTKSDLVMKKQVNGTVKRFNKESHPEEVEKLYETFAERFSGMLVRNEKWWLQAVYDDLTLAIYYDENQTAAGYMLYKIENYKMTVEEFVPLHNEARNGLWNFICQHDSMIKDLEMTVSENEPLLYTLQEPRVKTEIKPYFMGRIVDVEQFLKQYELNWNNVQQEVILHITDSFAQWNNITVRIANHEITIIEEPIDKGIKLDINALSTILFGYRRPLELNELELISGSEEEIRAFENVVPVRKPFIYDFF
>NZ_CP018931.1|WP_000664621.1|2519775_2521065_+|3-phosphoshikimate-1-carboxyvinyltransferase
MKERTIQPVNNGLNGNITIPGDKSISHRAVMFGAIAEGTTTIKGFLPGADCLSTISCFKEMGVDIVQNGDEVTVVGKGLEGLQEPKAVLDVGNSGTTIRLMSGILANTPFFSCVQGDASIAKRPMKRVTNPLKQMGANIDGREEGTFTPLTIRGGDLKAIEYTSPVASAQVKSAILLAGLRAEGVTAVTEPHISRDHTERMLEAFGVKVTREGKTVKLAGGQKLTATDVQVPGDVSSAAFFLVAGAIIPNSKLVLENVGMNPTRTGIIDVLEKMGATFTVEPINEGASEPAANITIETSSLKGIEIGGDIIPRLIDEIPVIALAATQAEGITVIKDAHELKVKETNRIDTVVAELTKLGARIEATDDGMIIYGKSALKGNTVNSYGDHRIGMMLAIAGCIAEGKTIIEDAEAVGVSYPTFFEELQKLAK
>NZ_CP018931.1|WP_001228117.1|2518658_2519759_+|prephenate-dehydrogenase
MRKKVVLIGTGLIGGSLALAIKKDHDVTITGYDIFQEQVERAKELHVVDEIAVDLQHACEEAHLIVFASPVEETKKLLHKLASFHLREDVIVTDVGSTKASIMNEAEALFSKEISFIGGHPMAGSHKTGVESAKAHLFENAFYILTPMHHVPNEHVEELKDWLKGTGSHFLVLNTEEHDYVTGIVSHFPHLIAAGLVKQVEKHAGDNPLIHQLAAGGFKDITRIASSSPKMWSDIVKQNREHLMVLLKEWISEMEDLYDTVSSGDAGEIQNYFADAKEYRDSLPVRKRGAIPAYHDLYVDVLDKVGALAHITSILAREEISITNLQILEAREGLLGVLRISFQREEDRMKAKLALGEEKYQTYETI
>NZ_CP018931.1|WP_001197261.1|2517565_2518666_+|histidinol-phosphate-transaminase
MQVKDQLSSLQPYKPGKSPEQMKEVYGDHSFVKLASNENPFGCSPRVLDELQKSWVDHALYPDGGATTLRQTIANKLHVQMEQVLCGSGLDEVIQMISRAVLKAGDNIVTAGATFPQYRHHAIIEGCEVKEVALNNGVYDLDEISSVVDNDTKIVWICNPNNPTGTYVNDRKLTQFIEDISENTLIVIDEAYYEYVTAKDFPETLPLLEKHKNILVLRTFSKAYGLASFRVGYAVGHEELIEKLNVVRLPFNVSSLAQKAATIAFGDDEFIEEIVRVNTEGLRQYESFCKENEIPFYQSQTNFIFLPVENGGEIYEACAHAGFIIRPFPNGVRITVGTREQNEGVISVLQQHFENKKRKSRDEANA
>NZ_CP018931.1|WP_071728841.1|2516374_2517547_+|chorismate-synthase
MRYITAGESHGPQLTVILEGVPAGLTLTAEHINKELLRRQKGHGRGRRMQIETDTVEIVSGVRHGMTLGSPITLIVKNDDFKHWTKVMGAEPISEKESKEMKRTITKPRPGHADLNGAIKYGHRDIRNVLERSSARETTVRVAAGAVAKQILKELGVEIAGHVLEIGGVKAKHISNLSIEEIQTITENSPVRCLDKTVEQEMMDAIDNAKSSGDSIGGIVEVIAEGMPIGVGSYVHYDRKLDAKLAGAIMSINAFKGAEIGVGFEAARQPGSKVHDEILWDEEQGYTRKTNNAGGLEGGMTTGMPIVVRGVMKPIPTLYKPLASVDIDTKEAFQASIERSDSCAVPAAGVVAESVVAWELAHALVEQFGKDRMELIQQNITQHNKYAKEF
>NZ_CP018931.1|WP_001273582.1|2515014_2516091_+|3-deoxy-7-phosphoheptulonate-synthase
MANHELDQLRKQVDEINLQLLHLLNKRGEIVQKIGEQKQVQGTKRFDPVREREVLDMIAENNEGPFETSTVQHIFKTIFKASLELQEDDNRKALLVSRKKKQENTIVDVKGELIGNGTQTFIMGPCAVESLEQVRQVGQAMKDQGLKLMRGGAFKPRTSPYDFQGLGVEGLQILRQVADEFDLAIISEILNPNDVEMALDYVDVIQVGARNMQNFDLLRAVGKVNKPVLLKRGLAATIDEFINAAEYIIAQGNDQIILCERGIRTYERATRNTLDISAVPILKKETHLPVVVDVTHSTGRRDLLLPTAKAALAIGADAVMAEVHPDPAVALSDSAQQMDIPEFHRFMEELKGFKNKLS
>NZ_CP018931.1|WP_075395915.1|2510670_2514183_+|DUF4020-domain-containing-protein
MTFLGKGESSVWITSEVEIPDELIDHLEKGKLVLFVGAGVSMKGKSNLPNFDDLVDEIAKTLYVEKREITEPHDYYLGKIAKTKDVHQVARDLVHIEKSKPNPLHYAIPRLFPLDTEVRIVTTNFDRHFTTAMKEMNRELNVYYAPALPTGRAFKGLAYIHGNIEQEKEALILTDGDFGRAYLTEGWARRFLVDLFSNYTVLFVGYSHNDPVMKYLATGLPPSTRRYAFVAQGENTYHWEHLGIRPIVYPNKGNNHQSLVKAVKRWAELMGDNYITKRMRIRDIVTVPPSVEQEQLSYIKQSIKKIETVRYFVEFAHDYEWVEWLEAEGKLQNLFLITSNYNEVDELLAKWLVEQFLFSHQKELFQLIFKNHSKLSPLLWRTICSYLNETKMKMDPLLFARWTLLLLETAEKDSKSIETMSYLLQKCSFPEHKEIALLLLTFILDGKLKLKRERKWGNDTGESIELEESSRLPVSTFSFVEQIWNEKMKPHISYYAVPIMMMGIEKMRMLSLRQAALKKKDKENGEKEFQQNDLAFLIQIVKECLAYLCENNEKKANYYITEMIEANSVLQNRIAIDAMNKNVFVSADEKMKWLLQEGILLDVTYKHEVFQLIKNHFALSLEKTKEEVIKIVLKDLAEGRAFDVCFVLDLLFTCDSNSPSTAKAYELMKQKHPHFHSERYSVQKKEAAEQSITCNVTADGLLQLKDDEIMKQVQQFSQDGVFEQRHFLEMLSKACKLNTEWSISFAYQLVGMHEISNEVWFVCIREWRNNRGLTNEQIQKVIPLLQKFVRNTAFHWLISSFLYEISNRLEELEENSIRNVKRFAFSVFPQVMKSDTDFKLAKQDFYNESIQHPVGKMTAVLLKLLSYDHLYDRNVYEYLFLFEEQVRISTERTNFMIARLVADITFLYHIEKQWCRKYLLPYLELKKENEITKYAWAGLCYTQINLPLFTEMKRFIKYAVEHLEVLHPHTREAFLKWLSFVFIKCVLYWEQKTDWLYPLLIRENEENKIKFMQFLCYYVKTLSAKEQQKFWAAWLSIFLRERPKMGGITAREYVMLLRIILFMDEIVERGLLIICKSFSDVGGKGNQTELKQLFHEILEKTESIKMYKELYANVFFTLLQTLQEANLLKTEIIQIKELLIGYRVEKCVINAIDNEIIRIGIVLENLQEEM
>NZ_CP018931.1|WP_000997708.1|2510082_2510520_-|YndM-family-protein
MNDFTVVLIKFISCIIAFSIGLALFFPATFVQIISFSLFVTIVSYMFVDKIILNRIGNTGAIMSDFLLTYLSVWIFGNILLDNYMQIAWGSILSAIVFTLSEVIVHRFSSSRTRHHNDNIHINRRFAYGTEFAEEQNILDKDKKK
>NZ_CP018931.1|WP_000709765.1|2509382_2509913_+|cysteine-hydrolase
MKKALLVIDVQAGMYTAGMPVHNGEKFLETLQELIGECRSNDIPVIYVQHNGPKDHPLEKGTDGWKIHAAIAPLEGECVVEKTTPDSFHKTNLKEVLQDKGIDHVIISGMQTQYCVDTTTRRACSEGYKITLVSDAHSTFDTEVLRAEDIVKHHNVVFGAFADVVTLKDLKVTASK
>NZ_CP018931.1|WP_139316684.1|2523621_2526738_+|MMPL-family-transporter
MSKLKNWRSLSFLLWIVITITMIVTMPNMDKLVKEKGHITIPNTEQSSIADKMIKEMNKDGTEKYDIIAVFNSGSKTALTTEQKEEITKTINALQNEKEQLGIKEVVSHLDNKELEKQLVSKDNTTILTQISIDKKHGEISKVSNNLHNKVKTKGVKTYLTGSDLIAGDFLTSSQEGVKKTEVISIIFILVILIIVFRSPIVPIVSLLTVGVSYLVSMGIIAHLVDQFNFPFSNFTQVFVVVVLFGVGTDYNILLFTRFKEELSKQENAFLATKETFKSAGKTVLYSGIAVLIGFASLALASFKLYQSTSAVAIGVAVLLLVLTTLNPFFMVLLGKGMFYPVKTFKGHEDSRLWGFFAKNSVARPFVALIIVFVISIPFVLKYSNTLNYNDLFEVDNKYESKMGINVIEEHFPPGFSSPSTLVIQSNNKLDEASSLQTLDELTEKILKVKGVSEVYAPTRPTGERIKELYINKQAGELNTGLGDANGGIKEINDGLTTAKDKMGSKDSNSLANVQKLIDGTNEAKNGVSALGTALNQLSNGINDGAKGAQQIESGLTSVNENISVLSNATSQLHAGYTQLEKGLSSYDQYFGSISQAIDGAKKGYEQIEMLMTNFIQTKPELANDPNILQTIGIAKEAQKQLGGLSNELNQLATQHNAAMGSFKEANQSLLKVDNGLKEMSNGVTKLQKGAADLKNGLNEGASGSKQIANKSSELQTGLTKINDGQGQVLTGLKDLQEQMGQLQSGLSKSTEGLEKVSNGLGDAQKYLGELNESKSSEKFYIPKEVLEGEDFQKALNTYMSHDRKTAKMTIILDVNPYSKEAMPIIQEINKTIDGTLKGTELNNAKKAIGGTTARNVDLKEVTGQDFLRTATIMLIGIAIVLIVITRSLLNTMFIIGSLILAYFASLGISEQISTHLLNVDSLSWNVPFFSFIMIVALGVDYSIFVMMRYNELEGDPATKIVTASRHIGGVVLSAALILGGTFAALIPSGVLTLIQVASVVGVALFLLAIIVMPILLPALIGLTSKMKDYAKKLSVRK
>NZ_CP018931.1|WP_075395912.1|2527075_2527924_+|hypothetical-protein
MNTKLIIVEGLPGFGKSTTAQLINEILSQNKIEVELFLEGNLNHPADYDGVSCFNKFEFDRLVSNSGDFKEVLLKRVLKKGSNYLLPYRKIKNEFGDQFSDELFNDISRNDIYELSFDKNVELIAGKWQNFAEIALEDNKVYIFECCFIQNPLTIGMIKYGEQKEKIINYVMKVAKIIENLNPMLFYVEQDNLEFSFRKALKERNPEWATGIVDYYTNQGYGKEHNHSGVEGAIKVLEARRNLELEIFDMLKMKKEKINNTKYEIDSYRSMLKDKLTIQMMK
>NZ_CP018931.1|WP_000633862.1|2528301_2529927_+|ATP-binding-cassette-domain-containing-protein
MITVSNVSLRFADRKLFEDVNIKFTPGNCYGLIGANGAGKSTFLKILSGEIEPSTGDIHITPGERLAVLKQNHFEYEEFPVLETVIMGHTQLYKVMQEKNAIYMKEDFSDEDGMRAAELEGEFAELNGWEAESEAAILLKGLGIGEDLHDKKLSELTGAEKVKVLLAQALFGKPDILLLDEPTNHLDLKAIQWLENFLMNFENTVIVVSHDRHFLNKVCTHMADLDFGKIQLYVGNYDFWYESSQLALKLTQDANKKKEEKVKELQNFIARFSSNASKAKQATSRKKLLDKITLDDIRPSSRRYPFVGFTPEREVGNDLLTVEGLSKTIDGEKVLDNVYFTLNKGDKVAFIGRNDIAMTTLFKILMGEMEPDSGSFKWGVTTSQSYFPRDNSKYFENSDLNLVEWLRQFSPQDESESFLRGFLGRMLFSGEEVKKNVSVLSGGEKVRCMLSKMMLSGANVITLDDPTNHLDLESITALNNGLIAFKGTMLFTSHDHQFVQTIANRIIEVTPNGVIDKEATYDEFLENEELQKQVDAMYKGQ
>NZ_CP018931.1|WP_000808762.1|2530443_2532417_+|LTA-synthase-family-protein
MKQFLLKSKSVLSNHFGFFLFAVILFWLKTYAAYVTEFNLGISNTIQKFLLFFNPLSSAVLFLGLALFAKGKRSYIWLIVINLLLSILLYANVVYYRFFSDFITFPTLTQTNNFGDLGGSIVALLHLYDPLYFLDTIILIVLVATKFANPKPIRVAKYKVSLVFVAGILLFSVNLGLAESDRPELLTRTFDRNYIVKYLGAYNYTIYDGIQSAKASTERALADGDNMTEVRNYLTSTYASPNPEYFGKGKGMNVIYIHLESFQNFLIDYKLNGQEVTPFLNSFTKDANTLYFDNFFHQTGQGKTSDAEFMLENSMFGLPQGSVFTTKSHNTYQSAPAILGQQGYTSAVFHGNYKTFWNRDDIYKSFGFNKFFDASYYDMNEKDVVNYGLKDKPFFNESIPLLETLKQPFYTKFITLSNHFPYPIDKEEATIEPANTGDSSVDTYFQTARYLDESVKGFIDYLKQSGLYDNSIIVMYGDHYGISDNHNAAMSKVMGKEINSFENAQLQRVPLIVRVPGVKGGVQHQYGGEIDVLPTLLHLLGTDTKNYVQFGSDLLSPDHKQVVAFRNGNFVSPTVTALNGKYYDTTTGKPVEFTDEIKQNEQMVQNSLKYSDQVVNGDLLRFYTPEGFTPIDRSKYNYNNRDKNKTKVKTAPEGEAK
>NZ_CP018931.1|WP_000346934.1|2532476_2533148_-|TerC-family-protein
MDFLSAEYLSALLAIIVIDLVLAGDNAIVIGLAARRLPKDQQKKVIIWGTIGAIAIRALATLVVVWLLKIPGLLLIGGVLLIWIAYKLIAEGKDHDIKAEEGFWSAIKTIIIADALMGIDNVLAVAGAAHGNFSLVIIGLLVSIPVVVWGSTLILKWVDRYPIIITIGAAVLAYTAAKMIVDEKWFAAFFESNPFIKWAFIIIIIAGVVFFGKAKQKATDGSI
>NZ_CP018931.1|WP_000637710.1|2533258_2533921_-|DUF3841-domain-containing-protein
MIVYTVQTEEAWKQFKKLGYLEGNKEFIDSDDIYSYDWMVRVAKTKLPHYEGNYPIWVWEANNYPNRNHKAWGRKNSKMVILTLDVPKEWVLWSDISYWCCAMGDSSMYFHQADKPALEEWYTYMDKEYGIIFDFVYLLSHPDWYLDKEDSLEKQGVIGKIPLSFVKKVRRFRAKEDTSIHTIRSDNWDNRKENRIKKMNRKLRKRNEKQKRVQKRLIRN
>NZ_CP018931.1|WP_000551420.1|2534076_2534904_-|polysaccharide-deacetylase
MHNGIRMTTLMKRAMLICAGVLFTYEAALGSAHTALASTEDEAKSVQLVSEIQSSLAPKEAPKQYNGQVRKVAYLTFDDGPGKYTAELLDMLKKENAKATFFLIGSNVKAFPDLVKREDAEGHYVGMHSMTHNYKKLYTEGHYVDEMKEDQGLIAGVLGKSPVLTRPSYGSMPGLNEALRNKVVENGLKVWDWTIDSLDWTYNKMPVDAASAKIVQNVINGANKPTEVILMHDIHPQSVKAVPGIIKGLKEKGYELEAYSENEHFPLNFWHDNRM
>NZ_CP018931.1|WP_001106984.1|2535121_2535382_+|lipoprotein
MNYKKMLSIFMTSIFTVGLLIGCNPAPKDEKEPDPTEEPSEQRQEEKNEKQDPAKEQNNELNKKDEQEPDPTEEPSEEQKKKKENE
>NZ_CP018931.1|WP_000923439.1|2535747_2536431_+|DNA-alkylation-repair-protein
MLLEEVMQQLEEYGTEQNRKTYKNHGAKEPLFGVSFANLKLLKKKIKKDHDLAISLWETKNMDAMTLATMILDPKKVTTELLNKWVQEVDYYCLMDVLMTAICTSPIAIERMEEWTKSDDEWIGRAGWSLLANIAIKNKTLQDDFFSPYLEEIKENIHNEKNRKREAMNSALIAIGIRNEDLEQTAIEIAREIGKVQVDHGATSCKTPDAESYIKKARERAEKKKMK
>NZ_CP018931.1|WP_000646309.1|2536447_2537149_+|nucleotidyltransferase-domain-containing-protein
MKAMEAAQSIITSHFPDCDVALLGGSVARGEATKTSDLDIVIVDQSLTSCYRESFYSNGWPVEVFVHNFETYKTFFKMDCDRGRPSLPQLVSEGIVLKGENEIVEKLKREASDLLNKGPAKWTEEMMKQKRYFITDTLDDFIGASKREEELFIANLLADLLHEYVLRVNGKWLGNSKWFIRVLRKYDEQYADQFVAAFDHFYTTGEKSKLITFVEKTLEQYGGRMFEGFSIGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP018931_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018931_5

3247831-3248006

Orphan

Consensus_repeat	Method
GGATTTGGTTCTGGATTTGG	CRT

3 spacers

The CRISPR arrays of NZ_CP018931_5

>merge|NZ_CP018931|5|3247831-3248006|CRT
GGCTTTGGTTCTGGATCTGGCTTTGGTTCTGGATCCGGATTTGGTTTGGGATTTGGTTCTGGATTTGGATCTGGGTTCGGATTTGGACCCGGATTTGGATTTGGTTCTGGGTTCGGATTTGGATTTGGCTCCGGGTTCGGATTTGGATTTGGACCCGGATTTGGTTCTGGATTTTT

>NZ_CP018931|5|3|3247831-3248006|CRT
GGCTTTGGTTCTGGATCTGG	CTTTGGTTCTGGATCCGGATTTGGTTTG
GGATTTGGTTCTGGATTTGG	ATCTGGGTTCGGATTTGGACCCGGATTT
GGATTTGGTTCTGGGTTCGG	ATTTGGATTTGGCTCCGGGTTCGGATTTGGATTTGGACCC
GGATTTGGTTCTGGATTTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018931.1\|WP_075666789.1\|3260203_3260686_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018931.1\|WP_075395491.1\|3262621_3265723_-\|isoleucine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235681
NZ_CP018931.1\|WP_155119908.1\|3237430_3237580_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018931.1\|WP_000410096.1\|3243270_3243759_-\|antitoxin-YezG-family-protein	unknown	unknown	gnl\|CDD\|377394
NZ_CP018931.1\|WP_000391132.1\|3255722_3256085_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378057
NZ_CP018931.1\|WP_075395692.1\|3240509_3241745_-\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376773
NZ_CP018931.1\|WP_001172765.1\|3251683_3255691_-\|type-VII-secretion-protein-EssC	unknown	unknown	gnl\|CDD\|274860
NZ_CP018931.1\|WP_075395696.1\|3248524_3251200_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|274350
NZ_CP018931.1\|WP_001050360.1\|3245269_3245707_-\|SseB-family-protein	unknown	unknown	gnl\|CDD\|377787
NZ_CP018931.1\|WP_000966846.1\|3256898_3257663_-\|VWA-domain-containing-protein	unknown	unknown	gnl\|CDD\|238119
NZ_CP018931.1\|WP_001221976.1\|3234999_3236184_-\|glycerate-kinase	unknown	unknown	gnl\|CDD\|376844
NZ_CP018931.1\|WP_000482300.1\|3260789_3262301_-\|peptidase-M36	unknown	unknown	gnl\|CDD\|225768
NZ_CP018931.1\|WP_075395695.1\|3243764_3245213_-\|WXG100-family-type-VII-secretion-target	unknown	unknown	gnl\|CDD\|372824
NZ_CP018931.1\|WP_000997785.1\|3239618_3240011_-\|immunity-22-family-protein	unknown	unknown	gnl\|CDD\|379476
NZ_CP018931.1\|WP_000570745.1\|3233572_3235003_-\|sodium:solute-symporter	unknown	unknown	gnl\|CDD\|273267
NZ_CP018931.1\|WP_075666790.1\|3257863_3259162_-\|aspartate--tRNA(Asn)-ligase	unknown	unknown	gnl\|CDD\|235354
NZ_CP018931.1\|WP_000807831.1\|3251283_3251556_-\|WXG100-family-type-VII-secretion-target	unknown	unknown	gnl\|CDD\|274862
NZ_CP018931.1\|WP_075395693.1\|3241901_3242687_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|214861
NZ_CP018931.1\|WP_075666792.1\|3236830_3237286_-\|DUF4274-domain-containing-protein	unknown	unknown	gnl\|CDD\|372909
NZ_CP018931.1\|WP_000241763.1\|3256113_3256887_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP018931.1\|WP_000482300.1\|3260789_3262301_-\|peptidase-M36	gnl\|CDD\|225768	COG3227, LasB, Zinc metalloprotease (elastase) [Amino acid transport and metabolism].	6.08856e-27
NZ_CP018931.1\|WP_001172765.1\|3251683_3255691_-\|type-VII-secretion-protein-EssC	gnl\|CDD\|274860	TIGR03928, T7_EssCb_Firm, type VII secretion protein EssC, C-terminal domain. This model describes the C-terminal domain, or longer subunit, of the Firmicutes type VII secretion protein EssC. This protein (homologous to EccC in Actinobacteria) and the WXG100 target proteins are the only homologous parts of type VII secretion between Firmicutes and Actinobacteria. [Protein fate, Protein and peptide secretion and trafficking].	0
NZ_CP018931.1\|WP_000410096.1\|3243270_3243759_-\|antitoxin-YezG-family-protein	gnl\|CDD\|377394	pfam04634, DUF600, Protein of unknown function, DUF600. This conserved region is found in several uncharacterized proteins from Gram positive bacteria.	1.38387e-51
NZ_CP018931.1\|WP_000391132.1\|3255722_3256085_-\|hypothetical-protein	gnl\|CDD\|378057	pfam08817, YukD, WXG100 protein secretion system (Wss), protein YukD. The YukD protein family members participate in the formation of a translocon required for the secretion of WXG100 proteins (pfam06013) in monoderm bacteria, with the WXG100 protein secretion system (Wss). Like the cytoplasmic protein EsaC in Staphylococcus aureus, YukD was hypothesized to play a role of a chaperone. YukD adopts a ubiquitin-like fold. Usually, ubiquitin covalently binds to protein and flags them for protein degradation, however conjugation assays have indicated that the classical YukD lacks the capacity for covalent bond formation with other proteins. In contrast to the situation in firmicutes, YukD-like proteins in actinobacteria are often fused to a transporter involved in the ESAT-6/ESX/Wss secretion pathway. Members of the YukD family are also associated in gene neighborhoods with other enzymatic members of the ubiquitin signaling and degradation pathway such as the E1, E2 and E3 trienzyme complex that catalyze ubiquitin transfer to substrates, and the JAB family metallopeptidases that are involved in its release. This suggests that a subset of the YukD family in bacteria are conjugated and released from proteins as in the eukaryotic ubiquitin-mediated signaling and degradation pathway.	0.00293559
NZ_CP018931.1\|WP_075395692.1\|3240509_3241745_-\|IS110-family-transposase	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	6.68341e-23
NZ_CP018931.1\|WP_075395696.1\|3248524_3251200_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|274350	TIGR02917, TPR_domain_protein, putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.	9.48904e-14
NZ_CP018931.1\|WP_001050360.1\|3245269_3245707_-\|SseB-family-protein	gnl\|CDD\|377787	pfam07179, SseB, SseB protein N-terminal domain. This family consists of several SseB proteins which appear to be found exclusively in Enterobacteria. SseB is known to enhance serine-sensitivity in Escherichia coli and is part of the Salmonella pathogenicity island 2 (SPI-2) translocon. This entry contains the presumed N-terminal domain of SseB.	2.03204e-12
NZ_CP018931.1\|WP_001221976.1\|3234999_3236184_-\|glycerate-kinase	gnl\|CDD\|376844	pfam02595, Gly_kinase, Glycerate kinase family. This is family of Glycerate kinases.	0
NZ_CP018931.1\|WP_075395491.1\|3262621_3265723_-\|isoleucine--tRNA-ligase	gnl\|CDD\|235681	PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewed.	0
NZ_CP018931.1\|WP_075395695.1\|3243764_3245213_-\|WXG100-family-type-VII-secretion-target	gnl\|CDD\|372824	pfam13930, Endonuclea_NS_2, DNA/RNA non-specific endonuclease.	6.44702e-41
NZ_CP018931.1\|WP_000997785.1\|3239618_3240011_-\|immunity-22-family-protein	gnl\|CDD\|379476	pfam14112, DUF4284, Immunity protein 22. A predicted immunity protein with an alpha+beta fold and conserved tryptophan,tyrosine and an acidic residues. Proteins containing this domain are present in bacterial polymorphic toxin systems as an immediate gene neighbor of the toxin gene, which usually contains toxin domains of the ColD/E5, Tox-REase-4, Ntox49 or Ntox14 families. The domain is also found in heterogeneous polyimmunity loci.	1.1455e-24
NZ_CP018931.1\|WP_000570745.1\|3233572_3235003_-\|sodium:solute-symporter	gnl\|CDD\|273267	TIGR00785, Uncharacterized_transporter_HI_0020, anion transporter. The Divalent Anion:Na+ Symporter (DASS) Family (TC 2.A.47) Functionally characterized proteins of the DASS family transport (1) organic di- and tricarboxylates of the Krebs Cycle as well as dicarboxylate amino acid, (2) inorganic sulfate and (3) phosphate. The animal NaDC-1 cotransport 3 Na+ with each dicarboxylate. Protonated tricarboxylates are also cotransported with 3Na+. [Transport and binding proteins, Anions, Transport and binding proteins, Cations and iron carrying compounds].	5.00208e-35
NZ_CP018931.1\|WP_075666790.1\|3257863_3259162_-\|aspartate--tRNA(Asn)-ligase	gnl\|CDD\|235354	PRK05159, aspC, aspartyl-tRNA synthetase; Provisional.	0
NZ_CP018931.1\|WP_000807831.1\|3251283_3251556_-\|WXG100-family-type-VII-secretion-target	gnl\|CDD\|274862	TIGR03930, WXG100_ESAT6, WXG100 family type VII secretion target. Members of this protein family include secretion targets for the two main variants of type VII secretion systems (T7SS), one found in the Actinobacteria, one found in the Firmicutes. This model was derived through iteration from pfam06013. The best characterized member of this family is ESAT-6 from Mycobacterium tuberculosis. Members of this family usually are ~100 amino acids in length but occasionally have a long C-terminal extension.	1.52885e-22
NZ_CP018931.1\|WP_075395693.1\|3241901_3242687_-\|recombinase-family-protein	gnl\|CDD\|214861	smart00857, Resolvase, Resolvase, N terminal domain. The N-terminal domain of the resolvase family contains the active site and the dimer interface. The extended arm at the C-terminus of this domain connects to the C-terminal helix-turn-helix domain of resolvase.	1.80239e-29
NZ_CP018931.1\|WP_075666792.1\|3236830_3237286_-\|DUF4274-domain-containing-protein	gnl\|CDD\|372909	pfam14096, DUF4274, Domain of unknown function (DUF4274). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, and is approximately 80 amino acids in length.	1.41892e-23
NZ_CP018931.1\|WP_000966846.1\|3256898_3257663_-\|VWA-domain-containing-protein	gnl\|CDD\|238119	cd00198, vWFA, Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A domains.	5.3007e-10

>NZ_CP018931.1|WP_001050360.1|3245269_3245707_-|SseB-family-protein
MNLLEICPLDEALVEALQNEEKRVRFYEILQKSNLYVVASVEGDTTVDEEGNLISTENTQLQIHYFEMEEGLMLPLYSDLKHLEMVIPEECPYVSMNAVELLKTIDLEANVILNPGTKFQKLFVKEEIEAICDNSIFDVFSKGDK
>NZ_CP018931.1|WP_075395695.1|3243764_3245213_-|WXG100-family-type-VII-secretion-target
MEIKVKPEQLEQIAKNISEMQTHSQNIQQNLNQSMFSIQMQWQGATSQHFYGEYMRSMRLMESYIRNLQVTEKELRRIAQKFRQADEEYQKKQNEKLKEAHKKEKKNEKSWWEKGIEGAAEFIGVNDAIRAVTGKDPITGKELSTKERLIAAGWTLLNFVPVGKVASLAGKGIKYVASSFGKTIVKAGKKLGEGVTMVAGKAGKAAVDGIKTASHKVKEGVNFVASTAKGFADKIGSLWNKGATTVKTTFLQGNEKIQHAVKTLLEYKWIPGEGKGFAIAGVGNVSGGGQYSLKEAYQYMESKVVKGTGNTPKITEIKEGDLGKQIIKGKNGRKELAPNVRYITEDGYKYTTDELGRIVDVEAEELILQKGKRNTGMQVAAGRENRLPDDDGGHLIGTQFHGSGDIDNLVAQNKQINRSGGEWYNMEKEWANALSEIPPKKVSVKIEPVYQGTSLRPNYFEIVYEIEGKGIFEKTIRNRAGG
>NZ_CP018931.1|WP_000410096.1|3243270_3243759_-|antitoxin-YezG-family-protein
MEKEMNKLYREIAETVNEMIPEEWEKFYFYAQISETGGGTYFFYNTPENRQCFNYSVKIPFNYAIDKEEFKKNKRKLFELSDELRNVFKDNEQELWYSFTMSLESSGKFKMHYDYTNWFDTEYSFSDQMIIWKNKYLGEVPNDENYKTLIDKYHSEFPNNPI
>NZ_CP018931.1|WP_075395693.1|3241901_3242687_-|recombinase-family-protein
MGEKVVGYVRVSTEGQVRDGYSLAYQVEEIKRYCMENNLQLLHVYEDRGLSGATVNENGLTVEREGLQELLSDMAYHQVSKVIVLNTSRLWRSDMAKVLIQRELKKHEVDVKAIEQPNYSIYAHEPNDFLVNGMLELLDQYQRLELALKLSRGRKKKAEQGGYAGGGVMFGYRVKKGQKVLEVDAEKAIIVRRLFELRYFFRHWSLAQLAERLNREGYCTAKGKQFTKVQVKRMLDRENFYRGMYKYGKIQTKGQHPAIIL
>NZ_CP018931.1|WP_075395692.1|3240509_3241745_-|IS110-family-transposase
MQNRQNYLYVGVDLHKEHHTAVIINCWQEKLGEIQFENKPSAFSKFLLEVETYVCDGITVVFGLEDVGGYGRALAKYLVDHERVVKEVNPALSFLERKSQVMIQKNDSWDAECVARILVNKFNQLPDAKPNDLFWSIQQLVSRRNALVKAQSALKNQLHIQLNHHYPSYKKFFSELDGKTALAFWQQYPSPSCLEGANIKQLTAFLLDVSNNTCSVKKASDILNLVKEDGHTMKEYQETRDFLVRSIVRDIEFKKTEMKYIERELKQLVKLLDYQLDTMPGIELVTASALIAEIGDVRRFLNANKLARFAGIAPVYFGSGGKGKVHKSKQGNRALHALFYNLAVQQVQVAKGSKTPRNPVFHAYYQKKLKEGKTKGQALVCIMRRLVNIVYGMMKYKTAYELPVVEEKEVV
>NZ_CP018931.1|WP_000997785.1|3239618_3240011_-|immunity-22-family-protein
MNDHVSIWIGNFENEEELMNYTNIEYTEDGDSISSTFEKDFNLDYYDRDLIEKKWISKSTNSVKDLLDGFSYSDQFLEQFDTIRYSEEFNAAILIYNLEYDAQKTKGKFKNSDLKFIGVAQYTITVDDRW
>NZ_CP018931.1|WP_155119908.1|3237430_3237580_-|hypothetical-protein
MYIKLTNSYKLVSFNVVFIMKYKKCHIVTTKLTNLCYLKTYELKALDCL
>NZ_CP018931.1|WP_075666792.1|3236830_3237286_-|DUF4274-domain-containing-protein
MENRDISLLEELLHNTNKEDTISRIKNIDNPIILHCFAANYNWNNGFDIPNAILENKDCDLGTGLLMFHYVDGYRLLESSEEVSNSLLQEWKVFILKLQNKIMNLEFKTQNISFSPELTKIQIFKLKKRNPSISDILINESPGNIIDIPKI
>NZ_CP018931.1|WP_001221976.1|3234999_3236184_-|glycerate-kinase
MRILVVPSGFKESLGAKEAADVMKEGILKVMPLATVETLPMVDGGEGFTEAIINITGGKMYEVQVTGPVGDEIQSYFGVFETRNGERTAVIEMAAAAGLRLVPRDLRDPRKTTTHGVGQLIELALNKGVDRILIGCGDSGTSDGGAGMAEALGVKFLNEDEKEIQIQGGTSLLQVSKIDTSQVDPRLRHVQIDVACNWFNQLCGEHGVARVFGPQKGANEAQVIELEKALERYASIIKKDIGIDVHHTPGSGASGGLGAGLQALIGATLHPRYDIIMKYMDLNKLLLKCDLVFTAEGSIDFQTPRGKIPAEVAKCAKRYGLPVIALVGTVGKGARINYDYGIDAYTSILPMPSSLENAFSNAEKWLRDCTESTMRTVLVGYQIASRLNKSGYVS
>NZ_CP018931.1|WP_000570745.1|3233572_3235003_-|sodium:solute-symporter
MIEKNVVELHVDNNDTPKVKSSWVLPVALILIVEIVLLLPSSLTMEAKWSLFGFCSAIILWTTTTINSAYIALGSVLFLIISGTAKQDLLFDSLASDVIWLMIGSFILGRALQITGLAEKMTYFVVNRARNISGLCWILTMIIQILAFFIPSTSGRAAVVLPVFQAICKEIGSRRIAKALAILMPTVILVSTSSTIIGAGSHLIALDMLNEFNNKNITFVEWLIWGLPFGIIMSFISCRVILVLFLDKEEVKTKLQQKKVKFELSRNEKYTISILIAMVAFWLTEWLHGLEIATVTIIGVFLLTLPKLGVMQWKESLKGVSWNLILFVGAAIALGKSLMESGAAQWIMQNLFLVTELINKQSIFIVLLVIVILSVTSHLYITSHTTRAVIFIPPLLYFASSLQLNEVAVLFLGIVGMNYCLTFPVSSKALLLFQESDRETFQPQDLLKLSSYLSVIYIFVMVIFYYAYWQWVGLSL
>NZ_CP018931.1|WP_075395696.1|3248524_3251200_-|tetratricopeptide-repeat-protein
MGFRPEVGEKISLNKDVYRFEKHPAVIGIEMPYGQEGRQGTVYQLQHENGMERIALKVFKERYREEKHQLAFLKPLSSIAGLKVCSRYIVTKEEHISAIEKSEDLANSIVMPWVEGPTWADILQEQRMLSKEQCFFIAEAFLTTLKMMEENEVAHNDLSSSNVLIPFLSENPIEGQHYIELVDVEQMYGPKTKRPSLLPAGSAGYAPMYLKSGVWQKEADRFAGAILLGEILSWCSEEVRNKKWTDASYFKTEEMQKECERYTLLQQVLHNQWNGEIAKLFKQAWSSNSFAECPSFAQWYDVFHSVRERIKIDAERQSAEEHSLFVSKCLEIARLLEERGFKQAALYEYKIIFNSLNPSTALQKELAYIIQTMESQEPEINKKMVLQHYLELATELERENNAAFACFVYSRIVQFPNINQALKQEIASIIEEIKEGQGTETQQEVAATITVPNSILQSRKKTKKQVEYDIDDEILNAKASNQPLTVAHEQSEPSAFSTWWKKNKKRILIIGSTVVVVIGGSTLFYFYTTNAKYQKFMEQARQAYDNKKYTKAEEAVGHAIAVKGKDEAYLQLATIYVAEGKNKIAIDYITKLIKDREIDKENNEAAYLLASANFRIGKYQEAVQNFEQALANNAKGIEPYKKDAMRDLAVSHMKMKEFEKAEDVIVKMSTKTNEDKAIVSYLKGQLSTATVQLEKAESFFKEAIMQDSKNPIYTIELSNLYVLWNKTNLIDSAKKEMNYQQASHILQVAIQKDMKNIELLNQLGIVYYEAGQFYETRDGAKSTAAYQQALEAYNRVVSSGTRDINTLVNIGILYDKVGQGNEAEKLFTEAYSQNDENPHVNFAFGMFKIKQKKYEEASRFLRKTVQANENESEVRAAQEKLTEMKTNGWIQ
>NZ_CP018931.1|WP_000807831.1|3251283_3251556_-|WXG100-family-type-VII-secretion-target
MAEIKITPEELERIAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQAKFRGEFIQSKQAMQQYIPILEGISTDLKRIADKFRNTDNAY
>NZ_CP018931.1|WP_001172765.1|3251683_3255691_-|type-VII-secretion-protein-EssC
MQKSPYFQRSPRVKVDIPTGDVIIHDPPNIPEEPKFSIETMLLPAMMTVLTLVLYFVMMKFMKMNSSYMPLMMVSSIPMLGSYVITTMGHFRKKKEHRQMVEQLQTRYLEQIQKHRVELDTLKVEQAKYLITQNPSPLKSVQRIENRESNLWERTPESPDFLDIRIGTGERPFLVELKVPEQKGYEENPLVTEAQNVKRDFNTIPNGHISISLKKNDVIGVVGNKEDRLNFIRIVTTQIMTHHAPNEVKIAAFYHEKEKKQWDWMRWLPHVWDEQRSMRFLSENQQDAQKLAEVLFTPLNMRRIYNSSAQADAKVPLIPMYVFFLSAREFLEDDPLTPMLLREGESVGASTFIFAEQKERLPMECDLVISLNGENGELVETFSSSAENSGTTRASFKVDRLSFERCELGARSIAPIRMKSSTAANIPKVLTFLDLFQAKNMEELQVLERWKENRYPTSLPVPIGVREGSKPVFLNIHDKIEKKGHGPHGLMAGTTGSGKSEVIQSIIAALAATYHPHEMAFMLIDYKGGGMSNTFAGLPHIIASITNLEDPNLIERARISLKAELERRQKLFIQAGNVQHLDEYYETSWREKEPLPHLFIVIDEFAQMKKEQPEFMDELISVAAIGRTLGVHLLLATQKPSGVVNDKIWSNSRFRICLRVQDDADSREMLKIPDASKINVPGRGYLQVGSNEVLELFQSAWSGAPYNPDEEKVLDIVDFTEVKLSGERIKVKKRPKPMTNSPKQLQAFIQYVQSVSEKENIKALPGPWLDPLPEKLLLKEFYAMENWTIADWNKPKEYLQVTVGLIDDVANQAQYPLKLDLQEGHLNIYGMPGTGKTTMLQTIIMSLAVSHTPEEVNFYVIDFGRMFLDFRDLPHIGGIIQEGENEKMKRLFGFLKQEITNRKESFSNIGAKSFSMYNRMVEKKVPAIVVMVDGYMRFKNEFEKENEVLELLLRESSTYGVYFYFSLNQTIDMFDRVRNNIPMALTFELQDGTEYHNLVGRPKFPLIEVPVGRGLMKGQPPELFQAALPFIGESELEYSQQLKTIIQKMNGEWNGEKAKTIPMVPKEIFVEHMVGKLETAQISAGIETEDIRLQSFSLDEMSHIFIGGRIEGGKTSLLQTLLFTTTYQYSPEKVELYLVDLGERPTGILALGDLPHVKKKVTDAIQLKEMLDELLELINNREAVMPTLDPNVTVEFPYKRIIIAIDDIDQMLTVLSTDYEAKNKIELIVQNCKNKGVHFMTAATTSSLNSYSHEKWFAEIRKRSIGYLLGTTQNNDVYFFNMKLPHTEMDQELLSGDGYCIRRKPIKIKCAYTPLHLLRTMIDKISVKWTELKVK
>NZ_CP018931.1|WP_000391132.1|3255722_3256085_-|hypothetical-protein
MEEIIVTYIKQSNEEIDIAIPNDVKAVQIIEAILHHEKIDEALSSTYEIRVAKDKEEWHSIRNDETLRDNDVWDGQYVMLYKKGSIIPSFEMLPAEEVYNEPVKQDISTSEEDYVWKIIE
>NZ_CP018931.1|WP_000241763.1|3256113_3256887_-|hypothetical-protein
MVKYILSQKKETVLQEKKTKHFTYQYSYVRAKETQDLNESGQDFLAFQDNGTSFIFVLCDGVGLSFHGEIAAEFLGMKLLNLFETYQESGRDIAALLNDQLENWIEEASEEVSAFRLPEKTPWLLRDVLEEKRKQGSEAMFIGGKIELIPNQDKAHIAIVTHGDSFVQLFQDKENCSNVMKFERNIEKRWSTQRGIIGGELAVFSKTLSRQEANRIVIHSDGLAPLKQYNFEEVLKEIERAQNSPTSDDISFLDVSW
>NZ_CP018931.1|WP_000966846.1|3256898_3257663_-|VWA-domain-containing-protein
MLYQTQATQQTPAYIIYLLDVSASMNQMMDAGGEEKRRIDIVTDALSLAIRQMVFRSTKGSRLLPRYKLSILAYSDHVFDLLGGVKTIDEVARLRPLEKIQTHRLTDTAKAFSVVEKLLQKELPNLQDGPAPVVCHMTDGASTGEDPELIVRRIMNMSVPDGNVLIENIFISDEIMQEQITNIKKWEGIMPNTEITDEYGAKLQRLSSPIPQSYREMMTEHGFHIADGAVMMFPGTNADLVSLGFQMSAATPVR
>NZ_CP018931.1|WP_075666790.1|3257863_3259162_-|aspartate--tRNA(Asn)-ligase
MGQIMKRSLTKECTEKSGKVVSLQGWVKKIRHLGNVSFLLLRDRTGVIQCVLENEFAGFKVDVESIVHVIGEIVETSKTELGVEVLAHEVKILNGAEPLPFEINKKKLQVGLGQLLNERVLSLRHERTTAIFKVKSTLVQSFSELLIENDFTRIFTPKIVSQGAEGGANVFKLPYFQKEAYLAQSPQFYKQMMVAGGLERVFEIAPVYRAEHHNSSRHLNEYISLDVELGFIHDFHEVMQLETDVLRYMFQQVAKNCEKELQLLQIEVPVITEIPKITLLEAQEILKSKYCKESPVGDLDTEGEKLLGEYVKETYKSEFVFITHYPKEARPMYTMPNNENSAITDSFDLLYKGLEITSGAQRIHNYEMLLASFKEKGLHPDKFQSYLNTFRYGCPPHGGFGIGLERIVYKLLELSNVREASAFPRDCTRLIP
>NZ_CP018931.1|WP_075666789.1|3260203_3260686_+|hypothetical-protein
MKKAISFFLLLLCLIVVNETYAYSPKSLPISQNSDQWQVNIAEPKKANKKKLQAKKDEFQTYQFSVKNVGNSEVYNVHVEVFRNEPKTKTKYELFSLKESRLASGKTGFEHANFPVVTKADEVDVIITWQEHPFRSMRNGQKVESRKFKEHFVFKDKKNK
>NZ_CP018931.1|WP_000482300.1|3260789_3262301_-|peptidase-M36
MFNKKMVAMAMTVPLVMGTLSTVSAVETKKQVKVEAYSPQKKAIEYLKGNANQYGLKPDLSDLQYISTTETSVASYVRFQQVVNGAPVFSNQITVTLNGEGKGVLAVSDYQPIKAVKQVTEKISEKDAIQKSMAYVGEASEQNLWAPTEKEFGYIIEEGIARPVYKVVVHSNNPFGAWETFIDAENGKLIKKVDINRKVEGTGKVFLPNPVVSSGSLAGLKDNNDADSTALTNQLKTVTLKGLDGTGFLIGEYVTISSKARTKSTNLQFNYTRANDSFEDVMSYYHIDTLQRYIQSLGFQNINNRSIKVNVNGTTADNSFYSPTTKALTFGTGGVDDAEDAGIIAHEYGHSIQDNQVPGFGSSAEGGAMGEGFGDFLGATYEDAVSTTGYGKACVGEWDAAAYSSSDPTCLRRLDTNKVYPKDIKNQVHADGEIWSQGQYEMAQAFGRDVATKIILQSHWSLTPNSKFSDGAKAIKQADALLYGGQHAADIDRIWAARGISTN
>NZ_CP018931.1|WP_075395491.1|3262621_3265723_-|isoleucine--tRNA-ligase
MKKVDVKESAVGRETRIRKQWNEQSIFEQSIQNREGAQSFVFYEGPPTANGLPHVGHALGRTIKDVVARYKTMAGYKVLRKAGWDTHGLPVELGVEKQLGISGKHEIEEYGIEPFIKKCKESVFTYEKQWREFTESIGYWVDMDDPYVTLENPYIESVWHILGTIHEKGLLYKGHRVSPYCPSCQTSLSSHEVAQGYKTVKDLSATVKFKVKDSENEYFLGWTTTPWTLPANVALAVHPNMEYVKAKQEGHVYIVAKERVQDVLKENYEVLSVHKGEELLNISYTAPFPMKEVTNGYRVIGADFVTADSGTGLVHIAPAYGEDDYRVVQSEGLSFLHVVDEKGEYTEAVPFLKGKFVKDCDVDIVRYLAKEGLLYHKEKYEHSYPHCWRCDSPLLYYAGESWLIRTTAIKDTFLQNNDSVTWYPDHMKHGRFGKFLENMVDWNISRNRYWGTPLNVWECESCDHQFAPKSIDDLRKHSTKETPEDLELHKPYVDEVQVSCEKCGSAMNRTPEVIDVWFDSGSMPFAQYHYPFENKELFEEQFPADVIAEGIDQTRGWFYSLLAVSALYTGKVPYKRVLSLGHVLDEEGQKMSKSKGNALDPVDLVEKFGADALRWALLVDGAPWNAKRFSERTVLEAKSKFVDTLVNVYSFYVLYANLDEYNPNETYDVKRTKLDEWVLSRLHSTTKKVRTALDDYQFTNAAREIAALVDEVSNWYVRRSRNRFWESGMNAEKAAAYETLHDVLVTISKLIAPFTPFVAEDIHLNLTGSSVHLEDYPVVNESLLQPKLEAEMDAVLQVVELGRSNRNQHSLKVKQPLAELVLLEHNENDMDWESYRDIVMDELNVKAFHVELDETKYTSYQLKLNFKKAGPKFGKNVNAVNGWLKQLSQDEVQNFVSTERAVYEAASGEEVVVTTEDVLVEKVAKSGFSNTTNGQYTVMLDTNVTEELLQEGVAREFIRAVQEYRKQLNLPVNLRVDVILDTEEELQQTLTNHKELLEENLLVKQFTFGHLTNEDDELSLGETKVRIKLSTAQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP018931_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018931_6

4106641-4106896

Orphan

Consensus_repeat	Method
TTCTCATGCGGAAGGTAAACATACA	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP018931_6

>merge|NZ_CP018931|6|4106641-4106896|CRISPRCasFinder
CTCTAATGCAGAGGGTACAGCTTCACATGCAGAAGGGCTTCTTACACATGCAAAAGGTTCTTTCTCTCATGCCGAAGGATCAAAAACGAAAGCAACTGGACATAGTTCCCATAGTGAAGGAAGTGAAACGACAGCAGGTGGCTCTTATTCTCATGCGGAAGGTAAACATACAATCGCTTTAGGCGAAGCAGCACATGCAGAAGGAACCGCGACTATCGCTAACGGATTCTCTTCTCATGCGGAAGGTAATCATACA

>NZ_CP018931|6|3|4106641-4106896|CRISPRCasFinder
CTCTAATGCAGAGGGTACAGCTTCA	CATGCAGAAGGGCTTCTTACACATGCAAAAGGTTCTTT
CTCTCATGCCGAAGGATCAAAAACG	AAAGCAACTGGACATAGTTCCCATAGTGAAGGAAGTGAAACGACAGCAGGTGGCTCTTA
TTCTCATGCGGAAGGTAAACATACA	ATCGCTTTAGGCGAAGCAGCACATGCAGAAGGAACCGCGACTATCGCTAACGGATTCTC
TTCTCATGCGGAAGGTAATCATACA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018931.1\|WP_000654694.1\|4104039_4105200_+\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NZ_CP018931.1\|WP_000360638.1\|4111661_4112555_+\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|372699
NZ_CP018931.1\|WP_000043381.1\|4111263_4111662_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381281
NZ_CP018931.1\|WP_000673194.1\|4108501_4109299_-\|NAD-kinase	unknown	unknown	gnl\|CDD\|235317
NZ_CP018931.1\|WP_000003393.1\|4113077_4114904_-\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NZ_CP018931.1\|WP_001079111.1\|4107592_4108486_-\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NZ_CP018931.1\|WP_075396649.1\|4096721_4097402_-\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP018931.1\|WP_000799201.1\|4116280_4117825_-\|cardiolipin-synthase	unknown	unknown	gnl\|CDD\|234967
NZ_CP018931.1\|WP_001081482.1\|4109317_4109956_-\|GTP-pyrophosphokinase-family-protein	unknown	unknown	gnl\|CDD\|225232
NZ_CP018931.1\|WP_075396645.1\|4114954_4116199_-\|competence-protein	unknown	unknown	gnl\|CDD\|226875
NZ_CP018931.1\|WP_000872722.1\|4105274_4106015_+\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	unknown	unknown	gnl\|CDD\|184187
NZ_CP018931.1\|WP_000069724.1\|4100204_4101092_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375999
NZ_CP018931.1\|WP_075396648.1\|4098938_4100039_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005
NZ_CP018931.1\|WP_000428855.1\|4101214_4102060_+\|O-methyltransferase	unknown	unknown	gnl\|CDD\|377550
NZ_CP018931.1\|WP_001271203.1\|4097414_4098101_-\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP018931.1\|WP_001180009.1\|4109986_4110358_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018931.1\|WP_001087866.1\|4098097_4098787_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369778
NZ_CP018931.1\|WP_075396646.1\|4102961_4103897_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NZ_CP018931.1\|WP_139316749.1\|4102196_4102955_+\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|379312
NZ_CP018931.1\|WP_000191105.1\|4110504_4111083_+\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|143627

Protein	Function_ID	Function_description	E-value
NZ_CP018931.1\|WP_000654694.1\|4104039_4105200_+\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	1.52707e-99
NZ_CP018931.1\|WP_000360638.1\|4111661_4112555_+\|DsbA-family-protein	gnl\|CDD\|372699	pfam13743, Thioredoxin_5, Thioredoxin.	5.36453e-93
NZ_CP018931.1\|WP_000043381.1\|4111263_4111662_+\|hypothetical-protein	gnl\|CDD\|381281	cd14772, TrHb2_Bs-trHb-like_O, Truncated hemoglobins, group 2 (O); Bacillus subtilis TrHb like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). TrHb2's belonging to this group include monomeric Bacillus subtilis trHb (Bs-trHb), which exhibits an extremely high oxygen affinity, and a dimeric TrHb2 from the thermophilic aerobic spore forming bacterium Geobacillus stearothermophilus(Gs-trHb).	1.17037e-69
NZ_CP018931.1\|WP_000673194.1\|4108501_4109299_-\|NAD-kinase	gnl\|CDD\|235317	PRK04885, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional.	0
NZ_CP018931.1\|WP_000003393.1\|4113077_4114904_-\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NZ_CP018931.1\|WP_001079111.1\|4107592_4108486_-\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	1.51034e-100
NZ_CP018931.1\|WP_075396649.1\|4096721_4097402_-\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	4.03193e-108
NZ_CP018931.1\|WP_000799201.1\|4116280_4117825_-\|cardiolipin-synthase	gnl\|CDD\|234967	PRK01642, cls, cardiolipin synthetase; Reviewed.	0
NZ_CP018931.1\|WP_001081482.1\|4109317_4109956_-\|GTP-pyrophosphokinase-family-protein	gnl\|CDD\|225232	COG2357, COG2357, PpGpp synthetase catalytic domain [General function prediction only].	1.66713e-95
NZ_CP018931.1\|WP_000872722.1\|4105274_4106015_+\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	gnl\|CDD\|184187	PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional.	0
NZ_CP018931.1\|WP_000069724.1\|4100204_4101092_+\|hypothetical-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	4.03029e-18
NZ_CP018931.1\|WP_075396648.1\|4098938_4100039_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	7.29468e-55
NZ_CP018931.1\|WP_000428855.1\|4101214_4102060_+\|O-methyltransferase	gnl\|CDD\|377550	pfam05711, TylF, Macrocin-O-methyltransferase (TylF). This family consists of bacterial macrocin O-methyltransferase (TylF) proteins. TylF is responsible for the methylation of macrocin to produce tylosin. Tylosin is a macrolide antibiotic used in veterinary medicine to treat infections caused by Gram-positive bacteria and as an animal growth promoter in the swine industry. It is produced by several Streptomyces species. As with other macrolides, the antibiotic activity of tylosin is due to the inhibition of protein biosynthesis by a mechanism that involves the binding of tylosin to the ribosome, preventing the formation of the mRNA-aminoacyl-tRNA-ribosome complex. The structure of one representative sequence from this family, NovP, shows it to be an S-adenosyl-l-methionine-dependent O-methyltransferase that catalyzes the penultimate step in the biosynthesis of the aminocoumarin antibiotic novobiocin. Specifically, it methylates at 4-OH of the noviose moiety, and the resultant methoxy group is important for the potency of the mature antibiotic. It is likely that the key structural features of NovP are common to the rest of the family and include: a helical 'lid' region that gates access to the co-substrate binding pocket and an active centre that contains a 3-Asp putative metal binding site. A further conserved Asp probably acts as the general base that initiates the reaction by de-protonating the 4-OH group of the noviose unit.	1.13671e-149
NZ_CP018931.1\|WP_001271203.1\|4097414_4098101_-\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	4.87129e-112
NZ_CP018931.1\|WP_075396645.1\|4114954_4116199_-\|competence-protein	gnl\|CDD\|226875	COG4469, CoiA, Competence protein CoiA-like family, contains a predicted nuclease domain [General function prediction only].	5.91558e-58
NZ_CP018931.1\|WP_001087866.1\|4098097_4098787_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369778	pfam08242, Methyltransf_12, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	1.33577e-17
NZ_CP018931.1\|WP_075396646.1\|4102961_4103897_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	7.58302e-22
NZ_CP018931.1\|WP_139316749.1\|4102196_4102955_+\|methyltransferase-domain-containing-protein	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	9.7031e-20
NZ_CP018931.1\|WP_000191105.1\|4110504_4111083_+\|CYTH-domain-containing-protein	gnl\|CDD\|143627	cd07762, CYTH-like_Pase_1, Uncharacterized subgroup 1 of the CYTH-like superfamily. Enzymes belonging to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup are of bacterial origin and have not been characterized.	1.94434e-83

>NZ_CP018931.1|WP_000872722.1|4105274_4106015_+|bis(5'-nucleosyl)-tetraphosphatase-PrpE
MKYDIIGDIHGCLQEFQNLTEKLGYNWSSGLPVHPDQRKLAFVGDITDRGPHSLRMIEIVWELVIHKKVAYYAPGNHCNKLYRFFLGRNVTVAHGLETTVAEYEALPSHKQNMIKEKFITLYEQSPLYHVLDEKRLLVCHAGIRQDYIGRQDKKVQTFVLYGDITGEKHADGSPVRRDWAKEYKGTTWIVYGHTPVKEPRFVNHTVNIDTGAVFGGRLTALRYPEMETVSVPSSLPFVPEKFRPIS
>NZ_CP018931.1|WP_000654694.1|4104039_4105200_+|rod-shape-determining-protein-RodA
MKDPNSQYQIDYVLLCILFAIGTVSCFAIASAQASLPPFLQNVNFVLKQIQWYFIGFIAIGVIMIIDFDRYQKIAWYLYSFALVLLIGLELQVPGAITIKGATAWYRLPGIGNFQPSEIMKLFLIIVTGRIIANHNEKYFYRTIHDDFLLLGKICATSLPPLLLIAKEPDLGNTMVISAMLAAMILVSGIRWRFIFGLVSGIFVTAVTLTYIFFTHTKFFKTHILQEYQLNRFYGWLAPYKYDAQGYQLRQAFLATGSGEMQGKGWENGQVYFPEPHTDFIFTNVAEQFGFLGASVIIAIFFLLIFRMIHIAIESNDPFGSYICAGTIGMFTFQVFQNIGMTIGLLPITGITLPLMSYGGSSLLTYMIAIGFVLNVRSRTKIFMFN
>NZ_CP018931.1|WP_075396646.1|4102961_4103897_+|glycosyltransferase-family-2-protein
MENIKNVPLVSILIPTYNRPHYFKIALESALAQTYSNTEIIVGDDSTNNETEKLIYRDYLHKHKHITYIRNPSTLGQFHNALMLLEQSNGEYINFLMDDDIFYNNKIEKMMFYFQKDLDQNLALITSYRTWINDDGDIIEQHPSMKKLYDEDTLLNGKDFGNRMLILGQNIIGEPTTVLFRKRLLTEPFGTLNGRNYNCSVDMASWISLLSKGDAIYITEPLSSFRLHTGQQVHHKYLEGCEDFSHLVLHSKKYGFLQDIDYYKTSLLKACEWYKNATTFYQLYPELIPTTDTHTRLSHCLNIVTKELHAI
>NZ_CP018931.1|WP_139316749.1|4102196_4102955_+|methyltransferase-domain-containing-protein
MNENEKKITLIPPPELVQYVGGHFEEVGKEFIQYFIEIGNLKSNETVLDVGCGIGRMAVPLMNYLSDDGTYYGFDLFNKGITWCKNNISTRRNNFHFEHVDIYNQFYNPDGKEDASQYKFPYEDESFDFIFLTSVFTHLLPKELEHYVREIARVLKKDGRCFITFFLINPESSYYLNAGLSPLGFYHQIDNCYVLNKDIPNFAVAYPEEDIRTLLNKYGLEMQTPPHYGSWCGRTEHTSYQDIILTQKISER
>NZ_CP018931.1|WP_000428855.1|4101214_4102060_+|O-methyltransferase
MENKSAVQLYLELLKKTILFEIWLEYEPYLPASLHISKELSYEPVTVPLPLFLKQYVENHNLKIVNPNVSNNERQGGKDWPRAAHSMVGRKRMNQLQEAMETVVKENIEGDFIETGVWRGGSCIFMNGFLQANNITDRTVWVADSFEGLPAPNLEQYPKDYGDYLHTFDYLRVSLETVQENFRKYDLLNDQVKFLKGWFKDTLPSAPIEKIAIARLDGDMYESTMDSLVNLYDKVSIGGFIIIDDYGLITCAEAVTDFRSERNIKTPMTQIDDFGIFWRKE
>NZ_CP018931.1|WP_000069724.1|4100204_4101092_+|hypothetical-protein
MSNNNYSNGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTVPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGDTGTTGPTGPTGDTGTTGPTGPTGDTGTTGPTGPTGDTGATGLTGPTGDTGATGLTGPTGATGLTGPTGPSGLGLPAGLYAFNSGGISLDLGINDPVPFNTVGSQFGTAISQLDADTFVISETGFYKITVIANTATASVLGGLTIQVNGVPVPGTGSSLISLGAPIVIQAITQITTTPSLVEVIVTGLGLSLALGTSASIIIEKVA
>NZ_CP018931.1|WP_075396648.1|4098938_4100039_-|glycosyltransferase-family-2-protein
MLNKQGITISLCMIVRDEEKTIARCLDSVEKIVDEIIVVDTGSIDRTKEIVEKYTSNIYDFQWIDDFAAARNFSFSKATQEYILWLDADDVLLEDAQEALKLLKRELDPKIDAVSMPYHLAMDSNGKPLYCTKRNRLVKREKQFQWFGKVHEYLAISGETFSSNVAITHKKEKKVTNRNLKIFQNTVAAGEELSPRDLFYYANESTDNQKYDDAVLLYETFLNQDEGWYEEKIYACGKLGDCYAKLGMWEKAIESCVKSFRYDVPRGENCTRIGYIYMEQQKYNEAIFWFKLATEVPMATESPFHSPASYTWLPYLQMCICYSKLGEQDKAYYYNELAASYVPNNAAIEYNRKYFRSIFDQQKKSL
>NZ_CP018931.1|WP_001087866.1|4098097_4098787_-|class-I-SAM-dependent-methyltransferase
MNSPKNSLYEEKSGHYYNAVNPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGTRVSGIEAFPEAAEQAKEKLDHVVLGDIETMEMPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKHNGVILASIPNVAHISVLAPLLAGNWSYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYIDHKMYEPLIEELYGVCKKYRLGSGFMAETVVFQYIIEAEKSSL
>NZ_CP018931.1|WP_001271203.1|4097414_4098101_-|streptomycin-biosynthesis-protein-StrF
MSAAEKTILFVTCINDSKMYAQCVRHILRLAVPPGYVVQFMPIRNAKSMTSGYNQAISHPAKYKVYIHQDVFIMNVAFLHGLLQLFNEHEHLGMIGMIGAQYVPPNGVWNEGKGVVGKVIGYMNDLFYMASQEQPYHESKTFMPVECIDGLLMATQYDIPWREDLFDGFDYYDVSQSFEFRKAGYTVGVPVQRDAWCIHYHIDVNMTNYEKYRKIFVEHYMSDVNQDE
>NZ_CP018931.1|WP_075396649.1|4096721_4097402_-|streptomycin-biosynthesis-protein-StrF
MKDHTILVVVCINNEELFEQCERQIRNLFVPPGYVVQIFPIRDAKSMASAYNRALSYPAKYKVYIHQDTFLINREMFYTLISLFKDNEKLGLIGVAGAQFLPSNGIWWEGKNLVGKVIEHRRQNYQLLNLDQLFYGNQSFMSVQAIDGLLMATQYDIPWREDLFQGFHFYDVSQSLEFQKAGYLIGIPNQANLWCIHYNGDEFDADTYEKYRKVFVEHYKDILSPS
>NZ_CP018931.1|WP_001079111.1|4107592_4108486_-|RluA-family-pseudouridine-synthase
MNRFTLKWDIESAEEGTLVREFLKTKGISKAALTDIKFHGGAIEVNGQHASVRHQLQVGEELRIFFPVEERSEGMIAEDIPLCIVYEDDAVLVINKEANMSTIPSREHPSGSVANALLSHYDKQYLPSTVHIVTRLDRDTSGLMLIAKNRFVHHLLSKQHQQKAVKRTYEAIVHGEMVEREGTIDAPIGRKSDSIIERTVCEEGQRAVTHFRVIDSANHKTHVSLELDTGRTHQIRVHMAHIGHPLLGDNLYGGKRDEMKRQALHSTSLTFYHPILEKEMSFAAMIPSDMQEVLRQT
>NZ_CP018931.1|WP_000673194.1|4108501_4109299_-|NAD-kinase
MKFTIMSKGDQSSDTLASTMKEYLLDFGFIMDEQEPDIVISVGGDGTLLYAFHRYYNRLDETAFVGVHTGHLGFYADWLPTEVEKLVIAIAKTPFQVVEYPLLEVIIRYMNGSKESQYLAMNEATVKSAEGTLVTEVEIRGEYFETFRGDGLCISTPSGSTAYNKALGGAIIHPSIEAIQIAEMASINNRVFRTVGSPLVLPKHHTCVLKPTAGMNLQITVDHLTMVHQDVKSIQYRVANEKVRFVRFRPFPFWKRVRDSFVADK
>NZ_CP018931.1|WP_001081482.1|4109317_4109956_-|GTP-pyrophosphokinase-family-protein
MNRNWEEFLAPYHQAVAELKVKLKGMRTQFAMLTEHSPIEFVTGRVKSVASIIDKAEKRNVPLDRLREDMQDIAGLRMMCQFVDEIKPVVEYLRKRNDFEIVEERDYVTQKKDSGYRSYHVVISYPVQTIQGEQKVLVEIQIRTLAMNFWATIEHSLNYKYSGRFPEDIKIRLQRAAEAAFLLDEEMSSIRLEIQEAQKAFSRKQETKDSES
>NZ_CP018931.1|WP_001180009.1|4109986_4110358_-|hypothetical-protein
MQNKIQVKSVEKRENALIFCAENSEIEVKGLSARNHVLVDSDNLSFLYILENESSFIYVSIPHTCWEAMHEAMNNDVVMFVRVNDIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
>NZ_CP018931.1|WP_000191105.1|4110504_4111083_+|CYTH-domain-containing-protein
MTQEIEIEFKNIVTEEEFHALCKSFSIEVFTKQVNHYFETPNFSLKEAGSALRIRHKGETYTLTLKQPAEVGLLETHQVVTENEAKMMMETNVIISGAVMNQLCKLQIPVSALTYMGSLTTERAETLFEGGTLVFDHSFYYNHDDYEIEFEVQDEETGKAAFIHLLKQHNIPIRHTNNKVKRFFLAKQNKAR
>NZ_CP018931.1|WP_000043381.1|4111263_4111662_+|hypothetical-protein
MSKQPMTPFEAIGGEQCIAILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPNETGEI
>NZ_CP018931.1|WP_000360638.1|4111661_4112555_+|DsbA-family-protein
MDKQEAKHINMPSPSACEHKSVEAYLFIDPLCKDCWEIEPFIIKLWLEYGKYFSIRHIVTGKVDGTNASSHKWNKPANIRFVWEKTTSLHGFSCDGKVHMQEASSTPYLVSMAIKAAELQGRKAGSKFLRKLQEYIFLENVSNPDCELLLACAKDSDIDVEEFKKDLYSASAKKAFQCDLKFTNEMHITEIPSLVFFHANSDEEGIKIAGTYSYDVYVQLLKELVKCEIEPEPLPPLEVLLEATQFISSKEVAFIYDCSKQEIERELKKLQLKRKVQMIDVKCERYWKWIAKEKDLV
>NZ_CP018931.1|WP_000003393.1|4113077_4114904_-|oligoendopeptidase-F
MSEQNTAKTLPDRNEIEESSTWRLEDIFQTDTEWEKEFQAIKELLPKLTEFKGKLGDSANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAYIVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASSNTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNTFASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLIESVNDNLHLLHRYIDIRKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWVDVYENKGKRSGAYSSGAYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVYGDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHIIHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVIDEEIGLEWSRIPHFYYNYYVYQYATGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQVFEEKLNELEALLFEEK
>NZ_CP018931.1|WP_075396645.1|4114954_4116199_-|competence-protein
MIPIFIAKRENGEKIHLLDHHDEELLHHMRKRESFFCIACGKEVLMRLGKQKKWHFAHKKVDSCLAFYEAESTYHMYGKELLYRWFKRQNVHVEIEHYLPEIQQRPDIFIERAGRKIAIEYQCANLSIEQLCKRTYSYWQAGIQVIWIIGGNQLKKHSAYWMKFSSIMAFSLQSYPQPLLIFFCSKQKSFMKCTFITSFSTSVAFSHIIYLPIETTTFEMLFSPVPFQREVLNREWKRRKDYFRQNALPILNYNHKSLLRLLYQCKCNPANFPPEIGVPLPSSFAFQTNSFIWQAFLYMKCIGELAVGDCISLKYVCSYIKKYTKRRMLPYFSQHIWKVAVTEYMTFLCYAGVLYKVGMYTYRKIRDAVPLKTGGEIMKHDEICLAHALSLFEAKFNMRGGKGDIIKTDREGIT
>NZ_CP018931.1|WP_000799201.1|4116280_4117825_-|cardiolipin-synthase
MKNTLKLIFFVLLLFALFVSLRMFIDVAFYSDVIGIKDVSILGIISILFTVSAFLIGCVIFLENRHPSKTLTWLIVLGIFPVFGFFAYLLFGQNFRRKRMFQKKALLDEQAFLQYKGHEDYEERILRNHKHQELLFRLADRLGALNISFQTETRTLTNGDETFQAILDGLKRAKHHIHMEYYIVRDDKLGTEIKDILIQKSKEGVVVRFLFDAVGSFKLSKSYIEELNDAGVEMIPFFPVRFPILNDKINYRNHRKIVIIDGNEGFVGGLNIGDEYLGKDKYFGFWRDTHLYLRGEAVQSLQLIFLQDWFYMTGEAVLAPEYLQAKAVEGEHWGGVQLVAGGPDNKWETIKHLYFAMIASARKSIWIATPYFIPDDDILSALKVAALAGIDVRLLMPSKPDKRTVFYASRSYFPELLDAGVKIYEYEKGFLHSKVVIVDSDLASIGTANMDMRSFHLNFEVNAFLYDTDSIRKLVQDFKDDLEESSEIHVDRFHKRRLHRRIVESTYRLLSPLL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NZ_CP018931.1	816627-816662	0	1.0
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NZ_CP018931.1	817959-817994	0	1.0
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NZ_CP018931.1	818229-818264	0	1.0
NZ_CP018931_1	1.2\|817158\|18\|NZ_CP018931\|CRT	817158-817175	18	NZ_CP018931.1	815313-815330	0	1.0
NZ_CP018931_1	1.2\|817158\|18\|NZ_CP018931\|CRT	817158-817175	18	NZ_CP018931.1	815592-815609	0	1.0
NZ_CP018931_1	1.2\|817158\|18\|NZ_CP018931\|CRT	817158-817175	18	NZ_CP018931.1	815907-815924	0	1.0
NZ_CP018931_1	1.2\|817158\|18\|NZ_CP018931\|CRT	817158-817175	18	NZ_CP018931.1	816087-816104	0	1.0
NZ_CP018931_1	1.2\|817158\|18\|NZ_CP018931\|CRT	817158-817175	18	NZ_CP018931.1	816240-816257	0	1.0
NZ_CP018931_1	1.2\|817158\|18\|NZ_CP018931\|CRT	817158-817175	18	NZ_CP018931.1	816330-816347	0	1.0
NZ_CP018931_1	1.2\|817158\|18\|NZ_CP018931\|CRT	817158-817175	18	NZ_CP018931.1	816492-816509	0	1.0
NZ_CP018931_1	1.2\|817158\|18\|NZ_CP018931\|CRT	817158-817175	18	NZ_CP018931.1	816699-816716	0	1.0
NZ_CP018931_1	1.2\|817158\|18\|NZ_CP018931\|CRT	817158-817175	18	NZ_CP018931.1	818031-818048	0	1.0
NZ_CP018931_1	1.2\|817158\|18\|NZ_CP018931\|CRT	817158-817175	18	NZ_CP018931.1	818319-818336	0	1.0
NZ_CP018931_1	1.2\|817158\|18\|NZ_CP018931\|CRT	817158-817175	18	NZ_CP018931.1	818625-818642	0	1.0
NZ_CP018931_1	1.6\|817383\|45\|NZ_CP018931\|CRT	817383-817427	45	NZ_CP018931.1	816861-816905	0	1.0
NZ_CP018931_1	1.8\|817500\|18\|NZ_CP018931\|CRT	817500-817517	18	NZ_CP018931.1	815295-815312	0	1.0
NZ_CP018931_1	1.8\|817500\|18\|NZ_CP018931\|CRT	817500-817517	18	NZ_CP018931.1	815655-815672	0	1.0
NZ_CP018931_1	1.8\|817500\|18\|NZ_CP018931\|CRT	817500-817517	18	NZ_CP018931.1	816888-816905	0	1.0
NZ_CP018931_1	1.8\|817500\|18\|NZ_CP018931\|CRT	817500-817517	18	NZ_CP018931.1	818301-818318	0	1.0
NZ_CP018931_1	1.8\|817500\|18\|NZ_CP018931\|CRT	817500-817517	18	NZ_CP018931.1	818643-818660	0	1.0
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP018931.1	817041-817067	0	1.0
NZ_CP018931_1	1.11\|817617\|18\|NZ_CP018931\|CRT	817617-817634	18	NZ_CP018931.1	815556-815573	0	1.0
NZ_CP018931_1	1.11\|817617\|18\|NZ_CP018931\|CRT	817617-817634	18	NZ_CP018931.1	818463-818480	0	1.0
NZ_CP018931_3	3.1\|1790811\|19\|NZ_CP018931\|CRT	1790811-1790829	19	NZ_CP018931.1	1789623-1789641	0	1.0
NZ_CP018931_3	3.1\|1790811\|19\|NZ_CP018931\|CRT	1790811-1790829	19	NZ_CP018931.1	1790460-1790478	0	1.0
NZ_CP018931_3	3.1\|1790811\|19\|NZ_CP018931\|CRT	1790811-1790829	19	NZ_CP018931.1	1790595-1790613	0	1.0
NZ_CP018931_3	3.1\|1790811\|19\|NZ_CP018931\|CRT	1790811-1790829	19	NZ_CP018931.1	1791189-1791207	0	1.0
NZ_CP018931_3	3.2\|1790856\|19\|NZ_CP018931\|CRT	1790856-1790874	19	NZ_CP018931.1	1791315-1791333	0	1.0
NZ_CP018931_3	3.2\|1790856\|19\|NZ_CP018931\|CRT	1790856-1790874	19	NZ_CP018931.1	1791351-1791369	0	1.0
NZ_CP018931_3	3.4\|1790955\|19\|NZ_CP018931\|CRT	1790955-1790973	19	NZ_CP018931.1	1789623-1789641	0	1.0
NZ_CP018931_3	3.4\|1790955\|19\|NZ_CP018931\|CRT	1790955-1790973	19	NZ_CP018931.1	1790460-1790478	0	1.0
NZ_CP018931_3	3.4\|1790955\|19\|NZ_CP018931\|CRT	1790955-1790973	19	NZ_CP018931.1	1790595-1790613	0	1.0
NZ_CP018931_3	3.4\|1790955\|19\|NZ_CP018931\|CRT	1790955-1790973	19	NZ_CP018931.1	1791189-1791207	0	1.0
NZ_CP018931_3	3.6\|1791054\|19\|NZ_CP018931\|CRT	1791054-1791072	19	NZ_CP018931.1	1789623-1789641	0	1.0
NZ_CP018931_3	3.6\|1791054\|19\|NZ_CP018931\|CRT	1791054-1791072	19	NZ_CP018931.1	1790460-1790478	0	1.0
NZ_CP018931_3	3.6\|1791054\|19\|NZ_CP018931\|CRT	1791054-1791072	19	NZ_CP018931.1	1790595-1790613	0	1.0
NZ_CP018931_3	3.6\|1791054\|19\|NZ_CP018931\|CRT	1791054-1791072	19	NZ_CP018931.1	1791189-1791207	0	1.0
NZ_CP018931_3	3.7\|1791099\|19\|NZ_CP018931\|CRT	1791099-1791117	19	NZ_CP018931.1	1789758-1789776	0	1.0
NZ_CP018931_3	3.7\|1791099\|19\|NZ_CP018931\|CRT	1791099-1791117	19	NZ_CP018931.1	1790415-1790433	0	1.0
NZ_CP018931_3	3.7\|1791099\|19\|NZ_CP018931\|CRT	1791099-1791117	19	NZ_CP018931.1	1790640-1790658	0	1.0
NZ_CP018931_3	3.7\|1791099\|19\|NZ_CP018931\|CRT	1791099-1791117	19	NZ_CP018931.1	1791270-1791288	0	1.0
NZ_CP018931_3	3.7\|1791099\|19\|NZ_CP018931\|CRT	1791099-1791117	19	NZ_CP018931.1	1791387-1791405	0	1.0
NZ_CP018931_3	3.7\|1791099\|19\|NZ_CP018931\|CRT	1791099-1791117	19	NZ_CP018931.1	1791432-1791450	0	1.0
NZ_CP018931_3	3.7\|1791099\|19\|NZ_CP018931\|CRT	1791099-1791117	19	NZ_CP018931.1	1791477-1791495	0	1.0
NZ_CP018931_3	3.8\|1791144\|19\|NZ_CP018931\|CRT	1791144-1791162	19	NZ_CP018931.1	1789623-1789641	0	1.0
NZ_CP018931_3	3.8\|1791144\|19\|NZ_CP018931\|CRT	1791144-1791162	19	NZ_CP018931.1	1790460-1790478	0	1.0
NZ_CP018931_3	3.8\|1791144\|19\|NZ_CP018931\|CRT	1791144-1791162	19	NZ_CP018931.1	1790595-1790613	0	1.0
NZ_CP018931_3	3.8\|1791144\|19\|NZ_CP018931\|CRT	1791144-1791162	19	NZ_CP018931.1	1791189-1791207	0	1.0
NZ_CP018931_1	1.8\|817500\|18\|NZ_CP018931\|CRT	817500-817517	18	NZ_CP018931.1	815889-815906	1	0.944
NZ_CP018931_1	1.8\|817500\|18\|NZ_CP018931\|CRT	817500-817517	18	NZ_CP018931.1	816681-816698	1	0.944
NZ_CP018931_1	1.8\|817500\|18\|NZ_CP018931\|CRT	817500-817517	18	NZ_CP018931.1	817050-817067	1	0.944
NZ_CP018931_1	1.8\|817500\|18\|NZ_CP018931\|CRT	817500-817517	18	NZ_CP018931.1	817905-817922	1	0.944
NZ_CP018931_1	1.8\|817500\|18\|NZ_CP018931\|CRT	817500-817517	18	NZ_CP018931.1	818013-818030	1	0.944
NZ_CP018931_1	1.8\|817500\|18\|NZ_CP018931\|CRT	817500-817517	18	NZ_CP018931.1	818607-818624	1	0.944
NZ_CP018931_1	1.12\|817653\|36\|NZ_CP018931\|CRT	817653-817688	36	NZ_CP018931.1	816528-816563	1	0.972
NZ_CP018931_1	1.13\|817707\|18\|NZ_CP018931\|CRT	817707-817724	18	NZ_CP018931.1	815313-815330	1	0.944
NZ_CP018931_1	1.13\|817707\|18\|NZ_CP018931\|CRT	817707-817724	18	NZ_CP018931.1	815592-815609	1	0.944
NZ_CP018931_1	1.13\|817707\|18\|NZ_CP018931\|CRT	817707-817724	18	NZ_CP018931.1	815691-815708	1	0.944
NZ_CP018931_1	1.13\|817707\|18\|NZ_CP018931\|CRT	817707-817724	18	NZ_CP018931.1	815907-815924	1	0.944
NZ_CP018931_1	1.13\|817707\|18\|NZ_CP018931\|CRT	817707-817724	18	NZ_CP018931.1	816087-816104	1	0.944
NZ_CP018931_1	1.13\|817707\|18\|NZ_CP018931\|CRT	817707-817724	18	NZ_CP018931.1	816240-816257	1	0.944
NZ_CP018931_1	1.13\|817707\|18\|NZ_CP018931\|CRT	817707-817724	18	NZ_CP018931.1	816330-816347	1	0.944
NZ_CP018931_1	1.13\|817707\|18\|NZ_CP018931\|CRT	817707-817724	18	NZ_CP018931.1	816492-816509	1	0.944
NZ_CP018931_1	1.13\|817707\|18\|NZ_CP018931\|CRT	817707-817724	18	NZ_CP018931.1	816699-816716	1	0.944
NZ_CP018931_1	1.13\|817707\|18\|NZ_CP018931\|CRT	817707-817724	18	NZ_CP018931.1	816861-816878	1	0.944
NZ_CP018931_1	1.13\|817707\|18\|NZ_CP018931\|CRT	817707-817724	18	NZ_CP018931.1	816978-816995	1	0.944
NZ_CP018931_1	1.13\|817707\|18\|NZ_CP018931\|CRT	817707-817724	18	NZ_CP018931.1	818031-818048	1	0.944
NZ_CP018931_1	1.13\|817707\|18\|NZ_CP018931\|CRT	817707-817724	18	NZ_CP018931.1	818319-818336	1	0.944
NZ_CP018931_1	1.13\|817707\|18\|NZ_CP018931\|CRT	817707-817724	18	NZ_CP018931.1	818409-818426	1	0.944
NZ_CP018931_1	1.13\|817707\|18\|NZ_CP018931\|CRT	817707-817724	18	NZ_CP018931.1	818625-818642	1	0.944
NZ_CP018931_1	1.13\|817707\|18\|NZ_CP018931\|CRT	817707-817724	18	NZ_CP018931.1	818787-818804	1	0.944
NZ_CP018931_1	1.14\|817743\|18\|NZ_CP018931\|CRT	817743-817760	18	NZ_CP018931.1	816861-816878	1	0.944
NZ_CP018931_1	1.15\|817779\|18\|NZ_CP018931\|CRT	817779-817796	18	NZ_CP018931.1	815619-815636	1	0.944
NZ_CP018931_1	1.15\|817779\|18\|NZ_CP018931\|CRT	817779-817796	18	NZ_CP018931.1	815853-815870	1	0.944
NZ_CP018931_1	1.15\|817779\|18\|NZ_CP018931\|CRT	817779-817796	18	NZ_CP018931.1	816366-816383	1	0.944
NZ_CP018931_1	1.15\|817779\|18\|NZ_CP018931\|CRT	817779-817796	18	NZ_CP018931.1	816771-816788	1	0.944
NZ_CP018931_1	1.15\|817779\|18\|NZ_CP018931\|CRT	817779-817796	18	NZ_CP018931.1	816825-816842	1	0.944
NZ_CP018931_1	1.15\|817779\|18\|NZ_CP018931\|CRT	817779-817796	18	NZ_CP018931.1	816942-816959	1	0.944
NZ_CP018931_1	1.15\|817779\|18\|NZ_CP018931\|CRT	817779-817796	18	NZ_CP018931.1	818103-818120	1	0.944
NZ_CP018931_3	3.2\|1790856\|19\|NZ_CP018931\|CRT	1790856-1790874	19	NZ_CP018931.1	1789407-1789425	1	0.947
NZ_CP018931_3	3.2\|1790856\|19\|NZ_CP018931\|CRT	1790856-1790874	19	NZ_CP018931.1	1789938-1789956	1	0.947
NZ_CP018931_3	3.2\|1790856\|19\|NZ_CP018931\|CRT	1790856-1790874	19	NZ_CP018931.1	1790505-1790523	1	0.947
NZ_CP018931_3	3.2\|1790856\|19\|NZ_CP018931\|CRT	1790856-1790874	19	NZ_CP018931.1	1790730-1790748	1	0.947
NZ_CP018931_3	3.2\|1790856\|19\|NZ_CP018931\|CRT	1790856-1790874	19	NZ_CP018931.1	3887247-3887265	1	0.947
NZ_CP018931_3	3.2\|1790856\|19\|NZ_CP018931\|CRT	1790856-1790874	19	NZ_CP018931.1	3887292-3887310	1	0.947
NZ_CP018931_3	3.2\|1790856\|19\|NZ_CP018931\|CRT	1790856-1790874	19	NZ_CP018931.1	3887562-3887580	1	0.947
NZ_CP018931_3	3.2\|1790856\|19\|NZ_CP018931\|CRT	1790856-1790874	19	NZ_CP018931.1	3887607-3887625	1	0.947
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	NZ_CP018931.1	1790253-1790280	1	0.964
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	NZ_CP018931.1	1790253-1790280	1	0.964
NZ_CP018931_3	3.7\|1791099\|19\|NZ_CP018931\|CRT	1791099-1791117	19	NZ_CP018931.1	1790685-1790703	1	0.947
NZ_CP018931_3	3.7\|1791099\|19\|NZ_CP018931\|CRT	1791099-1791117	19	NZ_CP018931.1	1791522-1791540	1	0.947
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NZ_CP018931.1	815484-815519	2	0.944
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NZ_CP018931.1	816735-816770	2	0.944
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NZ_CP018931.1	818067-818102	2	0.944
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NZ_CP018931.1	818175-818210	2	0.944
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NZ_CP018931.1	818517-818552	2	0.944
NZ_CP018931_1	1.7\|817446\|36\|NZ_CP018931\|CRT	817446-817481	36	NZ_CP018931.1	816924-816959	2	0.944
NZ_CP018931_1	1.12\|817653\|36\|NZ_CP018931\|CRT	817653-817688	36	NZ_CP018931.1	815502-815537	2	0.944
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	NZ_CP018931.1	1791225-1791252	2	0.929
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	NZ_CP018931.1	1791225-1791252	2	0.929
NZ_CP018931_3	3.7\|1791099\|19\|NZ_CP018931\|CRT	1791099-1791117	19	NZ_CP018931.1	1789848-1789866	2	0.895

1. spacer 1.1|817104|36|NZ_CP018931|CRT matches to position: 816627-816662, mismatch: 0, identity: 1.0

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caacaggagaaacgggaggaacaggaagcactgggg	Protospacer
************************************

2. spacer 1.1|817104|36|NZ_CP018931|CRT matches to position: 817959-817994, mismatch: 0, identity: 1.0

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caacaggagaaacgggaggaacaggaagcactgggg	Protospacer
************************************

3. spacer 1.1|817104|36|NZ_CP018931|CRT matches to position: 818229-818264, mismatch: 0, identity: 1.0

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caacaggagaaacgggaggaacaggaagcactgggg	Protospacer
************************************

4. spacer 1.2|817158|18|NZ_CP018931|CRT matches to position: 815313-815330, mismatch: 0, identity: 1.0

caacgggaagtacgggag	CRISPR spacer
caacgggaagtacgggag	Protospacer
******************

5. spacer 1.2|817158|18|NZ_CP018931|CRT matches to position: 815592-815609, mismatch: 0, identity: 1.0

caacgggaagtacgggag	CRISPR spacer
caacgggaagtacgggag	Protospacer
******************

6. spacer 1.2|817158|18|NZ_CP018931|CRT matches to position: 815907-815924, mismatch: 0, identity: 1.0

caacgggaagtacgggag	CRISPR spacer
caacgggaagtacgggag	Protospacer
******************

7. spacer 1.2|817158|18|NZ_CP018931|CRT matches to position: 816087-816104, mismatch: 0, identity: 1.0

caacgggaagtacgggag	CRISPR spacer
caacgggaagtacgggag	Protospacer
******************

8. spacer 1.2|817158|18|NZ_CP018931|CRT matches to position: 816240-816257, mismatch: 0, identity: 1.0

caacgggaagtacgggag	CRISPR spacer
caacgggaagtacgggag	Protospacer
******************

9. spacer 1.2|817158|18|NZ_CP018931|CRT matches to position: 816330-816347, mismatch: 0, identity: 1.0

caacgggaagtacgggag	CRISPR spacer
caacgggaagtacgggag	Protospacer
******************

10. spacer 1.2|817158|18|NZ_CP018931|CRT matches to position: 816492-816509, mismatch: 0, identity: 1.0

caacgggaagtacgggag	CRISPR spacer
caacgggaagtacgggag	Protospacer
******************

11. spacer 1.2|817158|18|NZ_CP018931|CRT matches to position: 816699-816716, mismatch: 0, identity: 1.0

caacgggaagtacgggag	CRISPR spacer
caacgggaagtacgggag	Protospacer
******************

12. spacer 1.2|817158|18|NZ_CP018931|CRT matches to position: 818031-818048, mismatch: 0, identity: 1.0

caacgggaagtacgggag	CRISPR spacer
caacgggaagtacgggag	Protospacer
******************

13. spacer 1.2|817158|18|NZ_CP018931|CRT matches to position: 818319-818336, mismatch: 0, identity: 1.0

caacgggaagtacgggag	CRISPR spacer
caacgggaagtacgggag	Protospacer
******************

14. spacer 1.2|817158|18|NZ_CP018931|CRT matches to position: 818625-818642, mismatch: 0, identity: 1.0

caacgggaagtacgggag	CRISPR spacer
caacgggaagtacgggag	Protospacer
******************

15. spacer 1.6|817383|45|NZ_CP018931|CRT matches to position: 816861-816905, mismatch: 0, identity: 1.0

caacaggaagcacgggagtaacaggagcaaccggagaaacaggtc	CRISPR spacer
caacaggaagcacgggagtaacaggagcaaccggagaaacaggtc	Protospacer
*********************************************

16. spacer 1.8|817500|18|NZ_CP018931|CRT matches to position: 815295-815312, mismatch: 0, identity: 1.0

caaccggagaaacaggtc	CRISPR spacer
caaccggagaaacaggtc	Protospacer
******************

17. spacer 1.8|817500|18|NZ_CP018931|CRT matches to position: 815655-815672, mismatch: 0, identity: 1.0

caaccggagaaacaggtc	CRISPR spacer
caaccggagaaacaggtc	Protospacer
******************

18. spacer 1.8|817500|18|NZ_CP018931|CRT matches to position: 816888-816905, mismatch: 0, identity: 1.0

caaccggagaaacaggtc	CRISPR spacer
caaccggagaaacaggtc	Protospacer
******************

19. spacer 1.8|817500|18|NZ_CP018931|CRT matches to position: 818301-818318, mismatch: 0, identity: 1.0

caaccggagaaacaggtc	CRISPR spacer
caaccggagaaacaggtc	Protospacer
******************

20. spacer 1.8|817500|18|NZ_CP018931|CRT matches to position: 818643-818660, mismatch: 0, identity: 1.0

caaccggagaaacaggtc	CRISPR spacer
caaccggagaaacaggtc	Protospacer
******************

21. spacer 1.10|817572|27|NZ_CP018931|CRT matches to position: 817041-817067, mismatch: 0, identity: 1.0

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagaaacaggtc	Protospacer
***************************

22. spacer 1.11|817617|18|NZ_CP018931|CRT matches to position: 815556-815573, mismatch: 0, identity: 1.0

tgacaggaagtacgggtc	CRISPR spacer
tgacaggaagtacgggtc	Protospacer
******************

23. spacer 1.11|817617|18|NZ_CP018931|CRT matches to position: 818463-818480, mismatch: 0, identity: 1.0

tgacaggaagtacgggtc	CRISPR spacer
tgacaggaagtacgggtc	Protospacer
******************

24. spacer 3.1|1790811|19|NZ_CP018931|CRT matches to position: 1789623-1789641, mismatch: 0, identity: 1.0

gccttgaggtccagtagcg	CRISPR spacer
gccttgaggtccagtagcg	Protospacer
*******************

25. spacer 3.1|1790811|19|NZ_CP018931|CRT matches to position: 1790460-1790478, mismatch: 0, identity: 1.0

gccttgaggtccagtagcg	CRISPR spacer
gccttgaggtccagtagcg	Protospacer
*******************

26. spacer 3.1|1790811|19|NZ_CP018931|CRT matches to position: 1790595-1790613, mismatch: 0, identity: 1.0

gccttgaggtccagtagcg	CRISPR spacer
gccttgaggtccagtagcg	Protospacer
*******************

27. spacer 3.1|1790811|19|NZ_CP018931|CRT matches to position: 1791189-1791207, mismatch: 0, identity: 1.0

gccttgaggtccagtagcg	CRISPR spacer
gccttgaggtccagtagcg	Protospacer
*******************

28. spacer 3.2|1790856|19|NZ_CP018931|CRT matches to position: 1791315-1791333, mismatch: 0, identity: 1.0

accctgaggtccagtagcg	CRISPR spacer
accctgaggtccagtagcg	Protospacer
*******************

29. spacer 3.2|1790856|19|NZ_CP018931|CRT matches to position: 1791351-1791369, mismatch: 0, identity: 1.0

accctgaggtccagtagcg	CRISPR spacer
accctgaggtccagtagcg	Protospacer
*******************

30. spacer 3.4|1790955|19|NZ_CP018931|CRT matches to position: 1789623-1789641, mismatch: 0, identity: 1.0

gccttgaggtccagtagcg	CRISPR spacer
gccttgaggtccagtagcg	Protospacer
*******************

31. spacer 3.4|1790955|19|NZ_CP018931|CRT matches to position: 1790460-1790478, mismatch: 0, identity: 1.0

gccttgaggtccagtagcg	CRISPR spacer
gccttgaggtccagtagcg	Protospacer
*******************

32. spacer 3.4|1790955|19|NZ_CP018931|CRT matches to position: 1790595-1790613, mismatch: 0, identity: 1.0

gccttgaggtccagtagcg	CRISPR spacer
gccttgaggtccagtagcg	Protospacer
*******************

33. spacer 3.4|1790955|19|NZ_CP018931|CRT matches to position: 1791189-1791207, mismatch: 0, identity: 1.0

gccttgaggtccagtagcg	CRISPR spacer
gccttgaggtccagtagcg	Protospacer
*******************

34. spacer 3.6|1791054|19|NZ_CP018931|CRT matches to position: 1789623-1789641, mismatch: 0, identity: 1.0

gccttgaggtccagtagcg	CRISPR spacer
gccttgaggtccagtagcg	Protospacer
*******************

35. spacer 3.6|1791054|19|NZ_CP018931|CRT matches to position: 1790460-1790478, mismatch: 0, identity: 1.0

gccttgaggtccagtagcg	CRISPR spacer
gccttgaggtccagtagcg	Protospacer
*******************

36. spacer 3.6|1791054|19|NZ_CP018931|CRT matches to position: 1790595-1790613, mismatch: 0, identity: 1.0

gccttgaggtccagtagcg	CRISPR spacer
gccttgaggtccagtagcg	Protospacer
*******************

37. spacer 3.6|1791054|19|NZ_CP018931|CRT matches to position: 1791189-1791207, mismatch: 0, identity: 1.0

gccttgaggtccagtagcg	CRISPR spacer
gccttgaggtccagtagcg	Protospacer
*******************

38. spacer 3.7|1791099|19|NZ_CP018931|CRT matches to position: 1789758-1789776, mismatch: 0, identity: 1.0

gccttgaggtccagtggca	CRISPR spacer
gccttgaggtccagtggca	Protospacer
*******************

39. spacer 3.7|1791099|19|NZ_CP018931|CRT matches to position: 1790415-1790433, mismatch: 0, identity: 1.0

gccttgaggtccagtggca	CRISPR spacer
gccttgaggtccagtggca	Protospacer
*******************

40. spacer 3.7|1791099|19|NZ_CP018931|CRT matches to position: 1790640-1790658, mismatch: 0, identity: 1.0

gccttgaggtccagtggca	CRISPR spacer
gccttgaggtccagtggca	Protospacer
*******************

41. spacer 3.7|1791099|19|NZ_CP018931|CRT matches to position: 1791270-1791288, mismatch: 0, identity: 1.0

gccttgaggtccagtggca	CRISPR spacer
gccttgaggtccagtggca	Protospacer
*******************

42. spacer 3.7|1791099|19|NZ_CP018931|CRT matches to position: 1791387-1791405, mismatch: 0, identity: 1.0

gccttgaggtccagtggca	CRISPR spacer
gccttgaggtccagtggca	Protospacer
*******************

43. spacer 3.7|1791099|19|NZ_CP018931|CRT matches to position: 1791432-1791450, mismatch: 0, identity: 1.0

gccttgaggtccagtggca	CRISPR spacer
gccttgaggtccagtggca	Protospacer
*******************

44. spacer 3.7|1791099|19|NZ_CP018931|CRT matches to position: 1791477-1791495, mismatch: 0, identity: 1.0

gccttgaggtccagtggca	CRISPR spacer
gccttgaggtccagtggca	Protospacer
*******************

45. spacer 3.8|1791144|19|NZ_CP018931|CRT matches to position: 1789623-1789641, mismatch: 0, identity: 1.0

gccttgaggtccagtagcg	CRISPR spacer
gccttgaggtccagtagcg	Protospacer
*******************

46. spacer 3.8|1791144|19|NZ_CP018931|CRT matches to position: 1790460-1790478, mismatch: 0, identity: 1.0

gccttgaggtccagtagcg	CRISPR spacer
gccttgaggtccagtagcg	Protospacer
*******************

47. spacer 3.8|1791144|19|NZ_CP018931|CRT matches to position: 1790595-1790613, mismatch: 0, identity: 1.0

gccttgaggtccagtagcg	CRISPR spacer
gccttgaggtccagtagcg	Protospacer
*******************

48. spacer 3.8|1791144|19|NZ_CP018931|CRT matches to position: 1791189-1791207, mismatch: 0, identity: 1.0

gccttgaggtccagtagcg	CRISPR spacer
gccttgaggtccagtagcg	Protospacer
*******************

49. spacer 1.8|817500|18|NZ_CP018931|CRT matches to position: 815889-815906, mismatch: 1, identity: 0.944

caaccggagaaacaggtc	CRISPR spacer
caacgggagaaacaggtc	Protospacer
**** *************

50. spacer 1.8|817500|18|NZ_CP018931|CRT matches to position: 816681-816698, mismatch: 1, identity: 0.944

caaccggagaaacaggtc	CRISPR spacer
caacaggagaaacaggtc	Protospacer
**** *************

51. spacer 1.8|817500|18|NZ_CP018931|CRT matches to position: 817050-817067, mismatch: 1, identity: 0.944

caaccggagaaacaggtc	CRISPR spacer
caacaggagaaacaggtc	Protospacer
**** *************

52. spacer 1.8|817500|18|NZ_CP018931|CRT matches to position: 817905-817922, mismatch: 1, identity: 0.944

caaccggagaaacaggtc	CRISPR spacer
caacaggagaaacaggtc	Protospacer
**** *************

53. spacer 1.8|817500|18|NZ_CP018931|CRT matches to position: 818013-818030, mismatch: 1, identity: 0.944

caaccggagaaacaggtc	CRISPR spacer
caacaggagaaacaggtc	Protospacer
**** *************

54. spacer 1.8|817500|18|NZ_CP018931|CRT matches to position: 818607-818624, mismatch: 1, identity: 0.944

caaccggagaaacaggtc	CRISPR spacer
caacaggagaaacaggtc	Protospacer
**** *************

55. spacer 1.12|817653|36|NZ_CP018931|CRT matches to position: 816528-816563, mismatch: 1, identity: 0.972

taacaggaagtactggggtaacaggaagtacgggtc	CRISPR spacer
taacaggaaatactggggtaacaggaagtacgggtc	Protospacer
*********.**************************

56. spacer 1.13|817707|18|NZ_CP018931|CRT matches to position: 815313-815330, mismatch: 1, identity: 0.944

caacaggaagtacgggag	CRISPR spacer
caacgggaagtacgggag	Protospacer
****.*************

57. spacer 1.13|817707|18|NZ_CP018931|CRT matches to position: 815592-815609, mismatch: 1, identity: 0.944

caacaggaagtacgggag	CRISPR spacer
caacgggaagtacgggag	Protospacer
****.*************

58. spacer 1.13|817707|18|NZ_CP018931|CRT matches to position: 815691-815708, mismatch: 1, identity: 0.944

caacaggaagtacgggag	CRISPR spacer
caacaggaaatacgggag	Protospacer
*********.********

59. spacer 1.13|817707|18|NZ_CP018931|CRT matches to position: 815907-815924, mismatch: 1, identity: 0.944

caacaggaagtacgggag	CRISPR spacer
caacgggaagtacgggag	Protospacer
****.*************

60. spacer 1.13|817707|18|NZ_CP018931|CRT matches to position: 816087-816104, mismatch: 1, identity: 0.944

caacaggaagtacgggag	CRISPR spacer
caacgggaagtacgggag	Protospacer
****.*************

61. spacer 1.13|817707|18|NZ_CP018931|CRT matches to position: 816240-816257, mismatch: 1, identity: 0.944

caacaggaagtacgggag	CRISPR spacer
caacgggaagtacgggag	Protospacer
****.*************

62. spacer 1.13|817707|18|NZ_CP018931|CRT matches to position: 816330-816347, mismatch: 1, identity: 0.944

caacaggaagtacgggag	CRISPR spacer
caacgggaagtacgggag	Protospacer
****.*************

63. spacer 1.13|817707|18|NZ_CP018931|CRT matches to position: 816492-816509, mismatch: 1, identity: 0.944

caacaggaagtacgggag	CRISPR spacer
caacgggaagtacgggag	Protospacer
****.*************

64. spacer 1.13|817707|18|NZ_CP018931|CRT matches to position: 816699-816716, mismatch: 1, identity: 0.944

caacaggaagtacgggag	CRISPR spacer
caacgggaagtacgggag	Protospacer
****.*************

65. spacer 1.13|817707|18|NZ_CP018931|CRT matches to position: 816861-816878, mismatch: 1, identity: 0.944

caacaggaagtacgggag	CRISPR spacer
caacaggaagcacgggag	Protospacer
**********.*******

66. spacer 1.13|817707|18|NZ_CP018931|CRT matches to position: 816978-816995, mismatch: 1, identity: 0.944

caacaggaagtacgggag	CRISPR spacer
caacaggaaatacgggag	Protospacer
*********.********

67. spacer 1.13|817707|18|NZ_CP018931|CRT matches to position: 818031-818048, mismatch: 1, identity: 0.944

caacaggaagtacgggag	CRISPR spacer
caacgggaagtacgggag	Protospacer
****.*************

68. spacer 1.13|817707|18|NZ_CP018931|CRT matches to position: 818319-818336, mismatch: 1, identity: 0.944

caacaggaagtacgggag	CRISPR spacer
caacgggaagtacgggag	Protospacer
****.*************

69. spacer 1.13|817707|18|NZ_CP018931|CRT matches to position: 818409-818426, mismatch: 1, identity: 0.944

caacaggaagtacgggag	CRISPR spacer
caacaggaaatacgggag	Protospacer
*********.********

70. spacer 1.13|817707|18|NZ_CP018931|CRT matches to position: 818625-818642, mismatch: 1, identity: 0.944

caacaggaagtacgggag	CRISPR spacer
caacgggaagtacgggag	Protospacer
****.*************

71. spacer 1.13|817707|18|NZ_CP018931|CRT matches to position: 818787-818804, mismatch: 1, identity: 0.944

caacaggaagtacgggag	CRISPR spacer
caacaggaaatacgggag	Protospacer
*********.********

72. spacer 1.14|817743|18|NZ_CP018931|CRT matches to position: 816861-816878, mismatch: 1, identity: 0.944

caacaggaagcatgggag	CRISPR spacer
caacaggaagcacgggag	Protospacer
************.*****

73. spacer 1.15|817779|18|NZ_CP018931|CRT matches to position: 815619-815636, mismatch: 1, identity: 0.944

caaccggaagcaccgggg	CRISPR spacer
caacaggaagcaccgggg	Protospacer
**** *************

74. spacer 1.15|817779|18|NZ_CP018931|CRT matches to position: 815853-815870, mismatch: 1, identity: 0.944

caaccggaagcaccgggg	CRISPR spacer
caacgggaagcaccgggg	Protospacer
**** *************

75. spacer 1.15|817779|18|NZ_CP018931|CRT matches to position: 816366-816383, mismatch: 1, identity: 0.944

caaccggaagcaccgggg	CRISPR spacer
caacaggaagcaccgggg	Protospacer
**** *************

76. spacer 1.15|817779|18|NZ_CP018931|CRT matches to position: 816771-816788, mismatch: 1, identity: 0.944

caaccggaagcaccgggg	CRISPR spacer
caacaggaagcaccgggg	Protospacer
**** *************

77. spacer 1.15|817779|18|NZ_CP018931|CRT matches to position: 816825-816842, mismatch: 1, identity: 0.944

caaccggaagcaccgggg	CRISPR spacer
caacaggaagcaccgggg	Protospacer
**** *************

78. spacer 1.15|817779|18|NZ_CP018931|CRT matches to position: 816942-816959, mismatch: 1, identity: 0.944

caaccggaagcaccgggg	CRISPR spacer
caacaggaagcaccgggg	Protospacer
**** *************

79. spacer 1.15|817779|18|NZ_CP018931|CRT matches to position: 818103-818120, mismatch: 1, identity: 0.944

caaccggaagcaccgggg	CRISPR spacer
caacaggaagcaccgggg	Protospacer
**** *************

80. spacer 3.2|1790856|19|NZ_CP018931|CRT matches to position: 1789407-1789425, mismatch: 1, identity: 0.947

accctgaggtccagtagcg	CRISPR spacer
accttgaggtccagtagcg	Protospacer
***.***************

81. spacer 3.2|1790856|19|NZ_CP018931|CRT matches to position: 1789938-1789956, mismatch: 1, identity: 0.947

accctgaggtccagtagcg	CRISPR spacer
accttgaggtccagtagcg	Protospacer
***.***************

82. spacer 3.2|1790856|19|NZ_CP018931|CRT matches to position: 1790505-1790523, mismatch: 1, identity: 0.947

accctgaggtccagtagcg	CRISPR spacer
accttgaggtccagtagcg	Protospacer
***.***************

83. spacer 3.2|1790856|19|NZ_CP018931|CRT matches to position: 1790730-1790748, mismatch: 1, identity: 0.947

accctgaggtccagtagcg	CRISPR spacer
accttgaggtccagtagcg	Protospacer
***.***************

84. spacer 3.2|1790856|19|NZ_CP018931|CRT matches to position: 3887247-3887265, mismatch: 1, identity: 0.947

accctgaggtccagtagcg	CRISPR spacer
accttgaggtccagtagcg	Protospacer
***.***************

85. spacer 3.2|1790856|19|NZ_CP018931|CRT matches to position: 3887292-3887310, mismatch: 1, identity: 0.947

accctgaggtccagtagcg	CRISPR spacer
accttgaggtccagtagcg	Protospacer
***.***************

86. spacer 3.2|1790856|19|NZ_CP018931|CRT matches to position: 3887562-3887580, mismatch: 1, identity: 0.947

accctgaggtccagtagcg	CRISPR spacer
accttgaggtccagtagcg	Protospacer
***.***************

87. spacer 3.2|1790856|19|NZ_CP018931|CRT matches to position: 3887607-3887625, mismatch: 1, identity: 0.947

accctgaggtccagtagcg	CRISPR spacer
accttgaggtccagtagcg	Protospacer
***.***************

88. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to position: 1790253-1790280, mismatch: 1, identity: 0.964

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgaggtccagtagcaccagtagca	Protospacer
********************* ******

89. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to position: 1790253-1790280, mismatch: 1, identity: 0.964

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgaggtccagtagcaccagtagca	Protospacer
********************* ******

90. spacer 3.7|1791099|19|NZ_CP018931|CRT matches to position: 1790685-1790703, mismatch: 1, identity: 0.947

gccttgaggtccagtggca	CRISPR spacer
gccttgaggtccagtagca	Protospacer
***************.***

91. spacer 3.7|1791099|19|NZ_CP018931|CRT matches to position: 1791522-1791540, mismatch: 1, identity: 0.947

gccttgaggtccagtggca	CRISPR spacer
gccttgaggtccagtgaca	Protospacer
****************.**

92. spacer 1.1|817104|36|NZ_CP018931|CRT matches to position: 815484-815519, mismatch: 2, identity: 0.944

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caacaggagaaacgggagtaacaggaagtactgggg	Protospacer
****************** *********.*******

93. spacer 1.1|817104|36|NZ_CP018931|CRT matches to position: 816735-816770, mismatch: 2, identity: 0.944

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caacaggagaaacgggaggaacaggaagtacagggg	Protospacer
****************************.** ****

94. spacer 1.1|817104|36|NZ_CP018931|CRT matches to position: 818067-818102, mismatch: 2, identity: 0.944

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caacaggagaaacgggagtaacaggaagtactgggg	Protospacer
****************** *********.*******

95. spacer 1.1|817104|36|NZ_CP018931|CRT matches to position: 818175-818210, mismatch: 2, identity: 0.944

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caataggagaaacgggaggaacaggaagtactgggg	Protospacer
***.************************.*******

96. spacer 1.1|817104|36|NZ_CP018931|CRT matches to position: 818517-818552, mismatch: 2, identity: 0.944

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caacaggagaaacgggagcaacaggaagtactgggg	Protospacer
****************** *********.*******

97. spacer 1.7|817446|36|NZ_CP018931|CRT matches to position: 816924-816959, mismatch: 2, identity: 0.944

caaccggagaaacgggtccaaccggaagcaccgggg	CRISPR spacer
caacaggagaaacgggtccaacaggaagcaccgggg	Protospacer
**** ***************** *************

98. spacer 1.12|817653|36|NZ_CP018931|CRT matches to position: 815502-815537, mismatch: 2, identity: 0.944

taacaggaagtactggggtaacaggaagtacgggtc	CRISPR spacer
taacaggaagtactggggtaacaggaaacacgggtc	Protospacer
***************************..*******

99. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to position: 1791225-1791252, mismatch: 2, identity: 0.929

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgaggtccagtggcaccagtagca	Protospacer
***************.***** ******

100. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to position: 1791225-1791252, mismatch: 2, identity: 0.929

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgaggtccagtggcaccagtagca	Protospacer
***************.***** ******

101. spacer 3.7|1791099|19|NZ_CP018931|CRT matches to position: 1789848-1789866, mismatch: 2, identity: 0.895

gccttgaggtccagtggca	CRISPR spacer
gccttgaggtccggtagca	Protospacer
************.**.***

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131075-131101	2	0.926
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68871-68897	2	0.926
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68934-68960	2	0.926
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131084-131110	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321784-321810	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321820-321846	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	327-353	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	363-389	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68781-68807	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68790-68816	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68799-68825	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68808-68834	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68817-68843	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68826-68852	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68835-68861	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68844-68870	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68853-68879	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68862-68888	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73983-74009	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90221-90247	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90230-90256	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90239-90265	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90248-90274	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90257-90283	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90266-90292	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90275-90301	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130583-130609	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130592-130618	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130601-130627	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130610-130636	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130637-130663	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130664-130690	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130673-130699	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130682-130708	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130691-130717	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130700-130726	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130709-130735	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130718-130744	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130727-130753	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68970-68996	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	MN693798	Marine virus AFVG_250M119, complete genome	11468-11494	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	472792-472818	3	0.889
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	132554-132580	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321739-321765	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321748-321774	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321847-321873	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321883-321909	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321892-321918	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321919-321945	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	102-128	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	129-155	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	138-164	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	174-200	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	201-227	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	228-254	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	237-263	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	273-299	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	300-326	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	399-425	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	408-434	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68916-68942	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68925-68951	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73974-74000	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130574-130600	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130736-130762	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130745-130771	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130754-130780	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130763-130789	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130772-130798	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NC_006869	Bacillus mycoides pSin9.7 plasmid	8650-8676	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	KF437907	Phormidium phage MIS-PhV1A, complete genome	8754-8780	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173150-173176	4	0.852
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	MT820023	Cryophage ML09, complete genome	21058-21084	4	0.852
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	MN163280	Klebsiella phage KpGranit, complete genome	83363-83390	4	0.857
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	MN163280	Klebsiella phage KpGranit, complete genome	84566-84593	4	0.857
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	MT380195	Klebsiella phage KP_LZD_B01, complete genome	83705-83732	4	0.857
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	88210-88237	4	0.857
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2039-2066	4	0.857
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	MN163280	Klebsiella phage KpGranit, complete genome	83363-83390	4	0.857
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	MN163280	Klebsiella phage KpGranit, complete genome	84566-84593	4	0.857
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	MT380195	Klebsiella phage KP_LZD_B01, complete genome	83705-83732	4	0.857
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	88210-88237	4	0.857
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2039-2066	4	0.857
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321793-321819	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321829-321855	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321856-321882	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321901-321927	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321928-321954	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	120-146	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	165-191	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	192-218	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	219-245	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	264-290	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	291-317	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	318-344	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	354-380	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	93-119	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71346-71372	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73911-73937	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130628-130654	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130655-130681	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68772-68798	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68907-68933	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	MN693798	Marine virus AFVG_250M119, complete genome	11477-11503	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP038597	Salmonella enterica subsp. enterica serovar Hadar strain 12-2388 plasmid p12-2388.2, complete sequence	12820-12846	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP038592	Salmonella enterica subsp. enterica serovar Senftenberg strain SA20061017 plasmid pSA20061017, complete sequence	11906-11932	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP038594	Salmonella enterica subsp. enterica serovar Senftenberg strain SA20130280 plasmid pSA20130280.1, complete sequence	11906-11932	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP038602	Salmonella enterica subsp. enterica serovar Senftenberg strain 11-5006 plasmid p11-5006.1, complete sequence	10982-11008	5	0.815
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	MN694697	Marine virus AFVG_250M792, complete genome	19466-19492	5	0.815
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3978-4005	5	0.821
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29500-29527	5	0.821
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76457-76484	5	0.821
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80962-80989	5	0.821
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	GU323708	Lactobacillus phage phiPYB5, complete genome	19360-19387	5	0.821
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	MN693189	Marine virus AFVG_25M326, complete genome	18912-18939	5	0.821
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1994-2021	5	0.821
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	MN694491	Marine virus AFVG_250M564, complete genome	18777-18804	5	0.821
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KR296684	UNVERIFIED: Salmonella phage 19, complete genome	10709-10736	5	0.821
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	NC_029072	Salmonella phage 19, complete genome	10709-10736	5	0.821
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KR296695	UNVERIFIED: Salmonella phage 41, complete genome	10717-10744	5	0.821
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	JX181824	Salmonella phage SSE-121, complete genome	15287-15314	5	0.821
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	GU070616	Salmonella phage PVP-SE1, complete genome	52021-52048	5	0.821
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3978-4005	5	0.821
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29500-29527	5	0.821
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76457-76484	5	0.821
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80962-80989	5	0.821
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	GU323708	Lactobacillus phage phiPYB5, complete genome	19360-19387	5	0.821
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	MN693189	Marine virus AFVG_25M326, complete genome	18912-18939	5	0.821
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1994-2021	5	0.821
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	MN694491	Marine virus AFVG_250M564, complete genome	18777-18804	5	0.821
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KR296684	UNVERIFIED: Salmonella phage 19, complete genome	10709-10736	5	0.821
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	NC_029072	Salmonella phage 19, complete genome	10709-10736	5	0.821
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KR296695	UNVERIFIED: Salmonella phage 41, complete genome	10717-10744	5	0.821
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	JX181824	Salmonella phage SSE-121, complete genome	15287-15314	5	0.821
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	GU070616	Salmonella phage PVP-SE1, complete genome	52021-52048	5	0.821
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71511-71537	6	0.778
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71556-71582	6	0.778
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90212-90238	6	0.778
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	NZ_CP039272	Salmonella enterica subsp. enterica serovar Senftenberg str. CFSAN004025 plasmid pCFSAN004025.2, complete sequence	4265-4291	6	0.778
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	MG945688	UNVERIFIED: Microviridae sp. isolate 1348-1711, complete genome	5353-5379	6	0.778
NZ_CP018931_1	1.10\|817572\|27\|NZ_CP018931\|CRT	817572-817598	27	AP014420	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C24-MedDCM-OCT-S43-C167, * SEQUENCING IN PROGRESS *, 5 ordered pieces	10318-10344	6	0.778
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	172880-172907	6	0.786
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	8862-8889	6	0.786
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9627-9654	6	0.786
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9915-9942	6	0.786
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9978-10005	6	0.786
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	10185-10212	6	0.786
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	10770-10797	6	0.786
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	10941-10968	6	0.786
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21041-21068	6	0.786
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21806-21833	6	0.786
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	22094-22121	6	0.786
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	22157-22184	6	0.786
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	22364-22391	6	0.786
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	22949-22976	6	0.786
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	23120-23147	6	0.786
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10617-10644	6	0.786
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10761-10788	6	0.786
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KT997873	Uncultured Mediterranean phage uvDeep-CGR2-KM21-C368, complete genome	19917-19944	6	0.786
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	MN693099	Marine virus AFVG_25M184, complete genome	13869-13896	6	0.786
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	MN694808	Marine virus AFVG_250M14, complete genome	26246-26273	6	0.786
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	MN693618	Marine virus AFVG_250M106, complete genome	26276-26303	6	0.786
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	172880-172907	6	0.786
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	8862-8889	6	0.786
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9627-9654	6	0.786
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9915-9942	6	0.786
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	9978-10005	6	0.786
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	10185-10212	6	0.786
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	10770-10797	6	0.786
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	10941-10968	6	0.786
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21041-21068	6	0.786
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	21806-21833	6	0.786
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	22094-22121	6	0.786
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	22157-22184	6	0.786
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	22364-22391	6	0.786
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	22949-22976	6	0.786
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	NZ_CP040338	Bacillus luti strain FJ plasmid unnamed2, complete sequence	23120-23147	6	0.786
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10617-10644	6	0.786
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	NC_011771	Bacillus cereus AH820 plasmid pAH820_10, complete sequence	10761-10788	6	0.786
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KT997873	Uncultured Mediterranean phage uvDeep-CGR2-KM21-C368, complete genome	19917-19944	6	0.786
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	MN693099	Marine virus AFVG_25M184, complete genome	13869-13896	6	0.786
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	MN694808	Marine virus AFVG_250M14, complete genome	26246-26273	6	0.786
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	MN693618	Marine virus AFVG_250M106, complete genome	26276-26303	6	0.786
NZ_CP018931_5	5.1\|3247851\|28\|NZ_CP018931\|CRT	3247851-3247878	28	NZ_CP014361	Methylomonas sp. DH-1 plasmid, complete sequence	191451-191478	6	0.786
NZ_CP018931_5	5.1\|3247851\|28\|NZ_CP018931\|CRT	3247851-3247878	28	NC_018680	Alteromonas macleodii str. 'Balearic Sea AD45' plasmid pAMBAS45, complete sequence	28734-28761	6	0.786
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321829-321864	7	0.806
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321856-321891	7	0.806
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321874-321909	7	0.806
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321901-321936	7	0.806
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	111-146	7	0.806
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	138-173	7	0.806
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	156-191	7	0.806
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	183-218	7	0.806
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	210-245	7	0.806
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	237-272	7	0.806
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	255-290	7	0.806
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	282-317	7	0.806
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	309-344	7	0.806
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68916-68951	7	0.806
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73974-74009	7	0.806
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130745-130780	7	0.806
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019095	Synechococcus phage ACG-2014f isolate Syn7803US34, complete genome	212626-212653	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019086	Synechococcus phage ACG-2014f isolate Syn7803US17, complete genome	217266-217293	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019106	Synechococcus phage ACG-2014f isolate Syn7803US50, complete genome	213838-213865	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019107	Synechococcus phage ACG-2014f isolate Syn7803US52, complete genome	208692-208719	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019143	Synechococcus phage ACG-2014f isolate Syn7803C12, complete genome	214343-214370	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019103	Synechococcus phage ACG-2014f isolate Syn7803US44, complete genome	208940-208967	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019102	Synechococcus phage ACG-2014f isolate Syn7803US43, complete genome	215794-215821	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019066	Synechococcus phage ACG-2014f isolate Syn7803C9, complete genome	206786-206813	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019142	Synechococcus phage ACG-2014f isolate Syn7803C11, complete genome	213638-213665	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019149	Synechococcus phage ACG-2014f isolate Syn7803C21, complete genome	213342-213369	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019105	Synechococcus phage ACG-2014f isolate Syn7803US4, complete genome	205948-205975	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019098	Synechococcus phage ACG-2014f isolate Syn7803US39, complete genome	213786-213813	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019159	Synechococcus phage ACG-2014f isolate Syn7803C34, complete genome	215952-215979	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019123	Synechococcus phage ACG-2014f isolate Syn7803US7, complete genome	210939-210966	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019111	Synechococcus phage ACG-2014f isolate Syn7803US57, complete genome	212941-212968	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019148	Synechococcus phage ACG-2014f isolate Syn7803C19, complete genome	205546-205573	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	NC_047712	Synechococcus phage ACG-2014f isolate Syn7803C7, complete genome	206545-206572	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019090	Synechococcus phage ACG-2014f isolate Syn7803US24, complete genome	215951-215978	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019146	Synechococcus phage ACG-2014f isolate Syn7803C16, complete genome	216437-216464	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019152	Synechococcus phage ACG-2014f isolate Syn7803C25, complete genome	211816-211843	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019093	Synechococcus phage ACG-2014f isolate Syn7803US30, complete genome	212525-212552	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019151	Synechococcus phage ACG-2014f isolate Syn7803C24, complete genome	215332-215359	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019150	Synechococcus phage ACG-2014f isolate Syn7803C22, complete genome	217555-217582	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	NC_026927	Synechococcus phage ACG-2014f isolate Syn7803C90, complete genome	218057-218084	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019097	Synechococcus phage ACG-2014f isolate Syn7803US37, complete genome	211660-211687	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019045	Synechococcus phage ACG-2014f isolate Syn7803C6, complete genome	216575-216602	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019037	Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome	216078-216105	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019099	Synechococcus phage ACG-2014f isolate Syn7803US3, complete genome	209171-209198	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019155	Synechococcus phage ACG-2014f isolate Syn7803C29, complete genome	212986-213013	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019141	Synechococcus phage ACG-2014f isolate Syn7803C10, complete genome	212463-212490	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019053	Synechococcus phage ACG-2014f isolate Syn7803C80, complete genome	216410-216437	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019147	Synechococcus phage ACG-2014f isolate Syn7803C17, complete genome	212771-212798	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019100	Synechococcus phage ACG-2014f isolate Syn7803US40, complete genome	206722-206749	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019101	Synechococcus phage ACG-2014f isolate Syn7803US42, complete genome	207510-207537	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019085	Synechococcus phage ACG-2014f isolate Syn7803US13, complete genome	212743-212770	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019096	Synechococcus phage ACG-2014f isolate Syn7803US36, complete genome	210778-210805	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019144	Synechococcus phage ACG-2014f isolate Syn7803C14, complete genome	205770-205797	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019145	Synechococcus phage ACG-2014f isolate Syn7803C15, complete genome	216194-216221	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019058	Synechococcus phage ACG-2014f isolate Syn7803C8, complete genome	213644-213671	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	KJ019092	Synechococcus phage ACG-2014f isolate Syn7803US2, complete genome	215381-215408	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	MK448998	Streptococcus phage Javan636, complete genome	35463-35490	7	0.75
NZ_CP018931_3	3.3\|1790901\|28\|NZ_CP018931\|CRT	1790901-1790928	28	MK448821	Streptococcus phage Javan623, complete genome	30477-30504	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019095	Synechococcus phage ACG-2014f isolate Syn7803US34, complete genome	212626-212653	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019086	Synechococcus phage ACG-2014f isolate Syn7803US17, complete genome	217266-217293	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019106	Synechococcus phage ACG-2014f isolate Syn7803US50, complete genome	213838-213865	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019107	Synechococcus phage ACG-2014f isolate Syn7803US52, complete genome	208692-208719	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019143	Synechococcus phage ACG-2014f isolate Syn7803C12, complete genome	214343-214370	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019103	Synechococcus phage ACG-2014f isolate Syn7803US44, complete genome	208940-208967	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019102	Synechococcus phage ACG-2014f isolate Syn7803US43, complete genome	215794-215821	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019066	Synechococcus phage ACG-2014f isolate Syn7803C9, complete genome	206786-206813	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019142	Synechococcus phage ACG-2014f isolate Syn7803C11, complete genome	213638-213665	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019149	Synechococcus phage ACG-2014f isolate Syn7803C21, complete genome	213342-213369	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019105	Synechococcus phage ACG-2014f isolate Syn7803US4, complete genome	205948-205975	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019098	Synechococcus phage ACG-2014f isolate Syn7803US39, complete genome	213786-213813	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019159	Synechococcus phage ACG-2014f isolate Syn7803C34, complete genome	215952-215979	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019123	Synechococcus phage ACG-2014f isolate Syn7803US7, complete genome	210939-210966	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019111	Synechococcus phage ACG-2014f isolate Syn7803US57, complete genome	212941-212968	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019148	Synechococcus phage ACG-2014f isolate Syn7803C19, complete genome	205546-205573	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	NC_047712	Synechococcus phage ACG-2014f isolate Syn7803C7, complete genome	206545-206572	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019090	Synechococcus phage ACG-2014f isolate Syn7803US24, complete genome	215951-215978	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019146	Synechococcus phage ACG-2014f isolate Syn7803C16, complete genome	216437-216464	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019152	Synechococcus phage ACG-2014f isolate Syn7803C25, complete genome	211816-211843	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019093	Synechococcus phage ACG-2014f isolate Syn7803US30, complete genome	212525-212552	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019151	Synechococcus phage ACG-2014f isolate Syn7803C24, complete genome	215332-215359	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019150	Synechococcus phage ACG-2014f isolate Syn7803C22, complete genome	217555-217582	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	NC_026927	Synechococcus phage ACG-2014f isolate Syn7803C90, complete genome	218057-218084	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019097	Synechococcus phage ACG-2014f isolate Syn7803US37, complete genome	211660-211687	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019045	Synechococcus phage ACG-2014f isolate Syn7803C6, complete genome	216575-216602	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019037	Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome	216078-216105	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019099	Synechococcus phage ACG-2014f isolate Syn7803US3, complete genome	209171-209198	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019155	Synechococcus phage ACG-2014f isolate Syn7803C29, complete genome	212986-213013	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019141	Synechococcus phage ACG-2014f isolate Syn7803C10, complete genome	212463-212490	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019053	Synechococcus phage ACG-2014f isolate Syn7803C80, complete genome	216410-216437	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019147	Synechococcus phage ACG-2014f isolate Syn7803C17, complete genome	212771-212798	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019100	Synechococcus phage ACG-2014f isolate Syn7803US40, complete genome	206722-206749	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019101	Synechococcus phage ACG-2014f isolate Syn7803US42, complete genome	207510-207537	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019085	Synechococcus phage ACG-2014f isolate Syn7803US13, complete genome	212743-212770	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019096	Synechococcus phage ACG-2014f isolate Syn7803US36, complete genome	210778-210805	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019144	Synechococcus phage ACG-2014f isolate Syn7803C14, complete genome	205770-205797	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019145	Synechococcus phage ACG-2014f isolate Syn7803C15, complete genome	216194-216221	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019058	Synechococcus phage ACG-2014f isolate Syn7803C8, complete genome	213644-213671	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	KJ019092	Synechococcus phage ACG-2014f isolate Syn7803US2, complete genome	215381-215408	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	MK448998	Streptococcus phage Javan636, complete genome	35463-35490	7	0.75
NZ_CP018931_3	3.5\|1791000\|28\|NZ_CP018931\|CRT	1791000-1791027	28	MK448821	Streptococcus phage Javan623, complete genome	30477-30504	7	0.75
NZ_CP018931_1	1.1\|817104\|36\|NZ_CP018931\|CRT	817104-817139	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130772-130807	8	0.778

1. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 2, identity: 0.926

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggac	Protospacer
****************** ****** *

2. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacagggc	Protospacer
****************** ****** *

3. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacagggc	Protospacer
****************** ****** *

4. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

5. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

6. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagtaacaggag	Protospacer
****************** ******

7. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagtaacaggag	Protospacer
****************** ******

8. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

9. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

10. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

11. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

12. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

13. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

14. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

15. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

16. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

17. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

18. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

19. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacgggagcaacaggagaaacaggag	Protospacer
****.********************

20. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

21. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

22. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

23. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

24. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

25. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

26. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

27. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

28. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

29. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

30. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagaagcaggag	Protospacer
********************.****

31. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagaagcaggag	Protospacer
********************.****

32. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

33. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

34. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

35. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

36. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

37. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

38. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

39. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

40. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
cgacaggagcaacaggagcatcaggtc	Protospacer
*.**************** * ******

41. spacer 1.10|817572|27|NZ_CP018931|CRT matches to MN693798 (Marine virus AFVG_250M119, complete genome) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacaggag	Protospacer
****************** ******

42. spacer 1.10|817572|27|NZ_CP018931|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.889

caacaggagcaacaggagaaacaggtc	CRISPR spacer
taacaggagcaacgggagtaacaggtc	Protospacer
.************.**** ********

43. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
gaacaggggcaacaggagcaacaggac	Protospacer
 ******.********** ****** *

44. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacgggagcaacaggag	Protospacer
*************.**** ******

45. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacgggag	Protospacer
****************** ***.**

46. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagtaacgggag	Protospacer
****************** ***.**

47. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacgggagcaacaggag	Protospacer
*************.**** ******

48. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacgggag	Protospacer
****************** ***.**

49. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagtaacgggag	Protospacer
****************** ***.**

50. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagtaacgggag	Protospacer
****************** ***.**

51. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacgggag	Protospacer
****************** ***.**

52. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacgggagcaacaggag	Protospacer
*************.**** ******

53. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagtaacgggag	Protospacer
****************** ***.**

54. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagtaacgggag	Protospacer
****************** ***.**

55. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacgggag	Protospacer
****************** ***.**

56. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacgggagcaacaggag	Protospacer
*************.**** ******

57. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagtaacgggag	Protospacer
****************** ***.**

58. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagtaacgggag	Protospacer
****************** ***.**

59. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacgggag	Protospacer
****************** ***.**

60. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacgggagcaacaggag	Protospacer
*************.**** ******

61. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacgggagcaacaggag	Protospacer
*************.**** ******

62. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacgggagcaacaggagcaacaggag	Protospacer
****.************* ******

63. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacgggagcaacaggag	Protospacer
*************.**** ******

64. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacgggagcaacaggagcaacaggag	Protospacer
****.************* ******

65. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacgggag	Protospacer
****************** ***.**

66. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacgggagcaacaggag	Protospacer
*************.**** ******

67. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacgggagcaacaggagcaacaggag	Protospacer
****.************* ******

68. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggagcaacgggag	Protospacer
****************** ***.**

69. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacgggagtaacaggag	Protospacer
*************.**** ******

70. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NC_006869 (Bacillus mycoides pSin9.7 plasmid) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggtccaacaggagaaacaggaa	Protospacer
*******  ****************

71. spacer 1.10|817572|27|NZ_CP018931|CRT matches to KF437907 (Phormidium phage MIS-PhV1A, complete genome) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caaaaggagcaacaggagcaacaggag	Protospacer
*** ************** ******

72. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
cgacgggagcaacaggagcaacaggcc	Protospacer
*.**.************* ******.*

73. spacer 1.10|817572|27|NZ_CP018931|CRT matches to MT820023 (Cryophage ML09, complete genome) position: , mismatch: 4, identity: 0.852

caacaggagcaacaggagaaacaggtc	CRISPR spacer
ctaaaggagcaacaggaaacacaggtc	Protospacer
* * *************.* *******

74. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.857

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgaggaccagtagcacctgtgtta	Protospacer
********* **************. .*

75. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.857

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgaggaccagtagcacctgtgtta	Protospacer
********* **************. .*

76. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.857

accctgaggtccagtagcacctgtagca	CRISPR spacer
tccctgcggtccagtagcaccagtagcg	Protospacer
 ***** ************** *****.

77. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.857

accctgaggtccagtagcacctgtagca	CRISPR spacer
tccctgcggtccagtagcaccagtagcg	Protospacer
 ***** ************** *****.

78. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.857

accctgaggtccagtagcacctgtagca	CRISPR spacer
accggtaggtccagtagcaccggtagca	Protospacer
***   *************** ******

79. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.857

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgaggaccagtagcacctgtgtta	Protospacer
********* **************. .*

80. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.857

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgaggaccagtagcacctgtgtta	Protospacer
********* **************. .*

81. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.857

accctgaggtccagtagcacctgtagca	CRISPR spacer
tccctgcggtccagtagcaccagtagcg	Protospacer
 ***** ************** *****.

82. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.857

accctgaggtccagtagcacctgtagca	CRISPR spacer
tccctgcggtccagtagcaccagtagcg	Protospacer
 ***** ************** *****.

83. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.857

accctgaggtccagtagcacctgtagca	CRISPR spacer
accggtaggtccagtagcaccggtagca	Protospacer
***   *************** ******

84. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
taacgggagcaacaggagcaacaggag	Protospacer
.***.************* ******

85. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
taacgggagcaacaggagcaacaggag	Protospacer
.***.************* ******

86. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
taacgggagcaacaggagcaacaggag	Protospacer
.***.************* ******

87. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
taacgggagcaacaggagcaacaggag	Protospacer
.***.************* ******

88. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
cgacgggagcaacaggagcaacaggag	Protospacer
*.**.************* ******

89. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
taacgggagcaacaggagcaacaggag	Protospacer
.***.************* ******

90. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
taacgggagcaacaggagcaacaggag	Protospacer
.***.************* ******

91. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
taacgggagcaacaggagcaacaggag	Protospacer
.***.************* ******

92. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
taacgggagcaacaggagcaacaggag	Protospacer
.***.************* ******

93. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
taacgggagcaacaggagcaacaggag	Protospacer
.***.************* ******

94. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
taacgggagcaacaggagcaacaggag	Protospacer
.***.************* ******

95. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
taacgggagcaacaggagcaacaggag	Protospacer
.***.************* ******

96. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
taacgggagcaacaggagcaacaggag	Protospacer
.***.************* ******

97. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
cgacgggagcaacaggagcaacaggag	Protospacer
*.**.************* ******

98. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
taacaggagtaacaggagcaacagggg	Protospacer
.********.******** ******

99. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
taaccggagcaacgggagaaacaggag	Protospacer
.*** ********.***********

100. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
aagcaggagcaacaggagcaacaggag	Protospacer
 *.*************** ******

101. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
aagcaggagcaacaggagcaacaggag	Protospacer
 *.*************** ******

102. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caggaggagcaacaggagcaacaggag	Protospacer
**. ************** ******

103. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
cgacaggagcaacaggagcaacgggag	Protospacer
*.**************** ***.**

104. spacer 1.10|817572|27|NZ_CP018931|CRT matches to MN693798 (Marine virus AFVG_250M119, complete genome) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
caacaggagcaacaggaggcacagtag	Protospacer
******************. ****

105. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP038597 (Salmonella enterica subsp. enterica serovar Hadar strain 12-2388 plasmid p12-2388.2, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
gaacaggagcaacagcataaacaggaa	Protospacer
 ************** * *******

106. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP038592 (Salmonella enterica subsp. enterica serovar Senftenberg strain SA20061017 plasmid pSA20061017, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
gaacaggagcaacagcataaacaggaa	Protospacer
 ************** * *******

107. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP038594 (Salmonella enterica subsp. enterica serovar Senftenberg strain SA20130280 plasmid pSA20130280.1, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
gaacaggagcaacagcataaacaggaa	Protospacer
 ************** * *******

108. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP038602 (Salmonella enterica subsp. enterica serovar Senftenberg strain 11-5006 plasmid p11-5006.1, complete sequence) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
gaacaggagcaacagcataaacaggaa	Protospacer
 ************** * *******

109. spacer 1.10|817572|27|NZ_CP018931|CRT matches to MN694697 (Marine virus AFVG_250M792, complete genome) position: , mismatch: 5, identity: 0.815

caacaggagcaacaggagaaacaggtc	CRISPR spacer
acacaggagcaacaggagctacaggtg	Protospacer
  ****************  ******

110. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
tccttgaggtccagtagcaccagttgga	Protospacer
 **.***************** ** * *

111. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
tccttgaggtccagtagcaccagttgga	Protospacer
 **.***************** ** * *

112. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgaggaccagtagcaccagtgtta	Protospacer
********* *********** **. .*

113. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgaggaccagtagcaccagtgtta	Protospacer
********* *********** **. .*

114. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to GU323708 (Lactobacillus phage phiPYB5, complete genome) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
cccctgtggtccagtagcaccagtaggc	Protospacer
 ***** ************** ****

115. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
accttgaggtccagtagcaccttgaggt	Protospacer
***.******************  **

116. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
accggtaggtccagtagcaccggtagcg	Protospacer
***   *************** *****.

117. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to MN694491 (Marine virus AFVG_250M564, complete genome) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgagcgccagtagcacctgtgtct	Protospacer
********  **************. *

118. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KR296684 (UNVERIFIED: Salmonella phage 19, complete genome) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgcggtcctgtagcacctgccgga	Protospacer
****** ***** **********. * *

119. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to NC_029072 (Salmonella phage 19, complete genome) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgcggtcctgtagcacctgccgga	Protospacer
****** ***** **********. * *

120. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KR296695 (UNVERIFIED: Salmonella phage 41, complete genome) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgcggtcctgtagcacctgccgga	Protospacer
****** ***** **********. * *

121. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to JX181824 (Salmonella phage SSE-121, complete genome) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgtggtcctgtagcacctgcggga	Protospacer
****** ***** **********..* *

122. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to GU070616 (Salmonella phage PVP-SE1, complete genome) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgtggtcctgtagcacctgcggga	Protospacer
****** ***** **********..* *

123. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
tccttgaggtccagtagcaccagttgga	Protospacer
 **.***************** ** * *

124. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
tccttgaggtccagtagcaccagttgga	Protospacer
 **.***************** ** * *

125. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgaggaccagtagcaccagtgtta	Protospacer
********* *********** **. .*

126. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgaggaccagtagcaccagtgtta	Protospacer
********* *********** **. .*

127. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to GU323708 (Lactobacillus phage phiPYB5, complete genome) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
cccctgtggtccagtagcaccagtaggc	Protospacer
 ***** ************** ****

128. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
accttgaggtccagtagcaccttgaggt	Protospacer
***.******************  **

129. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
accggtaggtccagtagcaccggtagcg	Protospacer
***   *************** *****.

130. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to MN694491 (Marine virus AFVG_250M564, complete genome) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgagcgccagtagcacctgtgtct	Protospacer
********  **************. *

131. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KR296684 (UNVERIFIED: Salmonella phage 19, complete genome) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgcggtcctgtagcacctgccgga	Protospacer
****** ***** **********. * *

132. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to NC_029072 (Salmonella phage 19, complete genome) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgcggtcctgtagcacctgccgga	Protospacer
****** ***** **********. * *

133. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KR296695 (UNVERIFIED: Salmonella phage 41, complete genome) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgcggtcctgtagcacctgccgga	Protospacer
****** ***** **********. * *

134. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to JX181824 (Salmonella phage SSE-121, complete genome) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgtggtcctgtagcacctgcggga	Protospacer
****** ***** **********..* *

135. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to GU070616 (Salmonella phage PVP-SE1, complete genome) position: , mismatch: 5, identity: 0.821

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgtggtcctgtagcacctgcggga	Protospacer
****** ***** **********..* *

136. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

caacaggagcaacaggagaaacaggtc	CRISPR spacer
tgacaggagcaactggtgaaacaggag	Protospacer
..*********** ** ********

137. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

caacaggagcaacaggagaaacaggtc	CRISPR spacer
tgacaggagcaactggagcaacaggag	Protospacer
..*********** **** ******

138. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

caacaggagcaacaggagaaacaggtc	CRISPR spacer
ctggaggagcaacaggagcaacaggag	Protospacer
* . ************** ******

139. spacer 1.10|817572|27|NZ_CP018931|CRT matches to NZ_CP039272 (Salmonella enterica subsp. enterica serovar Senftenberg str. CFSAN004025 plasmid pCFSAN004025.2, complete sequence) position: , mismatch: 6, identity: 0.778

caacaggagcaacaggagaaacaggtc	CRISPR spacer
gaacaggagcaacagcataaacagaaa	Protospacer
 ************** * ******.

140. spacer 1.10|817572|27|NZ_CP018931|CRT matches to MG945688 (UNVERIFIED: Microviridae sp. isolate 1348-1711, complete genome) position: , mismatch: 6, identity: 0.778

caacaggagcaacaggagaaacaggtc	CRISPR spacer
taagaggagcaacaggagaagcagaag	Protospacer
.** ****************.***.

141. spacer 1.10|817572|27|NZ_CP018931|CRT matches to AP014420 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C24-MedDCM-OCT-S43-C167, *** SEQUENCING IN PROGRESS ***, 5 ordered pieces) position: , mismatch: 6, identity: 0.778

caacaggagcaacaggagaaacaggtc	CRISPR spacer
atatgggagcaacaggagcaacaggtg	Protospacer
  *..************* *******

142. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagcacctgtagat	Protospacer
 **.  ********************

143. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

144. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tccagtaggtccagtagctcctgtagct	Protospacer
 **   ************ ********

145. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

146. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

147. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

148. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

149. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

150. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

151. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tccagtaggtccagtagctcctgtagct	Protospacer
 **   ************ ********

152. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

153. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

154. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

155. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

156. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

157. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

158. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

159. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KT997873 (Uncultured Mediterranean phage uvDeep-CGR2-KM21-C368, complete genome) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tccagttggtccagtagcacctgttgca	Protospacer
 **    ***************** ***

160. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tccttgaggtccagtagcaccagttgat	Protospacer
 **.***************** ** *

161. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to MN694808 (Marine virus AFVG_250M14, complete genome) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgagttccagtagcaccatctaca	Protospacer
******** ************  . .**

162. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to MN693618 (Marine virus AFVG_250M106, complete genome) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgagttccagtagcaccatctaca	Protospacer
******** ************  . .**

163. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagcacctgtagat	Protospacer
 **.  ********************

164. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

165. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tccagtaggtccagtagctcctgtagct	Protospacer
 **   ************ ********

166. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

167. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

168. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

169. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

170. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

171. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

172. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tccagtaggtccagtagctcctgtagct	Protospacer
 **   ************ ********

173. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

174. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

175. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

176. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

177. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to NZ_CP040338 (Bacillus luti strain FJ plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

178. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

179. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to NC_011771 (Bacillus cereus AH820 plasmid pAH820_10, complete sequence) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tcctgtaggtccagtagctcctgtagct	Protospacer
 **.  ************ ********

180. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KT997873 (Uncultured Mediterranean phage uvDeep-CGR2-KM21-C368, complete genome) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tccagttggtccagtagcacctgttgca	Protospacer
 **    ***************** ***

181. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to MN693099 (Marine virus AFVG_25M184, complete genome) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
tccttgaggtccagtagcaccagttgat	Protospacer
 **.***************** ** *

182. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to MN694808 (Marine virus AFVG_250M14, complete genome) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgagttccagtagcaccatctaca	Protospacer
******** ************  . .**

183. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to MN693618 (Marine virus AFVG_250M106, complete genome) position: , mismatch: 6, identity: 0.786

accctgaggtccagtagcacctgtagca	CRISPR spacer
accctgagttccagtagcaccatctaca	Protospacer
******** ************  . .**

184. spacer 5.1|3247851|28|NZ_CP018931|CRT matches to NZ_CP014361 (Methylomonas sp. DH-1 plasmid, complete sequence) position: , mismatch: 6, identity: 0.786

ctttggttctggatccggatttggtttg	CRISPR spacer
agctggttgtggatccggatttggagtg	Protospacer
  .***** ***************  **

185. spacer 5.1|3247851|28|NZ_CP018931|CRT matches to NC_018680 (Alteromonas macleodii str. 'Balearic Sea AD45' plasmid pAMBAS45, complete sequence) position: , mismatch: 6, identity: 0.786

ctttggttctggatccggatttggtttg	CRISPR spacer
acttggctctggatgcggatttggtaag	Protospacer
 .****.******* **********  *

186. spacer 1.1|817104|36|NZ_CP018931|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 7, identity: 0.806

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caacaggagtaacgggagcaacaggagcaacaggag	Protospacer
********* ******** *******.  ** **.*

187. spacer 1.1|817104|36|NZ_CP018931|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 7, identity: 0.806

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caacaggagtaacgggagcaacaggagcaacaggag	Protospacer
********* ******** *******.  ** **.*

188. spacer 1.1|817104|36|NZ_CP018931|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 7, identity: 0.806

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caacaggagcaacgggagcaacaggagtaacgggag	Protospacer
********* ******** *******.  ** **.*

189. spacer 1.1|817104|36|NZ_CP018931|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 7, identity: 0.806

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caacaggagtaacgggagcaacaggagcaacaggag	Protospacer
********* ******** *******.  ** **.*

190. spacer 1.1|817104|36|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.806

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caacaggagtaacgggagcaacaggagcaacaggag	Protospacer
********* ******** *******.  ** **.*

191. spacer 1.1|817104|36|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.806

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caacaggagcaacgggagcaacaggagtaacgggag	Protospacer
********* ******** *******.  ** **.*

192. spacer 1.1|817104|36|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.806

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caacaggagtaacgggagcaacaggagcaacaggag	Protospacer
********* ******** *******.  ** **.*

193. spacer 1.1|817104|36|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.806

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caacaggagtaacgggagcaacaggagcaacaggag	Protospacer
********* ******** *******.  ** **.*

194. spacer 1.1|817104|36|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.806

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caacaggagtaacgggagcaacaggagcaacaggag	Protospacer
********* ******** *******.  ** **.*

195. spacer 1.1|817104|36|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.806

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caacaggagcaacgggagcaacaggagtaacgggag	Protospacer
********* ******** *******.  ** **.*

196. spacer 1.1|817104|36|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.806

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caacaggagtaacgggagcaacaggagcaacaggag	Protospacer
********* ******** *******.  ** **.*

197. spacer 1.1|817104|36|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.806

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caacaggagtaacgggagcaacaggagcaacaggag	Protospacer
********* ******** *******.  ** **.*

198. spacer 1.1|817104|36|NZ_CP018931|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.806

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caacaggagtaacgggagcaacaggagcaacaggag	Protospacer
********* ******** *******.  ** **.*

199. spacer 1.1|817104|36|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.806

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caacaggagcaacgggagcaacaggagcaacaggag	Protospacer
********* ******** *******.  ** **.*

200. spacer 1.1|817104|36|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.806

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caacaggagcaacgggagcaacaggagaaacaggag	Protospacer
********* ******** *******.. ** **.*

201. spacer 1.1|817104|36|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.806

caacaggagaaacgggaggaacaggaagcactgggg	CRISPR spacer
caacaggagcaacgggagcaacaggagcaacaggag	Protospacer
********* ******** *******.  ** **.*

202. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019095 (Synechococcus phage ACG-2014f isolate Syn7803US34, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

203. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019086 (Synechococcus phage ACG-2014f isolate Syn7803US17, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

204. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019106 (Synechococcus phage ACG-2014f isolate Syn7803US50, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

205. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019107 (Synechococcus phage ACG-2014f isolate Syn7803US52, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

206. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019143 (Synechococcus phage ACG-2014f isolate Syn7803C12, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

207. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019103 (Synechococcus phage ACG-2014f isolate Syn7803US44, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

208. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019102 (Synechococcus phage ACG-2014f isolate Syn7803US43, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

209. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019066 (Synechococcus phage ACG-2014f isolate Syn7803C9, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

210. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019142 (Synechococcus phage ACG-2014f isolate Syn7803C11, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

211. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019149 (Synechococcus phage ACG-2014f isolate Syn7803C21, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

212. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019105 (Synechococcus phage ACG-2014f isolate Syn7803US4, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

213. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019098 (Synechococcus phage ACG-2014f isolate Syn7803US39, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

214. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019159 (Synechococcus phage ACG-2014f isolate Syn7803C34, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

215. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019123 (Synechococcus phage ACG-2014f isolate Syn7803US7, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

216. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019111 (Synechococcus phage ACG-2014f isolate Syn7803US57, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

217. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019148 (Synechococcus phage ACG-2014f isolate Syn7803C19, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

218. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to NC_047712 (Synechococcus phage ACG-2014f isolate Syn7803C7, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

219. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019090 (Synechococcus phage ACG-2014f isolate Syn7803US24, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

220. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019146 (Synechococcus phage ACG-2014f isolate Syn7803C16, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

221. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019152 (Synechococcus phage ACG-2014f isolate Syn7803C25, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

222. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019093 (Synechococcus phage ACG-2014f isolate Syn7803US30, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

223. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019151 (Synechococcus phage ACG-2014f isolate Syn7803C24, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

224. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019150 (Synechococcus phage ACG-2014f isolate Syn7803C22, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

225. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to NC_026927 (Synechococcus phage ACG-2014f isolate Syn7803C90, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

226. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019097 (Synechococcus phage ACG-2014f isolate Syn7803US37, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

227. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019045 (Synechococcus phage ACG-2014f isolate Syn7803C6, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

228. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019037 (Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

229. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019099 (Synechococcus phage ACG-2014f isolate Syn7803US3, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

230. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019155 (Synechococcus phage ACG-2014f isolate Syn7803C29, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

231. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019141 (Synechococcus phage ACG-2014f isolate Syn7803C10, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

232. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019053 (Synechococcus phage ACG-2014f isolate Syn7803C80, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

233. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019147 (Synechococcus phage ACG-2014f isolate Syn7803C17, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

234. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019100 (Synechococcus phage ACG-2014f isolate Syn7803US40, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

235. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019101 (Synechococcus phage ACG-2014f isolate Syn7803US42, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

236. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019085 (Synechococcus phage ACG-2014f isolate Syn7803US13, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

237. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019096 (Synechococcus phage ACG-2014f isolate Syn7803US36, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

238. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019144 (Synechococcus phage ACG-2014f isolate Syn7803C14, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

239. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019145 (Synechococcus phage ACG-2014f isolate Syn7803C15, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

240. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019058 (Synechococcus phage ACG-2014f isolate Syn7803C8, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

241. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to KJ019092 (Synechococcus phage ACG-2014f isolate Syn7803US2, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

242. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to MK448998 (Streptococcus phage Javan636, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
tccttgaggtccagtagcaccttgttta	Protospacer
 **.******************    .*

243. spacer 3.3|1790901|28|NZ_CP018931|CRT matches to MK448821 (Streptococcus phage Javan623, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
tccttgaggtccagtagcaccttgttta	Protospacer
 **.******************    .*

244. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019095 (Synechococcus phage ACG-2014f isolate Syn7803US34, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

245. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019086 (Synechococcus phage ACG-2014f isolate Syn7803US17, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

246. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019106 (Synechococcus phage ACG-2014f isolate Syn7803US50, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

247. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019107 (Synechococcus phage ACG-2014f isolate Syn7803US52, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

248. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019143 (Synechococcus phage ACG-2014f isolate Syn7803C12, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

249. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019103 (Synechococcus phage ACG-2014f isolate Syn7803US44, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

250. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019102 (Synechococcus phage ACG-2014f isolate Syn7803US43, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

251. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019066 (Synechococcus phage ACG-2014f isolate Syn7803C9, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

252. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019142 (Synechococcus phage ACG-2014f isolate Syn7803C11, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

253. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019149 (Synechococcus phage ACG-2014f isolate Syn7803C21, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

254. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019105 (Synechococcus phage ACG-2014f isolate Syn7803US4, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

255. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019098 (Synechococcus phage ACG-2014f isolate Syn7803US39, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

256. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019159 (Synechococcus phage ACG-2014f isolate Syn7803C34, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

257. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019123 (Synechococcus phage ACG-2014f isolate Syn7803US7, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

258. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019111 (Synechococcus phage ACG-2014f isolate Syn7803US57, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

259. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019148 (Synechococcus phage ACG-2014f isolate Syn7803C19, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

260. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to NC_047712 (Synechococcus phage ACG-2014f isolate Syn7803C7, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

261. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019090 (Synechococcus phage ACG-2014f isolate Syn7803US24, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

262. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019146 (Synechococcus phage ACG-2014f isolate Syn7803C16, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

263. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019152 (Synechococcus phage ACG-2014f isolate Syn7803C25, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

264. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019093 (Synechococcus phage ACG-2014f isolate Syn7803US30, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

265. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019151 (Synechococcus phage ACG-2014f isolate Syn7803C24, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

266. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019150 (Synechococcus phage ACG-2014f isolate Syn7803C22, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

267. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to NC_026927 (Synechococcus phage ACG-2014f isolate Syn7803C90, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

268. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019097 (Synechococcus phage ACG-2014f isolate Syn7803US37, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

269. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019045 (Synechococcus phage ACG-2014f isolate Syn7803C6, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

270. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019037 (Synechococcus phage ACG-2014f isolate Syn7803C58, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

271. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019099 (Synechococcus phage ACG-2014f isolate Syn7803US3, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

272. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019155 (Synechococcus phage ACG-2014f isolate Syn7803C29, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

273. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019141 (Synechococcus phage ACG-2014f isolate Syn7803C10, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

274. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019053 (Synechococcus phage ACG-2014f isolate Syn7803C80, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

275. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019147 (Synechococcus phage ACG-2014f isolate Syn7803C17, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

276. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019100 (Synechococcus phage ACG-2014f isolate Syn7803US40, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

277. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019101 (Synechococcus phage ACG-2014f isolate Syn7803US42, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

278. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019085 (Synechococcus phage ACG-2014f isolate Syn7803US13, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

279. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019096 (Synechococcus phage ACG-2014f isolate Syn7803US36, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

280. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019144 (Synechococcus phage ACG-2014f isolate Syn7803C14, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

281. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019145 (Synechococcus phage ACG-2014f isolate Syn7803C15, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

282. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019058 (Synechococcus phage ACG-2014f isolate Syn7803C8, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

283. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to KJ019092 (Synechococcus phage ACG-2014f isolate Syn7803US2, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
aatggtaggtccagtagcacctgtagat	Protospacer
* .   ********************

284. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to MK448998 (Streptococcus phage Javan636, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
tccttgaggtccagtagcaccttgttta	Protospacer
 **.******************    .*

285. spacer 3.5|1791000|28|NZ_CP018931|CRT matches to MK448821 (Streptococcus phage Javan623, complete genome) position: , mismatch: 7, identity: 0.75

accctgaggtccagtagcacctgtagca	CRISPR spacer
tccttgaggtccagtagcaccttgttta	Protospacer
 **.******************    .*

286. spacer 1.1|817104|36|NZ_CP018931|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.778

caacaggagaaacgggaggaacagga--agcactgggg	CRISPR spacer
caacaggagcaacgggagtaacaggagcaacattat--	Protospacer
********* ******** *******  *.**.*.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2808042 : 2850342

Bacillus_phage(83.78%)

portal,tail,holin,bacteriocin,terminase,capsid,protease,head,integrase

attL 2834445:2834459|attR 2855534:2855548

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075666810.1\|2808042_2809107_-	N-acetylmuramoyl-L-alanine amidase	A0A0A7AQV3	Bacillus_phage	3.6e-192	91.5
WP_075666809.1\|2809103_2809343_-\|holin	holin	A0A2H4J378	uncultured_Caudovirales_phage	1.0e-30	91.1
WP_075666808.1\|2809342_2809579_-	hypothetical protein	A0A1B1P887	Bacillus_phage	2.5e-24	80.3
WP_075666807.1\|2809654_2810359_-	hypothetical protein	NA	NA	NA	NA
WP_075666806.1\|2810652_2814519_-	peptidase S74	Q2I8E8	Bacillus_phage	0.0e+00	87.1
WP_075395983.1\|2814515_2816006_-\|tail	phage tail protein	A0A288WFS2	Bacillus_phage	1.2e-289	98.4
WP_075395984.1\|2816020_2819872_-\|tail	phage tail tape measure protein	Q2I8F0	Bacillus_phage	0.0e+00	97.7
WP_000344052.1\|2819886_2820063_-	hypothetical protein	A0A288WFY6	Bacillus_phage	3.4e-15	100.0
WP_000779158.1\|2820092_2820410_-	hypothetical protein	A0A288WFU2	Bacillus_phage	3.2e-51	95.2
WP_000896772.1\|2820458_2821067_-\|tail	tail protein	A0A288WG55	Bacillus_phage	4.8e-104	99.0
WP_075395985.1\|2821067_2821427_-	DUF3168 domain-containing protein	A0A0S2GLE3	Bacillus_phage	1.0e-58	95.0
WP_075395986.1\|2821423_2821861_-	HK97 gp10 family phage protein	A0A288WGM7	Bacillus_phage	6.7e-76	98.6
WP_001068017.1\|2821853_2822177_-\|head	phage head closure protein	H0USW8	Bacillus_phage	7.0e-54	92.5
WP_000244595.1\|2822173_2822452_-\|head,tail	phage gp6-like head-tail connector protein	H0USW7	Bacillus_phage	9.9e-41	95.6
WP_075395987.1\|2822472_2823645_-\|capsid	phage major capsid protein	A0A2H4J387	uncultured_Caudovirales_phage	1.7e-198	93.1
WP_075395988.1\|2823682_2824393_-\|protease	Clp protease ClpP	W8CYT5	Bacillus_phage	7.5e-125	96.2
WP_075395989.1\|2824379_2825633_-\|portal	phage portal protein	A0A2H4J371	uncultured_Caudovirales_phage	6.1e-239	98.6
WP_075395990.1\|2825821_2827516_-\|terminase	terminase large subunit	A0A2H4JB98	uncultured_Caudovirales_phage	6.2e-312	99.3
WP_075396036.1\|2827517_2828012_-\|terminase	phage terminase small subunit P27 family	A0A2H4J8E3	uncultured_Caudovirales_phage	8.1e-86	98.8
WP_075395991.1\|2828129_2828528_-	HNH endonuclease	A0A0S2GLI5	Bacillus_phage	1.0e-59	97.3
WP_001198484.1\|2828517_2828772_-	hypothetical protein	A0A2H4J3B1	uncultured_Caudovirales_phage	1.3e-44	100.0
WP_075395992.1\|2828905_2829118_-	hypothetical protein	A0A1B1P8F3	Bacillus_phage	1.0e-29	98.6
WP_155119909.1\|2829114_2829270_-	hypothetical protein	NA	NA	NA	NA
WP_075395993.1\|2829439_2829766_-	hypothetical protein	NA	NA	NA	NA
WP_075395995.1\|2830484_2831030_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_075395996.1\|2831421_2832324_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_075395997.1\|2832531_2833074_-\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	2.5e-88	91.1
WP_075395998.1\|2833073_2833556_-	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	1.4e-71	82.5
WP_000645586.1\|2833860_2833983_-	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_075396000.1\|2834006_2834309_-	hypothetical protein	Q3HKX6	Bacillus_phage	1.3e-33	72.0
2834445:2834459	attL	NA	NA	NA	NA
WP_075396001.1\|2834797_2834992_-	hypothetical protein	NA	NA	NA	NA
WP_075396002.1\|2835263_2835470_+	hypothetical protein	NA	NA	NA	NA
WP_075396003.1\|2836045_2836273_-	hypothetical protein	A0A288WFX6	Bacillus_phage	6.0e-36	97.3
WP_075396004.1\|2836275_2836551_-	hypothetical protein	NA	NA	NA	NA
WP_075396005.1\|2836584_2836854_-	hypothetical protein	D2XR50	Bacillus_phage	1.4e-36	84.3
WP_075396006.1\|2837133_2839131_+	collagen-like repeat preface domain-containing protein	NA	NA	NA	NA
WP_075396037.1\|2839311_2839806_-	nucleoside triphosphate pyrophosphohydrolase family protein	A0A0U4IBD0	Bacillus_phage	3.1e-21	50.5
WP_075396007.1\|2839821_2840241_-	hypothetical protein	A0A1B1P8B9	Bacillus_phage	4.8e-15	43.0
WP_075396008.1\|2840253_2840508_-	hypothetical protein	A0A0U3SU43	Bacillus_phage	3.2e-38	91.7
WP_075396009.1\|2840522_2840696_-	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	4.7e-25	98.2
WP_075396010.1\|2840914_2841718_-	ATP-binding protein	A0A1B1P7U2	Bacillus_phage	5.6e-145	98.5
WP_139316691.1\|2841686_2842562_-	DnaD domain protein	A0A1B1P7T6	Bacillus_phage	3.7e-49	96.2
WP_075396013.1\|2842938_2843205_-	helix-turn-helix domain-containing protein	A0A0U3ULL9	Bacillus_phage	1.4e-28	76.5
WP_044792376.1\|2843261_2843453_-	helix-turn-helix transcriptional regulator	A0A0U3SLC2	Bacillus_phage	2.4e-22	85.2
WP_075396014.1\|2843669_2844023_+	helix-turn-helix transcriptional regulator	A0A0U3SD25	Bacillus_phage	3.2e-52	92.2
WP_075396015.1\|2844347_2844494_-	complement C1q protein	NA	NA	NA	NA
WP_075396016.1\|2844531_2845683_-	hypothetical protein	A0A1B0T6A5	Bacillus_phage	2.1e-52	32.8
WP_075666805.1\|2846323_2846803_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_075396017.1\|2847102_2848212_+\|integrase	site-specific integrase	A0A0U3U8Y8	Bacillus_phage	5.2e-149	79.1
WP_000413152.1\|2848280_2848952_-	DUF3962 domain-containing protein	NA	NA	NA	NA
WP_080496862.1\|2850132_2850342_-\|bacteriocin	heterocycloanthracin/sonorensin family bacteriocin	NA	NA	NA	NA
2855534:2855548	attR	NA	NA	NA	NA

DBSCAN-SWA_2

3132169 : 3138386

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_139316659.1\|3132169_3132754_-	hypothetical protein	A0A288WFQ7	Bacillus_phage	2.9e-82	77.5
WP_075395665.1\|3132731_3133922_-	cell division protein FtsK	A0A288WFS1	Bacillus_phage	2.9e-145	65.2
WP_075395666.1\|3134040_3134223_-	hypothetical protein	A0A288WGN6	Bacillus_phage	9.1e-19	76.7
WP_075395667.1\|3134219_3134522_-	hypothetical protein	H0USY0	Bacillus_phage	2.4e-24	54.6
WP_080496853.1\|3134705_3134924_+	helix-turn-helix transcriptional regulator	A0A0S2SXU5	Bacillus_phage	2.9e-11	52.3
WP_075395668.1\|3134920_3135505_-	restriction endonuclease	NA	NA	NA	NA
WP_075395669.1\|3135633_3136086_+	SHOCT domain-containing protein	B8R671	Lactobacillus_phage	3.6e-08	36.2
WP_075395670.1\|3136177_3137149_+	DUF91 domain-containing protein	NA	NA	NA	NA
WP_075395671.1\|3137265_3137862_-	hypothetical protein	NA	NA	NA	NA
WP_075395672.1\|3138032_3138386_+	YolD-like family protein	A0A2H4JEH6	uncultured_Caudovirales_phage	8.2e-08	29.6

DBSCAN-SWA_3

3447819 : 3456554

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075395549.1\|3447819_3448692_-	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	1.1e-66	45.9
WP_003158174.1\|3448834_3448948_-	hypothetical protein	W8CYT3	Bacillus_phage	1.6e-05	95.8
WP_000818985.1\|3449064_3449784_-	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_000823559.1\|3449979_3450567_+	DUF3139 domain-containing protein	NA	NA	NA	NA
WP_001231492.1\|3450591_3451665_-	HAMP domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	2.7e-171	88.2
WP_128294964.1\|3451661_3452348_-	response regulator transcription factor	W8CYM9	Bacillus_phage	8.5e-118	93.4
WP_000453764.1\|3452427_3454188_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.2e-266	95.5
WP_001194297.1\|3454428_3455193_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_000755546.1\|3455291_3456554_-	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	6.8e-12	32.0

DBSCAN-SWA_4

4484917 : 4495462

Bacillus_phage(62.5%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000609128.1\|4484917_4485592_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.1e-36	39.1
WP_075396510.1\|4485594_4486770_+	FtsX-like permease family protein	NA	NA	NA	NA
WP_075396509.1\|4486882_4488106_-	hypothetical protein	A0A173GB44	Bacillus_phage	5.9e-21	44.1
WP_075396508.1\|4488309_4489593_-	C40 family peptidase	A0A2I7SDE4	Paenibacillus_phage	2.6e-19	30.7
WP_075396507.1\|4489696_4490680_-	N-acetylmuramoyl-L-alanine amidase	A9QTG1	Bacillus_phage	5.9e-88	74.6
WP_000930102.1\|4490684_4491110_-\|holin	phage holin family protein	A0A0S2MVC4	Bacillus_phage	1.1e-46	72.1
WP_075396506.1\|4491876_4492260_-	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	2.1e-17	43.8
WP_000402993.1\|4492630_4492984_+	helix-turn-helix transcriptional regulator	A0A2I7SDF8	Paenibacillus_phage	1.0e-05	36.5
WP_139316730.1\|4494145_4495462_+	SH3 domain-containing protein	J9PQW7	Bacillus_phage	9.2e-36	72.8

DBSCAN-SWA_5

4993703 : 5002076

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075396331.1\|4993703_4994291_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	7.7e-27	35.8
WP_001262445.1\|4994287_4995328_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	3.2e-68	45.9
WP_000879025.1\|4995430_4996846_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.3e-55	35.4
WP_075396330.1\|4996830_4999050_-	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	7.4e-163	41.2
WP_000666779.1\|4999033_4999717_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000278820.1\|4999713_4999968_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_001170540.1\|4999960_5000680_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	2.0e-48	43.9
WP_000625683.1\|5000768_5002076_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	6.4e-21	25.3

DBSCAN-SWA_6

5047137 : 5055087

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075396323.1\|5047137_5048643_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	9.2e-32	30.8
WP_000929888.1\|5048626_5049328_-	response regulator transcription factor	W8CYM9	Bacillus_phage	7.3e-40	36.9
WP_075396322.1\|5049473_5050799_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	9.2e-44	29.5
WP_000743900.1\|5051183_5052722_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	2.6e-21	31.2
WP_001029999.1\|5053129_5054764_-	chaperonin GroEL	A0A219YK78	uncultured_virus	2.0e-157	58.2
WP_000917306.1\|5054802_5055087_-	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.2e-20	53.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP018932

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

5758 : 12719

Bacillus_phage(33.33%)

integrase

attL 8195:8209|attR 15995:16009

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075395863.1\|5758_7024_+	Y-family DNA polymerase	O64031	Bacillus_phage	6.4e-103	46.7
WP_075395797.1\|7020_7362_+	YolD-like family protein	A0A1Q1PW34	Staphylococcus_phage	1.9e-09	40.3
WP_075395864.1\|7408_7783_+	hypothetical protein	D2XQ01	Bacillus_virus	9.0e-29	51.3
WP_075395798.1\|7896_8142_-	hypothetical protein	NA	NA	NA	NA
8195:8209	attL	NA	NA	NA	NA
WP_075666865.1\|8217_8802_+	hypothetical protein	NA	NA	NA	NA
WP_075395799.1\|8937_9174_-	hypothetical protein	NA	NA	NA	NA
WP_075395865.1\|9467_10541_+	hypothetical protein	A0A2H4J8G3	uncultured_Caudovirales_phage	5.1e-77	44.2
WP_000023351.1\|11109_11721_+	recombinase family protein	A0A1V0E035	Clostridioides_phage	7.8e-14	32.1
WP_075395800.1\|11738_12719_+\|integrase	site-specific integrase	A0A1B1P793	Bacillus_phage	1.1e-38	34.3
15995:16009	attR	NA	NA	NA	NA

DBSCAN-SWA_2

81675 : 88663

Bacillus_phage(33.33%)

integrase

attL 75368:75391|attR 92540:92563

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
75368:75391	attL	NA	NA	NA	NA
WP_075395863.1\|81675_82941_+	Y-family DNA polymerase	O64031	Bacillus_phage	6.4e-103	46.7
WP_075395797.1\|82937_83279_+	YolD-like family protein	A0A1Q1PW34	Staphylococcus_phage	1.9e-09	40.3
WP_075395864.1\|83325_83700_+	hypothetical protein	D2XQ01	Bacillus_virus	9.0e-29	51.3
WP_075395798.1\|83813_84059_-	hypothetical protein	NA	NA	NA	NA
WP_075666865.1\|84134_84719_+	hypothetical protein	NA	NA	NA	NA
WP_075395799.1\|84854_85091_-	hypothetical protein	NA	NA	NA	NA
WP_075395865.1\|85384_86458_+	hypothetical protein	A0A2H4J8G3	uncultured_Caudovirales_phage	5.1e-77	44.2
WP_000023351.1\|87026_87638_+	recombinase family protein	A0A1V0E035	Clostridioides_phage	7.8e-14	32.1
WP_075696925.1\|87655_88663_+\|integrase	site-specific integrase	A0A1B1P793	Bacillus_phage	1.5e-38	34.3
92540:92563	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP018931

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP018932

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection