CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP013938	Weissella cibaria strain CMU plasmid unnamed2, complete sequence	0 crisprs	NA	0
NZ_CP013936	Weissella cibaria strain CMU, complete genome	1 crisprs	DEDDh,cas3,csa3,DinG	2
NZ_CP013937	Weissella cibaria strain CMU plasmid unnamed1, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013936_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013936_1

2169586-2169693

Orphan

Consensus_repeat	Method
CGTTTGCGCATCCGAAACTGCCGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013936_1

>merge|NZ_CP013936|1|2169586-2169693|CRISPRCasFinder
CGTTTGCGCATCCGAAACTGCCGTCACCGTTGAAAAGCCACTTGAATCCACGGCCTTCGCTGCTGTTTCAGCATTATCACGGGCCGTTTGCGCATCCGAAACCGCCGT

>NZ_CP013936|1|1|2169586-2169693|CRISPRCasFinder
CGTTTGCGCATCCGAAACTGCCGT	CACCGTTGAAAAGCCACTTGAATCCACGGCCTTCGCTGCTGTTTCAGCATTATCACGGGC
CGTTTGCGCATCCGAAACCGCCGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013936.1\|WP_010375176.1\|2151709_2153050_-\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224169
NZ_CP013936.1\|WP_010375182.1\|2155639_2155867_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013936.1\|WP_010375184.1\|2155940_2156834_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|100078
NZ_CP013936.1\|WP_010375189.1\|2173147_2174662_-\|glycosyl-transferase	unknown	unknown	gnl\|CDD\|340855
NZ_CP013936.1\|WP_010375186.1\|2157753_2158068_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013936.1\|WP_010375198.1\|2182870_2183647_-\|3-oxoacyl-ACP-reductase	unknown	unknown	gnl\|CDD\|131468
NZ_CP013936.1\|WP_010375194.1\|2180303_2181362_-\|DUF3324-domain-containing-protein	unknown	unknown	gnl\|CDD\|371730
NZ_CP013936.1\|WP_010375185.1\|2157472_2157754_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225619
NZ_CP013936.1\|WP_010375190.1\|2174661_2176275_-\|glycosyl-transferase-family-1	unknown	unknown	gnl\|CDD\|340855
NZ_CP013936.1\|WP_010375193.1\|2179300_2180071_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372694
NZ_CP013936.1\|WP_010375197.1\|2181895_2182765_-\|NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224995
NZ_CP013936.1\|WP_010375180.1\|2154523_2155528_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|369561
NZ_CP013936.1\|WP_010375188.1\|2172455_2173067_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376676
NZ_CP013936.1\|WP_010375172.1\|2149928_2150780_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|283645
NZ_CP013936.1\|WP_080553245.1\|2153179_2153947_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP013936.1\|WP_010375196.1\|2181495_2181738_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013936.1\|WP_010375179.1\|2153909_2154395_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013936.1\|WP_010375191.1\|2176425_2178663_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236140
NZ_CP013936.1\|WP_010375174.1\|2150852_2151548_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224117
NZ_CP013936.1\|WP_010375192.1\|2178719_2179145_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP013936.1\|WP_010375176.1\|2151709_2153050_-\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224169	COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion].	6.50475e-111
NZ_CP013936.1\|WP_010375184.1\|2155940_2156834_-\|hypothetical-protein	gnl\|CDD\|100078	cd05709, S2P-M50, Site-2 protease (S2P) class of zinc metalloproteases (MEROPS family M50) cleaves transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of this family use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. The domain core structure appears to contain at least three transmembrane helices with a catalytic zinc atom coordinated by three conserved residues contained within the consensus sequence HExxH, together with a conserved aspartate residue. The S2P/M50 family of RIP proteases is widely distributed; in eukaryotic cells, they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum (ER) stress responses. In sterol-depleted mammalian cells, a two-step proteolytic process releases the N-terminal domains of sterol regulatory element-binding proteins (SREBPs) from membranes of the ER. These domains translocate into the nucleus, where they activate genes of cholesterol and fatty acid biosynthesis. It is the second proteolytic step that is carried out by the SREBP Site-2 protease (S2P) which is present in this CD superfamily. Prokaryotic S2P/M50 homologs have been shown to regulate stress responses, sporulation, cell division, and cell differentiation. In Escherichia coli, the S2P homolog RseP is involved in the sigmaE pathway of extracytoplasmic stress responses, and in Bacillus subtilis, the S2P homolog SpoIVFB is involved in the pro-sigmaK pathway of spore formation. Some of the subfamilies within this hierarchy contain one or two PDZ domain insertions, with putative regulatory roles, such as the inhibition of substrate cleavage as seen by the RseP PDZ domain.	0.000136799
NZ_CP013936.1\|WP_010375189.1\|2173147_2174662_-\|glycosyl-transferase	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	5.20103e-64
NZ_CP013936.1\|WP_010375198.1\|2182870_2183647_-\|3-oxoacyl-ACP-reductase	gnl\|CDD\|131468	TIGR02415, Diacetyl_reductase, acetoin reductases. One member of this family, as characterized in Klebsiella terrigena, is described as able to interconvert acetoin + NADH with meso-2,3-butanediol + NAD(+). It is also called capable of irreversible reduction of diacetyl with NADH to acetoin. Blomqvist, et al. decline to specify either EC 1.1.1.4 which is (R,R)-butanediol dehydrogenase, or EC 1.1.1.5, which is acetoin dehydrogenase without a specified stereochemistry, for this enzyme. This enzyme is a homotetramer in the family of short chain dehydrogenases (pfam00106). Another member of this family, from Corynebacterium glutamicum, is called L-2,3-butanediol dehydrogenase (). [Energy metabolism, Fermentation].	2.11707e-85
NZ_CP013936.1\|WP_010375194.1\|2180303_2181362_-\|DUF3324-domain-containing-protein	gnl\|CDD\|371730	pfam11797, DUF3324, Protein of unknown function C-terminal (DUF3324). This family consists of several hypothetical bacterial proteins of unknown function.	1.00815e-26
NZ_CP013936.1\|WP_010375185.1\|2157472_2157754_+\|hypothetical-protein	gnl\|CDD\|225619	COG3077, RelB, DNA-damage-inducible protein J [DNA replication, recombination, and repair].	0.00172192
NZ_CP013936.1\|WP_010375190.1\|2174661_2176275_-\|glycosyl-transferase-family-1	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	1.0305e-96
NZ_CP013936.1\|WP_010375193.1\|2179300_2180071_-\|hypothetical-protein	gnl\|CDD\|372694	pfam13731, WxL, WxL domain surface cell wall-binding. The WxL motif appears in two or three copies in these bacterial proteins and confers a cell surface localization function. It seems likely that this region is the cell wall-binding domain of gram-positive bacteria, and may interact with the peptidoglycan.	0.0033054
NZ_CP013936.1\|WP_010375180.1\|2154523_2155528_-\|alpha/beta-hydrolase	gnl\|CDD\|369561	pfam07859, Abhydrolase_3, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	1.68741e-46
NZ_CP013936.1\|WP_010375188.1\|2172455_2173067_-\|hypothetical-protein	gnl\|CDD\|376676	pfam01944, SpoIIM, Stage II sporulation protein M. SpoIIM is on e of four stage II sporulation proteins that is necessary for the forespore inside the mother-cell to be properly internalized through the breakdown of peptidoglycans trapped between the membranes of the septum separating the forespore and the mother-cell. The four proteins working in sequence are SpoIIB, pfam05036, SpoIIM, SpoIIP, pfam07454, and finally SpoIID, pfam08486. D, M and P are in a complex with each other and the complex assembles in a hierarchical manner such that M, which serves as a membrane anchor, recruits P to the septum and P, in turn, recruits D to the septum.	0.00286603
NZ_CP013936.1\|WP_010375172.1\|2149928_2150780_-\|alpha/beta-hydrolase	gnl\|CDD\|283645	pfam06028, DUF915, Alpha/beta hydrolase of unknown function (DUF915). This family consists of several bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.	2.71384e-86
NZ_CP013936.1\|WP_080553245.1\|2153179_2153947_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.6464e-06
NZ_CP013936.1\|WP_010375191.1\|2176425_2178663_-\|hypothetical-protein	gnl\|CDD\|236140	PRK08026, PRK08026, FliC/FljB family flagellin.	3.53328e-06
NZ_CP013936.1\|WP_010375174.1\|2150852_2151548_-\|hypothetical-protein	gnl\|CDD\|224117	COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning].	3.7092e-09
NZ_CP013936.1\|WP_010375197.1\|2181895_2182765_-\|NAD(P)-dependent-oxidoreductase	gnl\|CDD\|224995	COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism].	2.20459e-99

>NZ_CP013936.1|WP_010375186.1|2157753_2158068_+|hypothetical-protein
MAKKLYWAYVSFVDQPGGKERPVLYVRENQDSYFVYRLTTKFANKSPQIQKNYFEILDWQAAGLPQKSWIDRGRINKLPRATTKLRHIGELTTHDIKRLAAFKS
>NZ_CP013936.1|WP_010375185.1|2157472_2157754_+|hypothetical-protein
MTHTIKRRVQFSVDEGVAEAVESLLAKAGLTTSTLLPLVYAQILNTGQIPITHELSDEDLAEAKIIADSYEVPTFEVNTDADVQAFFDDDGGY
>NZ_CP013936.1|WP_010375184.1|2155940_2156834_-|hypothetical-protein
MVVLYIILSWIGAVVIHECGHCIVAWLLKINIARLGLFGFVIDNQKKIRFEGSGLGSFVVFRNAKPTVLNLGILYAGGAVANVLVVMLLPLKAGLGVETFTLMNGVIAAVTLLPLNNLATDGSMLLNLVMNPEETVLHYTVSYFLTNEYTEKFDALLPQVLSTLDGPLGKVQESHIIIYLSYLNYVCALKKGRLENEQKQLVKKVFNTVLSDKRMKSRYLSDYMVGEVMTQKLINGKNSVGDYKELHKLPILLKRRIAYLLDPEDTGKKADYYQEITTTAQGEATLMINGELSYLAL
>NZ_CP013936.1|WP_010375182.1|2155639_2155867_-|hypothetical-protein
MEKANAIRKTANHDILVLAAVVMPSLIFPRTFRGFVIVALCYLAFCIFIYAVYFVFLKYTKMGLSRVEKYYRLDE
>NZ_CP013936.1|WP_010375180.1|2154523_2155528_-|alpha/beta-hydrolase
MTTDEFTKRFRPGTTTSGYLDDRAKAEINAAGPSFDHQPTPAEIRAVMGWPAAHHEAVNELTVRAHKIVGVSVTEFVQQRYDDRVLPTVVFIHGGAFVGGSVANVTPILQQMADAGALRVFALDYSLAPEHPFPAGMLDVYRVVVALHQAAKQYGIDETQLSLAGDSAGGNLTYTVALLDQNLQSNYLHKLVAMYPAVYNGHDAEKEMDFSDIQAYGAQADQALIAQYIASFRESPLISDWYLQGVDDEQMAVSPINAPAAMLAELPASLLIIGEFDPLRLEGEAFFERVRDAGGTIAYIRYNGMVHAFVDKIGDYPQAKQAVLDLVDFVLAES
>NZ_CP013936.1|WP_010375179.1|2153909_2154395_-|hypothetical-protein
MAKRPEAIALENWLFARLNPRGKGRVSAYGATEVTLSTDASANKLGKGRKKAGYQGRVDFISIDTQRTVRAYEIKVSIQDFRTQAMKSWVGHYNYLVTTDELADKYRDEILAALPDGIGWLTPTQTVRRPKRHALQIDETWLVWLMMRRNAMVVRDSRLQD
>NZ_CP013936.1|WP_080553245.1|2153179_2153947_-|TetR/AcrR-family-transcriptional-regulator
MRWWSVIVGYRTEPEKRKIWYNNRNTYNEWEREVIMGRQRNEETIKQIRRAVWQLFLAKGYGKTSFSDVAQTAQLNRSIVQYYFAKKEDFSNMLMAQVSDQVLVIVDQKFPDASRLERYYLASQLYFAVFWHPELRHLLKEILENRKLADESMYNQVIWSVNILTDAVDEAKFEAAYIDVVDAWGGFAEVMYYSLQHDRQVDLARGLKRLVPLIAMIAGYEADVCDQVIATHTLTSEQRDELRDRILQQINQENK
>NZ_CP013936.1|WP_010375176.1|2151709_2153050_-|NAD(P)/FAD-dependent-oxidoreductase
MKYDIIFIGSGHAAWHGAQELARAGKRVALIEQEKVSGTCTNFGCNAKILLDGPAELLHHLHNYHGIGMNDAVNIVWPELMAYKHQVIDPMDEAMAQILAVDGIDIIFGHASFVDAHTITVNDDTYTADNFVLAMGQRPAKLPVTGTELTHDSKDFLDLPEMPKSMIMIGAGFIGMEFASIAQAAGSDVTIVEYADRALANFDADYTNRVVELMTAKGIKFAFNNAVEQISQDGDVFSVKTAQGNTFQADMVFDTTGRVSNTDDMNLASIGVETNRGGVIVNDHMQTTVAHIYASGDVVAKTTPRLTPTATFESLYIADVLLGQTTAAIAYPAVPSVTFTLPRMAQIGVSTAEAADSDEYNVYDINFAQLGMFASHHDTEAKVKIVLNQQKQLVGAALIGDAAPELVNTLVPIINHKYTKADLNKTIYAFPTPSAMLPMLLANFLA
>NZ_CP013936.1|WP_010375174.1|2150852_2151548_-|hypothetical-protein
MLEKIMAVCKSKWVLGLLVVGVSASAAVAASAAVSGWNGATNMNTVNQVLGQLDGMLTNRENQVKQLKADLKDADATIATLTQQRDAANAKLATAQQDLSAAQQAVTALTSQLNQAKTENDSLRGQLDEKIKEIQQKIADGNRQVELKQQEVDRLSAQVGSLNGQLGNLQNQLTNVTNQYNDLQHASHAQISSLSSEVDDLRNQLRAAEQDAQNTADNAQNILAKHNNTNV
>NZ_CP013936.1|WP_010375172.1|2149928_2150780_-|alpha/beta-hydrolase
MKKWMSTIIALVAIVGVAFGLHQSLKLKRDTAKYTYSNVPTLFIHGYGGTLNSTKDLVRAAEKAGAAKKMLTARVTKDGQVKLSGHWDKNKYNPMVQVVFSDNRNADFHTDAKWIKHVIVALQQRYGIKSFNAVAHSMGNLGLLTYEMTYGQDKSLPQLRKQVNIAGHFDGILGLNKEVANNTLDAQGKPTKMVSYYEWLLAHRDNYPDQQVAVLNMYGDLHNGSHSDGRVTTTSAKSLRYLLGNRPKSYREKEIVGPNAQHSKLHENNQVVNREMINFLWGK
>NZ_CP013936.1|WP_010375188.1|2172455_2173067_-|hypothetical-protein
MTKIGTIWRETFRRYWRTMVIFAIINVVIWFVVLALVKFNAFGLHDLALKSIKANFVNDASSHKINHSGAFGGFVQLTWHNYLGGLATVAISLIPIPFWWVTAVMNPASIGYLLGLSPIPVTTFFAGIFPHSIVEMPMQWLEFSIAWETFRLIWQNIRTKQGWWHGIDWRHIIIILIVVVLPMAILAGAIESFITPALLNMAK
>NZ_CP013936.1|WP_010375189.1|2173147_2174662_-|glycosyl-transferase
MNYFVSENVFTFNSGTEHAQAKRVQLFTEQGQSAQYVTRNYNRFLARDAEAIGLHAEQVLNMYDFFQGVTDVPREEVSLRLLPQIPLDEYHIEGHGPNYSTINHAGRELARINVMPATVGLVNDIVYYDRYGNTTARENFDWRGFKSSVDYFHPDGNLAVQKMLNLAGETVIEISHMKVNGTLYPTMWKLLNYKGHDWRFNTEDQLFLFFLNEITAEHPGSILVSDRRSLDHVVADVQFAAKKFAVLHDIHTPDIKNPIRGKLYDAYLNVLERRVRDFDAILVPTPEQQADLQKRYSGVDFRVVPDTFVPQAQLAASRLRLPDRQAGNILFMGRLSPEKRPDQAIRALARVVKSVPSATLTFHGYPANAEILNELKALANQLGVTNSVIFGDYITGDALAAAYQRAQVIVQTSVAEGFGMNLVEAMSYGVPVVSYDITYGTRELIHDGVNGYVVANGAHGEMADRIVSILSDDGVWADLSAAAYDKAVTFNGQAMMAAWQQALQ
>NZ_CP013936.1|WP_010375190.1|2174661_2176275_-|glycosyl-transferase-family-1
MNFFVNATMPKQKSGIEHAQLKRFELFNNHQVDSRIVLRDWDPVAHVNANAAGIPDNQLINMFDYFQEAVTVTPKTLHAQEIEFGVPNVQFADEPANNRYLVTAQNGQLVARVNYDATADKRVRSTELFDGYNNLFRVDHYDSRGFASLIQWYTTDNQIGTETWVTPSGRTVIETFNKKTMAGEFVKSGWRLIEHGGHVMQFDTIEELTKHFFDRLNDDFWSEEQPNVFVLDRSHLGDWGLLRLRKPAYVVMHLHNSHAGDAQDPMHAILNNHYEFAMNALDEYDAVVSATHKQTHDVNERFQPKTRLFTIPVGVVPDRLLQAERVPVARREFGKVIAFARIAWEKHLDDLVRAVGIVHKEFPQVTLDLYGYADPADNYKARTSVEEAIREYGLEGVVTMKGYTTEIDAVENNAMMYGLTSRMEGFNLAIMEAISHGLIAFSYDVNYGPNEIVEDDVNGNVVPYEDYEAMAQAMLKVLRDPDLAQRYSTGAYESSERYSEENVWHAWRELLDDAAAVWPAKLAAMPAHAHDLNKEAE
>NZ_CP013936.1|WP_010375191.1|2176425_2178663_-|hypothetical-protein
MAVSPASDTSTKTASGSTDELAVAAGNVGTATTSDAPTKVSGSLNKLYRFTGKQYLSLHTPDDSTGLKLTNISSYLDSSTFSVKVIYADGTISDVDSGGVDGYSTWYPTSNVQGIFYSVDPKTGALMVKHGTITVSKNKTTYNYSSPLAVATDGDWQNAAGSPATNIYVYSKVKVPALGQQLVLSGNVKMPTNGDMRQYSGDTRMFGAGSTTNTPVNYNVAGNIPETSSTSWYGSYEEGGFNILKHTDTGVITHDVSYTDGTGKSITSGSSDSYNQVIASDKITNTQSQDSTGTYTITTGSNNVTFAKQPAFVNANGDDVSTAVGLKDMTYYDATGAKTTDYAKAVKATMTVTIPATSSYTIKSVFQASKTESITSTTSMTGTDTNMAKIDLTKSFTWNGAAAVTGSINYVDANGNQVATGSYTKAPGSSTSDITAPTTTDGYRYKFVSVDKSTYDGSDIKVTVAKIATGNINYVYNGKTVSSTPFTDQDAGKTIANIAAPAGTVDGLRYKLADATKSYAYPDKDGDVNVDLAAIVSGTIEFVDADNNNALVQQQAFTDQTPGAQISPLTLPDGYVLAVGANGDVQSTYNYPTTDAQVVTVKVQKLTSGNRNDGMELTEVPSFSSDKNTIGASDTTTLTATKGGVLSYLNLKGQNADIYMSATDLKSNGSALPIKTLKANLSAGLADVYAANQTDGYGHMIVNDTTSKKGSLTIPDLQMTLSNNNFAAGTYSGTINYTMVSDDLN
>NZ_CP013936.1|WP_010375192.1|2178719_2179145_-|hypothetical-protein
MKNTRRLQAKVQHMALASIIIAGIVAPIVQLAPSLPGMSLQDVKAATGVVDKVDKGTASENYARDLLGGSYSGTTPAMLAGQTGVVDGSWKITPRDTSAAYAKRTNAKGDFPFNMLQRWLMVKIKFLMVARLAHMTQRQLS
>NZ_CP013936.1|WP_010375193.1|2179300_2180071_-|hypothetical-protein
MMKQFLMSVAVLGAAVTLAAPAVNADATFAGKTGTTDVTFQGDTTTKPGTTDPKDPDNGATVGGLTLTAVPSFSFKDAGATPKITEASTKVLTANGVSTQPTGDTTGTNNTSSSIYVRDTRGLTADAAGAGYSIYASASQLKAGDQVLPVASLNMTVADGTANSNGGLITGKSAVSVYQANNSVLKGGTAKTAGDATLGTVAGYGNLIAKGDGKTNGDNATGAVSAELNLSSNAVQAQKYTGTMYYTLVDSATSAN
>NZ_CP013936.1|WP_010375194.1|2180303_2181362_-|DUF3324-domain-containing-protein
MIGRKLWSSLAIVTAALGALGVAKPAAAADYSNNNPEMGVMLSSIEDDTDTNNSTWELNTKPGKVLQGSVSVQNASDAAAKFTVSMEQARTNDQVNIMYLSGGTNKSLDPNMKFSNLAKVDGKDNTTVTVPAKTTVQVPITLTMPAKEFDGYVLGAVVVNKELPKGYKVEGGVTNRFVYVKTVQITESIVNPTAVLTNDKKGLVKVSDGRQIFQLPIQNNVPSYIGNMSLKAKVTYKSTGDTVLTDSQKNRSVAPNSSFTYQIPSERVMKAGKYHYVVTMTNDKTKKSWTFSDDFTVSRASATSVGIGRSIAFVPTWIWQLLALFLVLIGFLFFLLWKRRKDDEDEDETTAK
>NZ_CP013936.1|WP_010375196.1|2181495_2181738_-|hypothetical-protein
MTIGRIYSDLKAMFELLAWITFIFVLFVLSSRYLYGMDYSIFLPLVVMLYAGVWVGLSVALVLTWIFSAGTAKQATQTTK
>NZ_CP013936.1|WP_010375197.1|2181895_2182765_-|NAD(P)-dependent-oxidoreductase
MKIGFIGTGVMGRGIINNLLQANYEVVVFNRTKAHAQSVLDNGATWADSPKEIAEAADLVITMVGYPKDVEEQYYGDNGLFAGSHAGQIFVDMTTSTPTLAEQLAVDGEKYDVKVLDAPVSGGDVGAKNGTLTIMAGGDEAAYDSLQPIFDVISKAANRFGVAGRGQHTKMANQIMIAATMLGMSEMMVYAKAADLDVAKVMATLSAGGAQNWSLDNYGPRVLAGDFEPGFYAKHLLKDLRIALDEAAKMNLSLPATDLAEALYTKLVEQKNLGDEGTQALVKLWAQFA
>NZ_CP013936.1|WP_010375198.1|2182870_2183647_-|3-oxoacyl-ACP-reductase
MAEKVAIVTGGGQGIGEGIALRLAQDGYAVIVNGRTQTKLDNVVNKIVAAGGEATTFAGDVQQKSVNEEMVQLALTKYGRLDVFVANAGIDWVDTIEETPEEQVDNVFNINLKSQVWALQTAPAAMRKNGKQGGSIVLASSIAGMEGFEMLGIYSATKFATRGLVQAAAKELATDNIRVNAYNPGIVLTPMWDQIDARFAERKNVAIGETRQAFIDGILLGRGEEPDDIAKYVSFLVSDQADYITGQSLAVDGGVKFQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

763515 : 772157

Synechococcus_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010372607.1\|763515_764004_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	3.8e-19	39.7
WP_010372610.1\|763996_765115_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_010372613.1\|765111_765837_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3HWF9	Synechococcus_phage	1.2e-29	34.2
WP_010372616.1\|765839_766097_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_010372619.1\|766098_766782_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_010372622.1\|766778_769001_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	6.3e-138	40.5
WP_010372626.1\|768985_770521_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.2e-48	33.3
WP_010372628.1\|770532_771573_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F0L1	Synechococcus_phage	2.4e-55	40.9
WP_010372630.1\|771563_772157_+	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	1.8e-23	38.9

DBSCAN-SWA_2

1513278 : 1559903

Lactobacillus_phage(25.0%)

portal,protease,terminase,transposase,integrase

attL 1510093:1510109|attR 1556448:1556464

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1510093:1510109	attL	NA	NA	NA	NA
WP_062359086.1\|1513278_1514073_-\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	3.6e-27	34.7
WP_075274794.1\|1514407_1515529_-\|portal	phage portal protein	D2IZF6	Enterococcus_phage	1.4e-109	56.3
WP_010374042.1\|1515537_1516818_-\|terminase	PBSX family phage terminase large subunit	Q8SDU9	Staphylococcus_phage	4.6e-141	59.7
WP_010374045.1\|1516810_1517233_-\|terminase	terminase small subunit	A0A1Q1PVS8	Bacillus_phage	7.3e-11	34.8
WP_010374047.1\|1518331_1518745_-	ArpU family transcriptional regulator	NA	NA	NA	NA
WP_010374048.1\|1518826_1519030_-	hypothetical protein	NA	NA	NA	NA
WP_010374050.1\|1519039_1519228_-	hypothetical protein	NA	NA	NA	NA
WP_010374052.1\|1519231_1519579_-	hypothetical protein	NA	NA	NA	NA
WP_010374054.1\|1519575_1519824_-	hypothetical protein	NA	NA	NA	NA
WP_010374056.1\|1519823_1520096_-	hypothetical protein	NA	NA	NA	NA
WP_010374058.1\|1520095_1520662_-	hypothetical protein	NA	NA	NA	NA
WP_010374060.1\|1520661_1520868_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_010374061.1\|1520923_1521292_-	hypothetical protein	NA	NA	NA	NA
WP_010374063.1\|1521294_1522020_-	ATP-binding protein	Q6J1V5	Lactobacillus_phage	1.3e-20	35.1
WP_010374064.1\|1522019_1522820_-	DnaD domain protein	A0A0S2MYA8	Enterococcus_phage	8.3e-40	63.2
WP_010374066.1\|1522782_1523493_-	hypothetical protein	D7RWH3	Brochothrix_phage	1.1e-35	40.1
WP_010374068.1\|1523506_1524352_-	hypothetical protein	NA	NA	NA	NA
WP_010374070.1\|1524362_1525289_-	DUF1351 domain-containing protein	A0A0P0IV40	Lactobacillus_phage	1.6e-13	27.8
WP_010374074.1\|1525597_1526125_-	hypothetical protein	NA	NA	NA	NA
WP_010374075.1\|1526114_1526303_-	hypothetical protein	NA	NA	NA	NA
WP_010374076.1\|1526292_1526517_-	hypothetical protein	NA	NA	NA	NA
WP_010374077.1\|1526566_1526800_-	hypothetical protein	NA	NA	NA	NA
WP_010374078.1\|1526802_1527012_-	hypothetical protein	NA	NA	NA	NA
WP_010374079.1\|1527132_1527411_+	hypothetical protein	C5I642	Staphylococcus_phage	5.3e-18	43.0
WP_010374080.1\|1527407_1527626_-	hypothetical protein	NA	NA	NA	NA
WP_010374081.1\|1527628_1528366_-	hypothetical protein	A0A097BYE0	Leuconostoc_phage	1.4e-44	44.6
WP_010374082.1\|1528376_1528604_-	hypothetical protein	NA	NA	NA	NA
WP_010374083.1\|1528690_1528900_+	hypothetical protein	NA	NA	NA	NA
WP_010374086.1\|1529282_1529624_+	XRE family transcriptional regulator	M1PKY8	Streptococcus_phage	5.7e-14	41.3
WP_010374088.1\|1529616_1530024_+	ImmA/IrrE family metallo-endopeptidase	D6PSS8	Lactobacillus_phage	8.9e-06	30.3
WP_010374089.1\|1530076_1530694_+	outer membrane protein assembly factor BamE	NA	NA	NA	NA
WP_010374091.1\|1531072_1531348_+	membrane protein	NA	NA	NA	NA
WP_010374093.1\|1531357_1531723_+	phage protein	NA	NA	NA	NA
WP_010374095.1\|1531758_1531959_-	hypothetical protein	A0A1P8BMQ1	Lactococcus_phage	5.9e-19	71.2
WP_010374097.1\|1532161_1533253_+\|integrase	site-specific integrase	E3W8I1	Leuconostoc_phage	9.6e-39	33.3
WP_010374099.1\|1533425_1534160_-	gamma-glutamyl-gamma-aminobutyrate hydrolase	NA	NA	NA	NA
WP_010374101.1\|1534281_1535376_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_029237506.1\|1535478_1536660_-	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
WP_010374105.1\|1536719_1537460_-	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_010374107.1\|1537479_1538346_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_010374110.1\|1538368_1539514_-	amidohydrolase	NA	NA	NA	NA
WP_010374112.1\|1539526_1540240_-	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase	NA	NA	NA	NA
WP_010374113.1\|1540255_1541542_-	diaminopimelate decarboxylase	NA	NA	NA	NA
WP_010374115.1\|1541555_1542671_-	alanine racemase	NA	NA	NA	NA
WP_010374117.1\|1543077_1544433_+	aspartate kinase	NA	NA	NA	NA
WP_010374119.1\|1544495_1545506_-	DUF3114 domain-containing protein	NA	NA	NA	NA
WP_010374121.1\|1545540_1546533_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_010374123.1\|1546547_1547402_-	homoserine kinase	NA	NA	NA	NA
WP_010374125.1\|1547805_1548354_+	folate family ECF transporter S component	NA	NA	NA	NA
WP_010374127.1\|1548415_1548730_-	hypothetical protein	NA	NA	NA	NA
WP_010374129.1\|1548913_1549570_+	metal-dependent transcriptional regulator	NA	NA	NA	NA
WP_010374131.1\|1549615_1550341_-	class A sortase	NA	NA	NA	NA
WP_010374133.1\|1550441_1551323_-	transcriptional regulator	NA	NA	NA	NA
WP_010374134.1\|1551315_1552191_-	hypothetical protein	NA	NA	NA	NA
WP_010374137.1\|1552438_1553080_-	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_010374139.1\|1553304_1554612_-	ATP-dependent helicase	A0A1V0SIR5	Klosneuvirus	5.7e-30	28.7
WP_029237507.1\|1554717_1555710_-	gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_010374143.1\|1555853_1557221_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	4.9e-125	50.3
1556448:1556464	attR	NA	NA	NA	NA
WP_010374144.1\|1557418_1558954_+	hypothetical protein	NA	NA	NA	NA
WP_010374146.1\|1559006_1559903_-\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage