CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP018319	Pseudomonas frederiksbergensis strain AS1, complete genome	1 crisprs	PD-DExK,DEDDh,csa3,PrimPol,cas3,DinG,WYL	0	0	6	0
NZ_CP018320	Pseudomonas frederiksbergensis strain AS1 plasmid, complete sequence	0 crisprs	NA	0	0	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP018319_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018319_1

4898821-4898992

Orphan

Consensus_repeat	Method
GCTCGCGATGGCGGCCTGACAGCCGACCAA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP018319_1

>merge|NZ_CP018319|1|4898821-4898992|CRISPRCasFinder
GCTCGCGATGGCGGCCTGACAGCCGACCAATCACTTCCTGCCAAACATCCAATCCCTGTGGGAGCGGGCTTGCTCGCGAAGGCGGCCTGACAGCCGACCAAATAGTCGCAGATGTACACCATTCCCCTGTGGGAGCGACCTCGCTCGCGATGGAGGTATATCAGACGACATC

>NZ_CP018319|1|1|4898821-4898992|CRISPRCasFinder
GCTCGCGATGGCGGCCTGACAGCCGACCAA	TCACTTCCTGCCAAACATCCAATCCCTGTGGGAGCGGGCTT
GCTCGCGAAGGCGGCCTGACAGCCGACCAA	ATAGTCGCAGATGTACACCATTCCCCTGTGGGAGCGACCTC
GCTCGCGATGGAGGTATATCAGACGACATC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018319.1\|WP_076030632.1\|4890598_4891168_-\|Rrf2-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224870
NZ_CP018319.1\|WP_074875728.1\|4894127_4894682_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|380339
NZ_CP018319.1\|WP_076030639.1\|4908749_4909415_+\|DsbA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|239322
NZ_CP018319.1\|WP_046049436.1\|4906277_4907330_+\|3-keto-5-aminohexanoate-cleavage-protein	unknown	unknown	gnl\|CDD\|377562
NZ_CP018319.1\|WP_074875719.1\|4889969_4890188_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018319.1\|WP_076030636.1\|4901574_4902288_-\|serine/threonine-protein-phosphatase	unknown	unknown	gnl\|CDD\|277367
NZ_CP018319.1\|WP_074877748.1\|4907421_4908753_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340886
NZ_CP018319.1\|WP_074875734.1\|4899214_4901272_+\|carbon-starvation-protein-A	unknown	unknown	gnl\|CDD\|184976
NZ_CP018319.1\|WP_074875738.1\|4902419_4902623_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018319.1\|WP_076030637.1\|4903091_4903490_+\|DUF5329-domain-containing-protein	unknown	unknown	gnl\|CDD\|379958
NZ_CP018319.1\|WP_076030634.1\|4892812_4894102_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223737
NZ_CP018319.1\|WP_076030638.1\|4904347_4905328_+\|quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|176189
NZ_CP018319.1\|WP_074875717.1\|4889559_4889799_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018319.1\|WP_074875721.1\|4890259_4890595_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018319.1\|WP_076030640.1\|4909411_4909738_+\|Rieske-2Fe-2S-domain-containing-protein	unknown	unknown	gnl\|CDD\|239604
NZ_CP018319.1\|WP_046049791.1\|4901286_4901484_+\|YbdD/YjiX-family-protein	unknown	unknown	gnl\|CDD\|225434
NZ_CP018319.1\|WP_076031579.1\|4894706_4896053_+\|glutamine-synthetase	unknown	unknown	gnl\|CDD\|223252
NZ_CP018319.1\|WP_076030633.1\|4891450_4892653_+\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224172
NZ_CP018319.1\|WP_008154581.1\|4896272_4896905_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP018319.1\|WP_076030635.1\|4896936_4898304_-\|histidine-kinase	unknown	unknown	gnl\|CDD\|226930

Protein	Function_ID	Function_description	E-value
NZ_CP018319.1\|WP_076030632.1\|4890598_4891168_-\|Rrf2-family-transcriptional-regulator	gnl\|CDD\|224870	COG1959, COG1959, Predicted transcriptional regulator [Transcription].	2.52194e-39
NZ_CP018319.1\|WP_074875728.1\|4894127_4894682_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|380339	cd02209, cupin_XRE_C, XRE (Xenobiotic Response Element) family transcriptional regulators, C-terminal cupin domain. This family contains transcriptional regulators containing an N-terminal XRE (Xenobiotic Response Element) family helix-turn-helix (HTH) DNA-binding domain and a C-terminal cupin domain. Included in this family is Escherichia coli transcription factor SutR (YdcN) that plays a regulatory role in sulfur utilization; it regulates a set of genes involved in the generation of sulfate and its reduction, the synthesis of cysteine, the synthesis of enzymes containing Fe-S as cofactors, and the modification of tRNA with use of sulfur-containing substrates. This family belongs to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	2.59861e-17
NZ_CP018319.1\|WP_046049436.1\|4906277_4907330_+\|3-keto-5-aminohexanoate-cleavage-protein	gnl\|CDD\|377562	pfam05853, BKACE, beta-keto acid cleavage enzyme. BKACE, beta-keto acid cleavage enzyme plays, a role in lysine degradation. In certain instances it catalyzes the conversion of 3-keto-5-aminohexanoate and acetyl-CoA into acetoacetate and 3-aminobutyryl-CoA. The family is found to have at least 14 slightly different potential new enzymatic activities, all of which can therefore be designated as beta-keto acid cleavage enzymes.	2.10721e-79
NZ_CP018319.1\|WP_076030636.1\|4901574_4902288_-\|serine/threonine-protein-phosphatase	gnl\|CDD\|277367	cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophosphatase domain. PrpA and PrpB are bacterial type I serine/threonine and tyrosine phosphatases thought to modulate the expression of proteins that protect the cell upon accumulation of misfolded proteins in the periplasm. The PPP (phosphoprotein phosphatase) family, to which PrpA and PrpB belong, is one of two known protein phosphatase families specific for serine and threonine. This family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-). The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes. Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes. PPPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	2.16328e-78
NZ_CP018319.1\|WP_074877748.1\|4907421_4908753_+\|MFS-transporter	gnl\|CDD\|340886	cd17328, MFS_spinster_like, Protein spinster and spinster homologs of the Major Facilitator Superfamily of transporters. The protein spinster family includes Drosophila protein spinster, its vertebrate homologs, and similar proteins. Humans contain three homologs called protein spinster homologs 1 (SPNS1), 2 (SPNS2), and 3 (SPNS3). Protein spinster and its homologs may be sphingolipid transporters that play central roles in endosomes and/or lysosomes storage. SPNS2 is also called sphingosine 1-phosphate (S1P) transporter and is required for migration of myocardial precursors. S1P is a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. The spinster-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.09518e-45
NZ_CP018319.1\|WP_074875734.1\|4899214_4901272_+\|carbon-starvation-protein-A	gnl\|CDD\|184976	PRK15015, PRK15015, carbon starvation protein CstA.	0
NZ_CP018319.1\|WP_076030638.1\|4904347_4905328_+\|quinone-oxidoreductase	gnl\|CDD\|176189	cd05286, QOR2, Quinone oxidoreductase (QOR). Quinone oxidoreductase (QOR) and 2-haloacrylate reductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. 2-haloacrylate reductase, a member of this subgroup, catalyzes the NADPH-dependent reduction of a carbon-carbon double bond in organohalogen compounds. Although similar to QOR, Burkholderia 2-haloacrylate reductase does not act on the quinones 1,4-benzoquinone and 1,4-naphthoquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	7.15318e-179
NZ_CP018319.1\|WP_076030634.1\|4892812_4894102_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223737	COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].	2.45566e-71
NZ_CP018319.1\|WP_076030639.1\|4908749_4909415_+\|DsbA-family-oxidoreductase	gnl\|CDD\|239322	cd03024, DsbA_FrnE, DsbA family, FrnE subfamily; FrnE is a DsbA-like protein containing a CXXC motif. It is presumed to be a thiol oxidoreductase involved in polyketide biosynthesis, specifically in the production of the aromatic antibiotics frenolicin and nanaomycins.	9.42668e-50
NZ_CP018319.1\|WP_076030637.1\|4903091_4903490_+\|DUF5329-domain-containing-protein	gnl\|CDD\|379958	pfam17263, DUF5329, Family of unknown function (DUF5329). This is a bacterial family of proteins with unknown function.	4.32103e-41
NZ_CP018319.1\|WP_046049791.1\|4901286_4901484_+\|YbdD/YjiX-family-protein	gnl\|CDD\|225434	COG2879, COG2879, Uncharacterized small protein [Function unknown].	3.21113e-33
NZ_CP018319.1\|WP_076030640.1\|4909411_4909738_+\|Rieske-2Fe-2S-domain-containing-protein	gnl\|CDD\|239604	cd03528, Rieske_RO_ferredoxin, Rieske non-heme iron oxygenase (RO) family, Rieske ferredoxin component; composed of the Rieske ferredoxin component of some three-component RO systems including biphenyl dioxygenase (BPDO) and carbazole 1,9a-dioxygenase (CARDO). The RO family comprise a large class of aromatic ring-hydroxylating dioxygenases found predominantly in microorganisms. These enzymes enable microorganisms to tolerate and even exclusively utilize aromatic compounds for growth. ROs consist of two or three components: reductase, oxygenase, and ferredoxin (in some cases) components. The ferredoxin component contains either a plant-type or Rieske-type [2Fe-2S] cluster. The Rieske ferredoxin component in this family carries an electron from the RO reductase component to the terminal RO oxygenase component. BPDO degrades biphenyls and polychlorinated biphenyls. BPDO ferredoxin (BphF) has structural features consistent with a minimal and perhaps archetypical Rieske protein in that the insertions that give other Rieske proteins unique structural features are missing. CARDO catalyzes dihydroxylation at the C1 and C9a positions of carbazole. Rieske ferredoxins are found as subunits of membrane oxidase complexes, cis-dihydrodiol-forming aromatic dioxygenases, bacterial assimilatory nitrite reductases, and arsenite oxidase. Rieske ferredoxins are also found as soluble electron carriers in bacterial dioxygenase and monooxygenase complexes.	1.00198e-23
NZ_CP018319.1\|WP_076031579.1\|4894706_4896053_+\|glutamine-synthetase	gnl\|CDD\|223252	COG0174, GlnA, Glutamine synthetase [Amino acid transport and metabolism].	5.79183e-92
NZ_CP018319.1\|WP_076030633.1\|4891450_4892653_+\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224172	COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion].	8.86877e-104
NZ_CP018319.1\|WP_008154581.1\|4896272_4896905_-\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	2.3686e-70
NZ_CP018319.1\|WP_076030635.1\|4896936_4898304_-\|histidine-kinase	gnl\|CDD\|226930	COG4564, COG4564, Signal transduction histidine kinase [Signal transduction mechanisms].	2.65807e-161

>NZ_CP018319.1|WP_076030635.1|4896936_4898304_-|histidine-kinase
MQLKHKIVALGILPLMLAIAVICALVISMNRQLGEQQAQLIEDSILASKRAELKNYVEMAQSLIEPLYDDGHGDEHAQQKVLEELRKLSFGINGYFFVYDHEGRSLMHARQSELVGKYLWDMKDPHGLPVIQALLKSAQSGEGFQRYAWNKPSSGQVTDKLAYVVMLDRWGWMLGTGIYLEDVERATQQARDEVAQGIRKTMLAIAAVALVAVLFVFASGMTLNVSEHRLADKKLQRLTQRIVSLQEEERSRVSRELHDGISQLLVSIKFQFELASHLLENGQAHDKGLSTLRDATQRLGEAIGEVRSLSHDLRSSLLDTLGLPAAIGQLAAEFEQRSGLVVTFNDNEFDCHLVDGAAVSLFRIVQEGLTNIERHAQAKNVSITLHGSEDSIRLTVVDDGIGFNVAQVERRHAGIGLRNIRERVEHFGGRFDLISMPGRSELDVWLPMKTPGTTH
>NZ_CP018319.1|WP_008154581.1|4896272_4896905_-|response-regulator-transcription-factor
MNLPYPIRVALVDDHALVRDGIKALLAVMPPLEVVGEAESGADAIEMVGRCQPDLLLVDISLRDMNGLELTRVLRSQYPSLKVLVLSMYDNNEYVSESVRAGASGYVLKNSPSREIIAAIEAIASGGTFYSAEIAQRLIADKNTDNELTPRESQVLYKMAQGLNNKEMARELDISVRTVETHRLSIRRKLNIDKPAALVKYAIDHGIISR
>NZ_CP018319.1|WP_076031579.1|4894706_4896053_+|glutamine-synthetase
MDAVCSDLVAEVRAFRQRFPQVRYVDLISLDIPGHFYGKRYPIEMLEKVAAGSALKLPQNCVLLGTQGGLFKIGDYCFNDGDPDAPRRLVPGTLKPVSWEKQLLGQMLITSSGTEKPIVFEPREVLAQVLERLGRKGIFPVVAFELEFYLFDRQLRDGLPQFPRDQLTDDADDQPNMHIERLSRFSPVLDDMVETARAQGIDATVITAELGPGQFEINFGHLDDGLRAADWAALFCRSTRGVALKHNHRASFMAKPYLQHPGSGMHVHVSLYDEAGTNLLAANDQQALRHAVAGCLEVLPHCMPIFAPNHNAMRRLSGTVNVATRASWGFEDRDACLRVPESDAKNLRIEHRLAGADANPYLVLAAILVGLEHGLEVGREPIASLNEDRGSGIDFPLEMLEAVRAMQNNVQLREGLGAEFVDVYCENKRQDHLAFLHDISAREYRWYL
>NZ_CP018319.1|WP_074875728.1|4894127_4894682_+|helix-turn-helix-domain-containing-protein
MDMQEEISALAILIQDLRKHKKYTLKDLADKIGRSVGFLSQVERGLSRPTVADLTAISETLGVPTTYFYSLPKPMALPWVTRPDERRTLYYADGITDILVSPKMRASFSMLESQLEPGASSGDRHMNDSSEQGGYVLEGELTLWLDDDKPVTLRTGDSFQLASHTHCRYGNLSDRLARVLWVYT
>NZ_CP018319.1|WP_076030634.1|4892812_4894102_+|FAD-binding-oxidoreductase
MFQQSTQHVSSYYAHTCADRLVDRAVLEGEQDTEVLIIGAGFSGLHTALRLALAGKRVTLLEASRVAWAASGRNGGQAILGWSCDMPPLEEALGYERARRLWDSMRWAARELRDLPGRHGFDCDYRPGHLWTSVMPRRVSLLTEWQHEASHKWGHDGLQFISREALPDWVASERYQAGLFDPEGGHLNPLKLALGLAAAIEQAGGCIHEQSKALSYHEEGDRYVVTTERGRIRADVLVLACNAYLDRLDPQLSSCVLPVGTYQVATAPLSKQQATALLPSNVCVTDNQFVLDYFRRTPDNRLLFGGGCTYLGGMPKDIAAATRPYLERVFPQLKGVELDFAWGGHIDLTLKRTPDIGRRGDLYWLQGYSGHGVLPTLAGARAVSDAILGQPDELALYQGLINGSFPGGKYLAAPLEAIGKAWYRLRDSL
>NZ_CP018319.1|WP_076030633.1|4891450_4892653_+|NAD(P)/FAD-dependent-oxidoreductase
MKQHILVIGAGFGGMWTALSATRLFDIHGHSDVEVTVLAPQAELRVRPRFYEPNAHQLAAPIGELFDAVGVQFIKGSAETIDVEQKRVGYVDASGNQRVCNYDKLVLATGSRLALPNTPGVAEHAFDVDQIEQAIRLENHLKSLVNLPESKARNTVVVAGGGFTGIETATEMPARLRAILGDRADIDVIIVDRGEKVGGSMGAEIAKSIVEASIETGVKWRLKSSVVAVDENGVTLTDGQRIDAKTVVWTTGVRASSLTEQIPAERDHLGRLHVDAHLKVIGQEDIFATGDVAYAASDDIGNFALMTCQHAISLGRHAGNNVAAQILGVDPTPYSQPKYVTCLDLGAWGAVYTEGWDRQVKLVREEGKALKTQINTMWIYPPAADRVTALASADPMIPVA
>NZ_CP018319.1|WP_076030632.1|4890598_4891168_-|Rrf2-family-transcriptional-regulator
MSLYSAGVEYGIHCLVFLVGSSGDTREASVRDLAELQGVPQDYLAKIFTKLAKAKLVVATEGVRGGFKLARPSDEISILDIVNAIDGQKLIFDCREIRGRCALFEGSAPAWALAGPCSVHAVMMTAQKRMEDALAQQTILDLARKVGRKAPAQFNAQVDNWINDRREKKINASTQASADPIIQVTEITD
>NZ_CP018319.1|WP_074875721.1|4890259_4890595_+|hypothetical-protein
MRKLIGGVGLALLAGCSLPASLVPGEPNVSKYSDKVPKDYAACVLPAWQREIPNTTQSAISNGYRVTAPSIITADEIVDIVKSKDGSHVSLYQGPPWAKSGALRQAVRDCL
>NZ_CP018319.1|WP_074875719.1|4889969_4890188_+|hypothetical-protein
MTATDEFRFHAHELIVDLDAATTEMMKLISAHQLSGPEWERVTQWQHEAYERWMTYLNERSYPETGDHNAPC
>NZ_CP018319.1|WP_074875717.1|4889559_4889799_-|hypothetical-protein
MWLNESENELRRDLQGLASDLRWSAVELLRIAEQLRLTGNDVDAQAILKLCELFQGDEERLKGYAEEVKAKIITRTKAQ
>NZ_CP018319.1|WP_074875734.1|4899214_4901272_+|carbon-starvation-protein-A
MPRLAKHLAWFAVAVLGAFALSVVALRRGEAINALWIVVAAVAIYLVAYRYYSLFIATKVMQLDPNRATPAVVNNDGLDYVPTNKHVLFGHHFAAIAGAGPLVGPVLAAQMGYLPGTLWLIAGVVLAGAVQDFMVLFMSTRRNGRSLGDMVREEMGRIPGTIALFGCFLIMIIILAVLALIVVKALAESPWGIFTVMATIPIAMFMGIYMRYIRPGRIGEISIVGVLLLLGSIWLGGQIAADPVWAKAFTFTGIQITWMLIGYGFVAAVLPVWLILAPRDYLSTFLKIGTIVALAIGILITMPDLKMPALTQFVDGTGPVWKGGLFPFLFITIACGAVSGFHALIASGTTPKLLASEGHARYIGYGGMLMESFVAIMAMVAASVIEPGVYFAMNSPAALVGSDAVTVAQTVSSWGFAITPEALQAVARDIGETTILARAGGAPTLAVGIAQILHQLLPGENTMAFWYHFAILFEALFILTAVDAGTRAGRFMLQDLLGSFVPALKRTESWTANLIATAGCVAMWGYLLYQGVIDPLGGINTLWPLFGISNQMLAGIALMLATVVLIKMKRQRYVWVTMLPAVWLLICTTTAGFIKLFDANPAIGFLALAKKYSDALANGQILAPAKSIDQMQHVIYNAYTNATLTALFLLVVFSILFFALKVGIAAWGSKERTDKEAPFQALPDA
>NZ_CP018319.1|WP_046049791.1|4901286_4901484_+|YbdD/YjiX-family-protein
MFNDLSRLGKYLGQAARLMVGMPDYDNYVEHMQTKHPDKPVMSYEVFFRERQEARYGSKAGPKCC
>NZ_CP018319.1|WP_076030636.1|4901574_4902288_-|serine/threonine-protein-phosphatase
MLENLEMSRVKRFAANVAGRDFAVGDIHGHFTRLQDALDAAGFNHSVDRLFSVGDLIDRGPECHDALEWLDKAWFHPVRGNHDDYVVYFDTCDVDSWIDNGGSWFMELPLFEKQAFAAQFARLPIAIEIETAYGLIGIVHADCPFPSWQQLRKELESPESNRRLQEVQHYCMWSRRRIDQQEAHGVEGLRALVVGHTPLYMPLSLGNVIHIDTGGWRPDRGYFTLLDLETLETIPAS
>NZ_CP018319.1|WP_074875738.1|4902419_4902623_-|hypothetical-protein
MSTLNEIAANHARMAKALVEASTGPSERHTQIVETFEVPTLDAQHMPLHLIASVQDNPFGQATAYLL
>NZ_CP018319.1|WP_076030637.1|4903091_4903490_+|DUF5329-domain-containing-protein
MWILKVAVIRSIFRQWLIAVSIGLFVAGGVQAQTSPQASQEIKGLLDFVERSECKFVRNGSEYPGPEARAHLEKKLDYLEGKNLVRSAEDFIDLAATKSSMSGKAYQVRCATGVQPASTWLKTELQRQRQRH
>NZ_CP018319.1|WP_076030638.1|4904347_4905328_+|quinone-oxidoreductase
MAKAVRFYETGGPEVLRYEEVEVGDPGPGQVRLRHVAVGLNYADTYFRNGTYPIPMPNGMGVEASGVVQAIGEGVTNVRVGDRVTYTGFLNTLGAYSTERLIPAAPLIKLPETISFETAAAMTMRGLTSSYLMRRIYDFKAGDSILLHAAAGGVGLIVSQWAKLLGLTVIGTVSTAVKGEIALAHGCDHVINYSHEDVAQRVRELTDGVGVNVVFDSVGKNTFMGSLDSLKRRGLMVCVGTASGPIPALDPVLLAMKGSLFMTRPALADYISDPAEKAALAGELFDHVGSGRIKIEINQHYALQDAVQAHRDLESRKTTGSSIFVI
>NZ_CP018319.1|WP_046049436.1|4906277_4907330_+|3-keto-5-aminohexanoate-cleavage-protein
MQFFDDSLHPENMEKVVITVAPYGPEWMPEDFPEDIPLTMDEQVQKAVECYEAGATVLHLHVRELDGKGSKRLSKFNELIAGVREAVPDMIIQVGGSISFAPESDGEAAKWLSDDTRHMLAELTPKPDQVTVAINTTQMNIMELLYPQYLEGTSLANPLYQAAYSEMTVPAGPAWVAEHLKRLMDNGIQPHFQLTGMHAMETLERLVRKGVYKGPLNLTWIGIGGGFDGPNPFNFFNFIHRAPDGCTLTSESLLKNVMPFNTMSMAMGMHPRVGNEDTIIDHKGDRFGSVAQIKQTVRIAHELGREIATGKEAREIYRIGVQYQSIEETLLANGMAPNRKAGQKGVPQRG
>NZ_CP018319.1|WP_074877748.1|4907421_4908753_+|MFS-transporter
MAFHPIAADDDDCSGVGVARKYAWIVFALTFGLLISDYMSRQVLNAVFPMLKGEWALSDGQLGLLSGIVALMVGLLTIPLSLLADRFGRVKSLALMALLWSLATLGCALAQDYQQMFIARFMVGVGEAAYGSVGIAVVISVFPKHMRATLASAFMAGGMFGSVLGMALGGAIAAKLGWRWSFAGMALFGLLLAVLYPIIVKEARIAPQRAAQVANKAAAAVKRPLRTLFSSRSVIAAYIGSGLQLFVGGTVIVWMPSYLNRYYDMATDKAGGLAAIIVLCSGAGMILCGMLSDRLCRHSPERKVALAIAYCLGSCLLLSAAFALPAGPGQLLLICLGMLIAAGTTGPCGAMVANLTHYSVHGTAFATLTLANNMLGLAPGPFITGRVSDLIGLQAAFQLVPLVSIAAAAVFFYAKCHYHKDIARLKGEQVRDSISKAVLEVKL
>NZ_CP018319.1|WP_076030639.1|4908749_4909415_+|DsbA-family-oxidoreductase
MSGRRLRIDVFFDFICPWCLIGKRQLEHAQVQFRSRHPDVQITTVWHGVQLLPQLPVEGEPFADFYRKRLGNADAMTMRQAQVQQAAAAVGLTIDLSHIETMPNTADAHRLFERVSVLGNAAQREMLLERLFAAYFRKRENLGCRETLLAIARACGVDTDVVLDCLTGDATPFEGLPGATSGVPSFQFDRRMTVIGAQPAQALLGAMSQALKESDNERQPA
>NZ_CP018319.1|WP_076030640.1|4909411_4909738_+|Rieske-2Fe-2S-domain-containing-protein
MNRRIPVPAGKLPQAGGRALFEFDDKSLALFNVEGDVFAIDDSCPHQGASLCGGRLDGRVIQCCAHGLRFDLRSGYLLNSTAIKVANYPVEIIDGQAFIVIVAEESAP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

197899 : 204181

uncultured_Caudovirales_phage(83.33%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_076031479.1\|197899_198292_+	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	2.9e-54	80.6
WP_076027900.1\|198293_198656_+	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	9.9e-41	68.3
WP_076027901.1\|198655_198949_+	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	1.4e-32	71.7
WP_074878158.1\|198945_199281_+	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	6.1e-45	80.2
WP_076027902.1\|199277_200279_+	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	1.1e-166	85.3
WP_076027903.1\|200369_201377_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_076027904.1\|201505_202900_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_074878166.1\|202900_204181_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.7e-98	53.3

DBSCAN-SWA_2

2910381 : 2959305

Klosneuvirus(20.0%)

holin,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_074871538.1\|2910381_2912085_-\|holin	choline dehydrogenase	A0A1V0SI18	Klosneuvirus	1.0e-50	29.7
WP_074871536.1\|2912229_2913702_-	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_033060362.1\|2913809_2914403_-	transcriptional regulator BetI	NA	NA	NA	NA
WP_076029476.1\|2914725_2916732_+	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	5.4e-19	25.8
WP_074871534.1\|2916919_2918098_-\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.9e-25	37.1
WP_074871533.1\|2918094_2918940_-\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_076029477.1\|2919017_2919968_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_076029478.1\|2920406_2921783_+	L-serine ammonia-lyase	NA	NA	NA	NA
WP_074871528.1\|2922356_2923460_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_074871527.1\|2923617_2923881_-	hypothetical protein	NA	NA	NA	NA
WP_076029479.1\|2924270_2925434_-	gamma-butyrobetaine dioxygenase	NA	NA	NA	NA
WP_076029480.1\|2925448_2925925_-	4-hydroxybenzoyl-CoA thioesterase	NA	NA	NA	NA
WP_076029481.1\|2926069_2927035_-	L-carnitine dehydrogenase	NA	NA	NA	NA
WP_008151915.1\|2927177_2928065_-	3-keto-5-aminohexanoate cleavage protein	NA	NA	NA	NA
WP_076029482.1\|2928140_2929085_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_076029483.1\|2929307_2930267_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_076029484.1\|2930395_2930812_-	DUF3010 family protein	NA	NA	NA	NA
WP_074871517.1\|2930873_2931275_-	DUF1311 domain-containing protein	NA	NA	NA	NA
WP_007907542.1\|2931511_2932489_+	membrane dipeptidase	NA	NA	NA	NA
WP_008033249.1\|2932567_2933098_+	hypothetical protein	NA	NA	NA	NA
WP_076029485.1\|2933113_2935174_+	dimethylglycine demethylation protein DgcA	NA	NA	NA	NA
WP_076029486.1\|2935395_2937345_+	dimethylglycine demethylation protein DgcB	NA	NA	NA	NA
WP_076029487.1\|2937344_2938565_+	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_030128552.1\|2938580_2939351_+	electron transfer flavoprotein subunit beta	NA	NA	NA	NA
WP_076029488.1\|2939473_2940040_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_038981128.1\|2940881_2942177_-	glycine-betaine demethylase subunit GbcA	NA	NA	NA	NA
WP_074871501.1\|2942459_2943560_+	glycine-betaine demethylase subunit GbcB	NA	NA	NA	NA
WP_076029489.1\|2943665_2944490_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_046045314.1\|2945490_2946531_-	low specificity L-threonine aldolase	NA	NA	NA	NA
WP_076029490.1\|2946662_2947379_+	conjugal transfer protein TraX	NA	NA	NA	NA
WP_074871495.1\|2947664_2948918_+	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	2.0e-101	53.0
WP_007947735.1\|2948941_2950192_+	sarcosine oxidase subunit beta	NA	NA	NA	NA
WP_033053963.1\|2950206_2950536_+	sarcosine oxidase subunit delta	NA	NA	NA	NA
WP_076029491.1\|2950532_2953550_+	sarcosine oxidase subunit alpha	NA	NA	NA	NA
WP_076029492.1\|2953725_2954358_+	sarcosine oxidase subunit gamma family protein	NA	NA	NA	NA
WP_074871490.1\|2954491_2955349_+	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_074871488.1\|2955554_2956754_+	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	6.0e-10	27.4
WP_076029493.1\|2957078_2957639_+	DUF2780 domain-containing protein	NA	NA	NA	NA
WP_076029494.1\|2957640_2958528_-	acyltransferase	NA	NA	NA	NA
WP_076029495.1\|2958798_2959305_+\|protease	ATP-dependent zinc protease	NA	NA	NA	NA

DBSCAN-SWA_3

3781295 : 3791549

Pseudomonas_phage(50.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_076029938.1\|3781295_3782153_+	peptidoglycan DD-metalloendopeptidase family protein	A0A0S2SXL7	Bacillus_phage	8.4e-06	33.3
WP_008154012.1\|3782258_3783266_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	6.6e-34	35.8
WP_008154011.1\|3783748_3784072_-	ferredoxin family protein	NA	NA	NA	NA
WP_076029939.1\|3784214_3786794_-	DNA mismatch repair protein MutS	A0A1V0SJ67	Klosneuvirus	2.0e-26	21.6
WP_076031545.1\|3787005_3787740_+	helix-turn-helix transcriptional regulator	B5TK58	Pseudomonas_phage	4.2e-131	95.1
WP_074879641.1\|3788484_3788832_+\|holin	pyocin R2, holin	B5TK61	Pseudomonas_phage	1.4e-52	88.7
WP_076029940.1\|3789053_3789617_+	glycoside hydrolase family 19 protein	B5TK83	Pseudomonas_phage	7.3e-83	80.1
WP_076031546.1\|3789912_3790413_+	CinA family protein	B5TK85	Pseudomonas_phage	6.7e-72	83.7
WP_076029942.1\|3790496_3791549_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	1.0e-109	59.7

DBSCAN-SWA_4

4284469 : 4293218

Enterobacteria_phage(37.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_076030262.1\|4284469_4285414_+	glycosyltransferase family 2 protein	E7C9N8	Salmonella_phage	6.7e-89	54.4
WP_076030263.1\|4285419_4285806_+	GtrA family protein	NA	NA	NA	NA
WP_083671749.1\|4285852_4286980_-	hypothetical protein	A0A076GD34	Sinorhizobium_phage	6.8e-64	41.8
WP_076030265.1\|4287310_4287859_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	5.1e-49	51.1
WP_076030266.1\|4287858_4288740_-	glucose-1-phosphate thymidylyltransferase RfbA	A0A291LA53	Escherichia_phage	1.8e-99	60.6
WP_076030267.1\|4288747_4289653_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.9e-24	34.2
WP_076030268.1\|4289649_4290750_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	4.0e-85	45.8
WP_156886733.1\|4291120_4291981_+	hypothetical protein	C7U0V2	Enterobacteria_phage	1.4e-05	36.7
WP_076030270.1\|4292051_4293218_-	nucleotide sugar dehydrogenase	M1I798	Paramecium_bursaria_Chlorella_virus	5.5e-109	54.3

DBSCAN-SWA_5

4942496 : 4955152

uncultured_Caudovirales_phage(58.33%)

integrase

attL 4932094:4932110|attR 4952383:4952399

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4932094:4932110	attL	NA	NA	NA	NA
WP_076030664.1\|4942496_4943546_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4JDJ8	uncultured_Caudovirales_phage	3.1e-103	58.0
WP_076030665.1\|4943547_4943790_-	DUF4224 domain-containing protein	A0A2H4JF29	uncultured_Caudovirales_phage	1.3e-09	40.5
WP_076030666.1\|4943834_4944191_-	hypothetical protein	H2BD40	Pseudomonas_phage	7.4e-41	67.9
WP_076030667.1\|4944243_4944678_-	hypothetical protein	NA	NA	NA	NA
WP_076031580.1\|4944836_4945049_+	hypothetical protein	NA	NA	NA	NA
WP_076030669.1\|4945453_4945672_+	hypothetical protein	NA	NA	NA	NA
WP_083671757.1\|4946047_4946422_-	DUF4406 domain-containing protein	L7TKQ2	Pseudomonas_virus	9.0e-21	52.6
WP_076030671.1\|4946418_4947057_-	hypothetical protein	A0A2I7R6M5	Vibrio_phage	5.7e-15	30.7
WP_076030672.1\|4947157_4947400_+	hypothetical protein	NA	NA	NA	NA
WP_076030673.1\|4947396_4947609_-	hypothetical protein	A0A2H4J2C6	uncultured_Caudovirales_phage	9.3e-15	55.1
WP_076030674.1\|4947583_4947784_-	hypothetical protein	NA	NA	NA	NA
WP_076030675.1\|4947935_4948217_+	hypothetical protein	NA	NA	NA	NA
WP_076030676.1\|4949344_4949728_-	hypothetical protein	NA	NA	NA	NA
WP_076030677.1\|4949803_4950265_-	hypothetical protein	A0A2H4J101	uncultured_Caudovirales_phage	1.6e-72	86.9
WP_076030678.1\|4950261_4950504_-	hypothetical protein	A0A2H4J1H1	uncultured_Caudovirales_phage	5.6e-08	46.2
WP_076030679.1\|4950500_4952159_-	Heme peroxidase	A0A2H4J6F0	uncultured_Caudovirales_phage	5.0e-196	75.0
WP_156886770.1\|4952155_4952848_-	hypothetical protein	A0A2H4J1F0	uncultured_Caudovirales_phage	1.7e-118	93.1
4952383:4952399	attR	NA	NA	NA	NA
WP_076030681.1\|4953065_4953260_-	hypothetical protein	Q9MC67	Pseudomonas_phage	5.5e-06	44.4
WP_076030682.1\|4953256_4953448_-	hypothetical protein	NA	NA	NA	NA
WP_076030683.1\|4953444_4953861_-	hypothetical protein	NA	NA	NA	NA
WP_076030684.1\|4954393_4955152_-	hypothetical protein	A0A1B0YZY3	Pseudomonas_phage	2.4e-65	48.9

DBSCAN-SWA_6

4960057 : 4978451

Pseudomonas_phage(60.0%)

terminase,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_076031581.1\|4960057_4960858_-	XRE family transcriptional regulator	A0A0A0YR73	Pseudomonas_phage	1.9e-76	54.8
WP_076030695.1\|4960974_4961184_+	XRE family transcriptional regulator	A0A2H4JF66	uncultured_Caudovirales_phage	1.1e-20	75.8
WP_076030696.1\|4961217_4961571_+	hypothetical protein	NA	NA	NA	NA
WP_076031582.1\|4961593_4961845_+	hypothetical protein	NA	NA	NA	NA
WP_033061777.1\|4962015_4962447_+	Rha family transcriptional regulator	A0A2D1GNM7	Pseudomonas_phage	1.6e-34	55.2
WP_076030697.1\|4962618_4963482_+	replication protein	A0A0S2SYI8	Pseudomonas_phage	9.6e-50	52.7
WP_076030698.1\|4963471_4964278_+	AAA family ATPase	A0A2H4J3E5	uncultured_Caudovirales_phage	4.9e-88	60.3
WP_076030699.1\|4964369_4964837_+	hypothetical protein	A0A0H5AUD0	Pseudomonas_phage	3.3e-65	77.4
WP_076030700.1\|4964818_4965388_+	hypothetical protein	A0A1P8VVT6	Streptococcus_phage	2.1e-21	37.4
WP_076030701.1\|4965384_4965960_+	recombination protein NinG	A0A059VA66	Pseudomonas_phage	1.3e-74	72.0
WP_076030702.1\|4965956_4966502_+	hypothetical protein	A0A0H5AWB8	Pseudomonas_phage	3.5e-58	61.9
WP_076030704.1\|4967086_4967425_+	MFS transporter	A0A088FVG2	Escherichia_phage	1.5e-19	48.2
WP_076030705.1\|4967421_4967766_+	hypothetical protein	A0A193GYR7	Enterobacter_phage	7.3e-09	41.9
WP_076030706.1\|4967786_4968260_+	DUF2514 family protein	NA	NA	NA	NA
WP_076030707.1\|4968312_4968501_+	hypothetical protein	NA	NA	NA	NA
WP_076030708.1\|4968886_4969141_+	hypothetical protein	NA	NA	NA	NA
WP_076030709.1\|4969149_4969767_+	hypothetical protein	G8C7P2	Escherichia_phage	1.3e-27	45.6
WP_076030710.1\|4969768_4971256_+\|terminase	terminase	A0A2H4J2I1	uncultured_Caudovirales_phage	2.0e-257	84.3
WP_076030711.1\|4971252_4972665_+	DUF4055 domain-containing protein	A0A1B0VMH0	Pseudomonas_phage	3.7e-240	87.9
WP_076030712.1\|4972639_4973707_+\|head	phage head morphogenesis protein	A0A2H4J831	uncultured_Caudovirales_phage	1.2e-105	55.6
WP_076031584.1\|4973788_4974517_+	hypothetical protein	A0A1B0VMG1	Pseudomonas_phage	2.9e-100	77.7
WP_076030713.1\|4974528_4975470_+	Ig domain-containing protein	A0A1B0VMF8	Pseudomonas_phage	3.6e-127	70.0
WP_076030714.1\|4975521_4975779_+	hypothetical protein	NA	NA	NA	NA
WP_076030715.1\|4975782_4976283_+	hypothetical protein	A0A1B0VND3	Pseudomonas_phage	5.3e-61	72.7
WP_076030716.1\|4976285_4976675_+	hypothetical protein	A0A1B0VRJ4	Pseudomonas_phage	3.6e-20	45.7
WP_076030718.1\|4977060_4977480_+	hypothetical protein	NA	NA	NA	NA
WP_076030719.1\|4977545_4978451_+	hypothetical protein	A0A2I6PI45	Pseudomonas_phage	1.2e-39	34.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP018320

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 2558

Rhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019694519.1\|1483_1693_-	hypothetical protein	NA	NA	NA	NA
WP_080690697.1\|1811_2558_-	hypothetical protein	A0A068CDF3	Rhizobium_phage	2.5e-22	42.9

DBSCAN-SWA_2

21303 : 34592

uncultured_Caudovirales_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031319755.1\|21303_22047_-	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	5.0e-79	61.1
WP_011117418.1\|23457_24372_-	transcriptional regulator GcvA	NA	NA	NA	NA
WP_011117419.1\|24676_25450_+	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	4.0e-15	28.5
WP_110389057.1\|25941_26259_+	hypothetical protein	NA	NA	NA	NA
WP_011117421.1\|26150_26858_-\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	4.8e-108	85.1
WP_011154423.1\|26815_27202_-\|transposase	transposase	A0A1B0YZU7	Pseudomonas_phage	1.4e-56	88.3
WP_011117423.1\|28028_29645_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-58	43.7
WP_011117424.1\|29881_30073_-	2-hydroxymuconate tautomerase	NA	NA	NA	NA
WP_011117425.1\|30127_30922_-	2-oxo-3-hexenedioate decarboxylase	NA	NA	NA	NA
WP_011117426.1\|30918_31959_-	4-hydroxy-2-oxovalerate aldolase	E5EQ69	Micromonas_sp._RCC1109_virus	2.3e-45	35.8
WP_011117427.1\|31970_32894_-	acetaldehyde dehydrogenase (acetylating)	E5EQ71	Micromonas_sp._RCC1109_virus	5.8e-37	36.6
WP_011117428.1\|32913_33699_-	2-oxopent-4-enoate hydratase	NA	NA	NA	NA
WP_011117429.1\|33710_34592_-	alpha/beta fold hydrolase	A0A023W6C9	Mycobacterium_phage	2.4e-11	39.2

DBSCAN-SWA_3

43679 : 46446

Brucella_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011117436.1\|43679_43976_-	putative addiction module antidote protein	A0A141GEX5	Brucella_phage	4.3e-10	44.6
WP_011117437.1\|43972_44275_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	1.6e-20	53.7
WP_011117438.1\|44484_44889_+	hypothetical protein	NA	NA	NA	NA
WP_011117440.1\|45618_46446_+	DUF945 domain-containing protein	K4F5L3	Cronobacter_phage	3.0e-48	43.7

DBSCAN-SWA_4

70758 : 71526

Brevibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011117384.1\|70758_71526_+	ParA family protein	A0A0K2FLP4	Brevibacillus_phage	3.6e-16	29.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP018319

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP018320

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection