CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP018360	Klebsiella oxytoca strain CAV1752 plasmid pCAV1752-111, complete sequence	0 crisprs	DEDDh	0	0	1	0
NZ_CP018357	Klebsiella oxytoca strain CAV1752 plasmid pCAV1752-3851, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP018358	Klebsiella oxytoca strain CAV1752 plasmid pCAV1752-4374, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP018361	Klebsiella oxytoca strain CAV1752 plasmid pCAV1752-278, complete sequence	0 crisprs	cas3,csa3,RT	0	0	9	0
NZ_CP018359	Klebsiella oxytoca strain CAV1752 plasmid pCAV1752-5521, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP018362	Klebsiella oxytoca strain CAV1752 chromosome, complete genome	6 crisprs	DEDDh,DinG,csa3,cas3,cas14j,WYL	8	15	12	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 110699

114

Salmonella_phage(83.75%)

integrase,transposase,capsid,terminase,tail,portal

attL 30045:30065|attR 52523:52543

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047719664.1\|4253_4589_+\|tail	phage tail protein	J9Q6E1	Salmonella_phage	1.3e-42	70.0
WP_076751945.1\|4643_5342_+\|tail	phage minor tail protein L	J9Q7Y5	Salmonella_phage	4.3e-101	75.2
WP_047719666.1\|5331_6135_+	C40 family peptidase	J9Q7R4	Salmonella_phage	7.9e-115	74.8
WP_047719667.1\|6122_6734_+\|tail	tail assembly protein	J9Q7F8	Salmonella_phage	3.6e-59	57.1
WP_076751947.1\|6745_19171_+	DUF1983 domain-containing protein	J9Q713	Salmonella_phage	2.8e-41	60.5
WP_076751949.1\|19218_20763_+\|tail	tail fiber domain-containing protein	A0A0H4TGH1	Klebsiella_phage	1.7e-44	40.1
WP_009484919.1\|20845_21160_+	hypothetical protein	J9Q6E7	Salmonella_phage	2.3e-33	69.8
WP_076751951.1\|21170_21863_+	hypothetical protein	J9Q7Y7	Salmonella_phage	8.9e-99	76.2
WP_076751953.1\|21859_22111_+	hypothetical protein	NA	NA	NA	NA
WP_076751956.1\|22333_22543_-	hypothetical protein	NA	NA	NA	NA
WP_076751958.1\|22673_23192_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_064383558.1\|23196_23469_-	DUF1778 domain-containing protein	NA	NA	NA	NA
WP_047719673.1\|23777_24443_+	AAA family ATPase	J9Q7R7	Salmonella_phage	4.1e-93	75.2
WP_047719674.1\|24447_24822_+	hypothetical protein	J9Q7G3	Salmonella_phage	9.9e-20	54.3
WP_076751960.1\|25150_25897_+	hypothetical protein	J9Q7R8	Salmonella_phage	5.7e-75	55.2
WP_047719676.1\|25935_27297_+	AAA family ATPase	J9Q7G4	Salmonella_phage	1.6e-179	69.8
WP_076751962.1\|27432_28548_+	DNA primase	J9Q720	Salmonella_phage	4.4e-148	66.3
WP_047719678.1\|28613_29522_+	hypothetical protein	NA	NA	NA	NA
WP_047719679.1\|29608_30064_+	hypothetical protein	J9Q7R9	Salmonella_phage	4.6e-27	42.4
30045:30065	attL	NA	NA	NA	NA
WP_047719680.1\|30060_30525_+	DUF1653 domain-containing protein	NA	NA	NA	NA
WP_047719681.1\|30524_31853_+	DNA ligase	J9Q7G5	Salmonella_phage	4.4e-187	71.5
WP_047719682.1\|31849_32065_+	hypothetical protein	J9Q6I3	Salmonella_phage	2.2e-16	57.1
WP_047719683.1\|32219_32471_+	hypothetical protein	NA	NA	NA	NA
WP_076751964.1\|33618_34230_+	hypothetical protein	S4TP42	Salmonella_phage	7.8e-22	35.6
WP_148723003.1\|34345_35128_+	hypothetical protein	Q858S3	Enterobacteria_phage	2.4e-23	41.2
WP_076751966.1\|35351_35597_+	hypothetical protein	A0A1S6UB66	Serratia_phage	3.3e-16	54.3
WP_076751968.1\|35606_35852_+	GrxA family glutaredoxin	A0A1L2CUT4	Pectobacterium_phage	1.8e-09	44.6
WP_076751969.1\|35939_36161_-	hypothetical protein	NA	NA	NA	NA
WP_148723004.1\|36135_36693_-	hypothetical protein	NA	NA	NA	NA
WP_076751971.1\|36912_37965_+\|integrase	site-specific integrase	A0A1W6JPG6	Morganella_phage	3.9e-21	27.2
WP_047719694.1\|37954_38260_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_076751973.1\|38864_40838_+	hypothetical protein	J9Q7G6	Salmonella_phage	1.7e-126	45.1
WP_076751975.1\|40934_42173_+	AAA family ATPase	J9Q733	Salmonella_phage	9.6e-144	61.0
WP_076751977.1\|42350_44723_+	DNA polymerase III subunit alpha	J9Q7Z2	Salmonella_phage	1.1e-310	67.1
WP_076751979.1\|44793_45954_+	uracil-DNA glycosylase	J9Q7Z2	Salmonella_phage	1.0e-139	61.3
WP_076751980.1\|45950_46373_+	hypothetical protein	J9Q7S4	Salmonella_phage	2.7e-13	37.0
WP_117093564.1\|46460_47580_+\|transposase	IS3-like element ISKpn34 family transposase	S5WIU1	Leptospira_phage	6.6e-51	43.3
WP_076751982.1\|47679_48945_-	hypothetical protein	NA	NA	NA	NA
WP_076751984.1\|49046_49442_-	DNA-binding protein	Q71TH9	Escherichia_phage	1.8e-43	62.7
WP_177952556.1\|49577_49742_+	hypothetical protein	NA	NA	NA	NA
WP_076751986.1\|49741_50182_+	hypothetical protein	J9Q6I8	Salmonella_phage	2.2e-34	49.7
WP_076751988.1\|50248_51241_+	hypothetical protein	J9Q7Z3	Salmonella_phage	1.6e-61	45.6
WP_076751990.1\|51301_52264_+	exonuclease	J9Q7S6	Salmonella_phage	1.4e-118	64.1
WP_047719702.1\|52260_52521_+	hypothetical protein	NA	NA	NA	NA
WP_076751992.1\|52538_53603_+	recombinase	J9Q736	Salmonella_phage	3.7e-152	73.8
52523:52543	attR	NA	NA	NA	NA
WP_076751994.1\|53668_54922_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_076751996.1\|54925_56941_-	ATP-dependent helicase	NA	NA	NA	NA
WP_076751998.1\|56981_59663_-	class I SAM-dependent DNA methyltransferase	Q6NE04	Leptospira_phage	1.3e-169	40.0
WP_077274229.1\|59914_60106_+	hypothetical protein	NA	NA	NA	NA
WP_076752001.1\|60289_60637_+	hypothetical protein	NA	NA	NA	NA
WP_076752002.1\|60633_60846_+	hypothetical protein	NA	NA	NA	NA
WP_047719710.1\|61112_62237_-	RepB family plasmid replication initiator protein	J9Q7H0	Salmonella_phage	2.7e-76	48.3
WP_076752070.1\|62555_63203_+	hypothetical protein	J9Q739	Salmonella_phage	2.7e-65	55.7
WP_076752004.1\|63439_64525_+	metallophosphoesterase	J9Q7S9	Salmonella_phage	1.1e-148	71.5
WP_076752006.1\|64521_66438_+	AAA family ATPase	J9Q741	Salmonella_phage	3.5e-209	60.7
WP_076752008.1\|66427_67126_+	hypothetical protein	NA	NA	NA	NA
WP_076752010.1\|67142_67658_+	hypothetical protein	J9Q7Z7	Salmonella_phage	1.0e-51	58.9
WP_117093564.1\|67667_68788_-\|transposase	IS3-like element ISKpn34 family transposase	S5WIU1	Leptospira_phage	6.6e-51	43.3
WP_076752072.1\|69022_71353_+	ribonucleoside-diphosphate reductase subunit alpha	J9Q7T0	Salmonella_phage	0.0e+00	70.9
WP_076752012.1\|71448_71853_+	DUF2591 family protein	NA	NA	NA	NA
WP_047719716.1\|71866_73009_+	ribonucleotide-diphosphate reductase subunit beta	J9Q7H3	Salmonella_phage	1.3e-179	80.0
WP_052959175.1\|73202_73949_+	hypothetical protein	J9Q742	Salmonella_phage	1.6e-61	51.0
WP_076752014.1\|74144_75236_+	thymidylate synthase	J9Q6J6	Salmonella_phage	5.3e-130	59.2
WP_077274225.1\|75249_75651_+	hypothetical protein	J9Q7Z8	Salmonella_phage	4.8e-12	36.6
WP_187420812.1\|75659_76124_+	dihydrofolate reductase	J9Q7T1	Salmonella_phage	1.1e-44	55.3
WP_076752020.1\|76120_76771_+	AAA family ATPase	J9Q7H4	Salmonella_phage	2.3e-27	37.0
WP_076752022.1\|76825_77233_+	hypothetical protein	J9Q743	Salmonella_phage	7.0e-11	38.3
WP_076752024.1\|77229_77781_+	3'-5' exonuclease	J9Q6J8	Salmonella_phage	1.4e-54	58.1
WP_076752026.1\|78135_78948_+	hypothetical protein	J9Q7Z9	Salmonella_phage	3.1e-26	42.1
WP_077274226.1\|78948_79302_+	hypothetical protein	NA	NA	NA	NA
WP_076752028.1\|79468_80092_+	phage N-6-adenine-methyltransferase	J9Q7T2	Salmonella_phage	1.7e-77	70.6
WP_076752030.1\|80275_80500_+	hypothetical protein	J9Q7H5	Salmonella_phage	1.5e-15	51.4
WP_077274230.1\|81072_81636_+	ribonuclease HI	J9Q745	Salmonella_phage	6.5e-31	39.1
WP_047719727.1\|82289_82715_+	tellurite resistance TerB family protein	Q71TK7	Escherichia_phage	4.1e-54	77.3
WP_047719728.1\|82714_82870_+	DUF3927 family protein	NA	NA	NA	NA
WP_076752079.1\|82933_83683_+	Rha family transcriptional regulator	J9Q7T3	Salmonella_phage	5.9e-80	64.3
WP_047719619.1\|83770_84205_+	hypothetical protein	NA	NA	NA	NA
WP_076752031.1\|84260_84578_+	energy transducer TonB	NA	NA	NA	NA
WP_047719621.1\|84730_85024_+	hypothetical protein	NA	NA	NA	NA
WP_076752033.1\|85205_85856_-	hypothetical protein	G8C7R6	Escherichia_phage	1.5e-55	48.1
WP_047719623.1\|85865_86165_-	hypothetical protein	A0A192Y8D4	Enterobacteria_phage	3.1e-08	34.3
WP_047719624.1\|86300_86561_+	hypothetical protein	NA	NA	NA	NA
WP_047719625.1\|86557_87208_+	HD domain-containing protein	J9Q7H7	Salmonella_phage	2.4e-53	54.2
WP_076752035.1\|87311_88979_+	DUF4942 domain-containing protein	J9Q747	Salmonella_phage	7.2e-211	64.8
WP_047719627.1\|88987_89167_+	hypothetical protein	NA	NA	NA	NA
WP_047719628.1\|89208_89820_+	hypothetical protein	NA	NA	NA	NA
WP_076752037.1\|89893_90121_+	hypothetical protein	NA	NA	NA	NA
WP_148719562.1\|90435_91452_+\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	2.4e-185	99.1
WP_013815099.1\|91550_92519_+\|transposase	IS5-like element IS903B family transposase	A0A1B0VFY5	Salmonella_phage	1.0e-185	99.1
WP_076752039.1\|92564_93125_-	hypothetical protein	J9Q754	Salmonella_phage	2.1e-34	48.7
WP_047739735.1\|93433_93742_-	hypothetical protein	NA	NA	NA	NA
WP_139153313.1\|93756_94290_-	hypothetical protein	NA	NA	NA	NA
WP_139153314.1\|94354_94708_-	hypothetical protein	NA	NA	NA	NA
WP_076752041.1\|94753_96331_-	DEAD/DEAH box helicase	J9Q7I4	Salmonella_phage	4.7e-212	70.6
WP_076752043.1\|96396_97110_+	ParB N-terminal domain-containing protein	J9Q756	Salmonella_phage	5.8e-85	67.0
WP_076752044.1\|97093_97768_+	ParB N-terminal domain-containing protein	J9Q6L1	Salmonella_phage	7.7e-71	65.3
WP_076752045.1\|97760_98402_+	ABC transporter	J9Q807	Salmonella_phage	2.1e-94	84.4
WP_076752047.1\|98391_98949_+	hypothetical protein	NA	NA	NA	NA
WP_076752049.1\|98945_99836_+	hypothetical protein	J9Q7I6	Salmonella_phage	4.0e-136	77.7
WP_047719648.1\|99845_100112_+	hypothetical protein	J9Q757	Salmonella_phage	1.0e-31	76.1
WP_076752051.1\|100282_100873_+	DNA-binding protein	J9Q6D4	Salmonella_phage	1.3e-58	61.8
WP_076752053.1\|100872_102129_+\|terminase	terminase	J9Q7Y2	Salmonella_phage	1.5e-229	88.5
WP_076752055.1\|102160_103735_+\|portal	phage portal protein	J9Q7R1	Salmonella_phage	6.7e-227	73.0
WP_076752057.1\|103747_104608_+	hypothetical protein	J9Q7F4	Salmonella_phage	9.8e-79	57.1
WP_047719653.1\|104637_105510_+\|capsid	phage capsid protein	J9Q710	Salmonella_phage	1.0e-131	81.4
WP_076752059.1\|105583_106027_+	Ig domain-containing protein	J9Q6D6	Salmonella_phage	1.3e-21	43.2
WP_076752061.1\|106068_106494_+	hypothetical protein	J9Q7Y3	Salmonella_phage	1.6e-42	63.6
WP_076752063.1\|106493_107327_+	hypothetical protein	J9Q7R2	Salmonella_phage	7.0e-74	48.9
WP_076752065.1\|107337_107682_+	hypothetical protein	J9Q7F6	Salmonella_phage	5.0e-34	57.9
WP_047719658.1\|107672_108167_+	hypothetical protein	J9Q711	Salmonella_phage	1.4e-34	51.2
WP_077257922.1\|108163_108547_+	hypothetical protein	J9Q6D8	Salmonella_phage	1.7e-30	44.4
WP_076752066.1\|108639_109080_+	hypothetical protein	NA	NA	NA	NA
WP_047719662.1\|110028_110346_+	hypothetical protein	J9Q7R3	Salmonella_phage	4.8e-31	66.7
WP_047719731.1\|110471_110699_+	hypothetical protein	J9Q7F7	Salmonella_phage	4.0e-24	76.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP018362

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP018362_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018362_1

2423232-2423318

Orphan

Consensus_repeat	Method
AATCGTGTTCCCACTGTTCCCAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP018362_1

>merge|NZ_CP018362|1|2423232-2423318|CRISPRCasFinder
AATCGTGTTCCCACTGTTCCCACCTGGGTGCAGGTGGTGGGAACAGAAAAAACTCTTTTAAATCAATCTTGTTCCCACTGTTCCCAC

>NZ_CP018362|1|1|2423232-2423318|CRISPRCasFinder
AATCGTGTTCCCACTGTTCCCAC	CTGGGTGCAGGTGGTGGGAACAGAAAAAACTCTTTTAAATC
AATCTTGTTCCCACTGTTCCCAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018362.1\|WP_009651862.1\|2418908_2419415_-\|G/U-mismatch-specific-DNA-glycosylase	unknown	unknown	gnl\|CDD\|182301
NZ_CP018362.1\|WP_001144069.1\|2413622_2413838_+\|30S-ribosomal-protein-S21	unknown	unknown	gnl\|CDD\|234707
NZ_CP018362.1\|WP_014839584.1\|2412371_2413385_-\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD	unknown	unknown	gnl\|CDD\|236585
NZ_CP018362.1\|WP_014226896.1\|2410716_2412324_+\|cytosine-permease	unknown	unknown	gnl\|CDD\|224374
NZ_CP018362.1\|WP_038423682.1\|2418176_2418839_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP018362.1\|WP_076752402.1\|2428601_2429189_-\|host-cell-division-inhibitor-Icd-like-protein	unknown	unknown	gnl\|CDD\|371132
NZ_CP018362.1\|WP_076752391.1\|2419727_2421011_-\|P2-family-phage-major-capsid-protein	unknown	unknown	gnl\|CDD\|368296
NZ_CP018362.1\|WP_076752394.1\|2423400_2423658_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018362.1\|WP_076752398.1\|2427814_2428045_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018362.1\|WP_076752392.1\|2421013_2421748_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018362.1\|WP_004105908.1\|2416091_2417936_+\|RNA-polymerase-sigma-factor-RpoD	unknown	unknown	gnl\|CDD\|235549
NZ_CP018362.1\|WP_076752395.1\|2423668_2424646_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|222904
NZ_CP018362.1\|WP_076752396.1\|2424663_2427330_-\|DUF927-domain-containing-protein	unknown	unknown	gnl\|CDD\|336282
NZ_CP018362.1\|WP_076752403.1\|2429695_2430637_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018362.1\|WP_014226898.1\|2414072_2415818_+\|DNA-primase	unknown	unknown	gnl\|CDD\|235551
NZ_CP018362.1\|WP_076752399.1\|2428037_2428232_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018362.1\|WP_032731274.1\|2429342_2429534_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|378935
NZ_CP018362.1\|WP_076752393.1\|2422155_2422422_-\|ogr/Delta-like-zinc-finger-family-protein	unknown	unknown	gnl\|CDD\|368019
NZ_CP018362.1\|WP_076752400.1\|2428224_2428416_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018362.1\|WP_142499986.1\|2427387_2427759_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP018362.1\|WP_009651862.1\|2418908_2419415_-\|G/U-mismatch-specific-DNA-glycosylase	gnl\|CDD\|182301	PRK10201, PRK10201, G/U mismatch-specific DNA glycosylase.	7.75741e-125
NZ_CP018362.1\|WP_001144069.1\|2413622_2413838_+\|30S-ribosomal-protein-S21	gnl\|CDD\|234707	PRK00270, rpsU, 30S ribosomal protein S21; Reviewed.	8.25342e-17
NZ_CP018362.1\|WP_014839584.1\|2412371_2413385_-\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD	gnl\|CDD\|236585	PRK09604, PRK09604, tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD.	0
NZ_CP018362.1\|WP_014226896.1\|2410716_2412324_+\|cytosine-permease	gnl\|CDD\|224374	COG1457, CodB, Purine-cytosine permease and related proteins [Nucleotide transport and metabolism].	4.11908e-18
NZ_CP018362.1\|WP_038423682.1\|2418176_2418839_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	3.58472e-13
NZ_CP018362.1\|WP_076752402.1\|2428601_2429189_-\|host-cell-division-inhibitor-Icd-like-protein	gnl\|CDD\|371132	pfam10554, Phage_ASH, Ash protein family. This family was identified by Iyer and colleagues. It includes the Ash protein from bacteriophage P4.	3.15533e-16
NZ_CP018362.1\|WP_076752391.1\|2419727_2421011_-\|P2-family-phage-major-capsid-protein	gnl\|CDD\|368296	pfam05125, Phage_cap_P2, Phage major capsid protein, P2 family.	1.45081e-107
NZ_CP018362.1\|WP_032731274.1\|2429342_2429534_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|378935	pfam12728, HTH_17, Helix-turn-helix domain. This domain is a DNA-binding helix-turn-helix domain.	4.92419e-06
NZ_CP018362.1\|WP_004105908.1\|2416091_2417936_+\|RNA-polymerase-sigma-factor-RpoD	gnl\|CDD\|235549	PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated.	0
NZ_CP018362.1\|WP_076752395.1\|2423668_2424646_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|222904	PHA02601, int, integrase; Provisional.	1.05535e-168
NZ_CP018362.1\|WP_076752396.1\|2424663_2427330_-\|DUF927-domain-containing-protein	gnl\|CDD\|336282	pfam06048, DUF927, Domain of unknown function (DUF927). Family of bacterial proteins of unknown function. The C-terminal half of this family contains a P-loop motif. The N-terminal domain appears to have a unique fold, which contains three Helices and two strands. Structural analyses show that helicases containing this domain form a hexameric ring with a positively charged central pore threading a single DNA strand through suggestive of a replicative function for this helicase.	3.12932e-104
NZ_CP018362.1\|WP_014226898.1\|2414072_2415818_+\|DNA-primase	gnl\|CDD\|235551	PRK05667, dnaG, DNA primase; Validated.	0
NZ_CP018362.1\|WP_076752393.1\|2422155_2422422_-\|ogr/Delta-like-zinc-finger-family-protein	gnl\|CDD\|368019	pfam04606, Ogr_Delta, Ogr/Delta-like zinc finger. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F. This family also includes zinc fingers in recombinase proteins.	3.44625e-15

>NZ_CP018362.1|WP_076752393.1|2422155_2422422_-|ogr/Delta-like-zinc-finger-family-protein
MFTCPHCGHTAHTRTSRRLSDFTVRQYHQCQNLECSAAFTTLNAYEGLIPQRRRKDIAGGEVPQKAVAPGKAEGGRAFKPGADPETIP
>NZ_CP018362.1|WP_076752392.1|2421013_2421748_-|hypothetical-protein
MSIDKKTTALAENIEEKHKAFEEKRTILVEKQTTLKNLLATRESLKEEAHHQSDEWERNLLASGGVETEASDTTTFLSGMAMQKLERINPLIEKAQAEVIIARFDAGKAALEYINQHKELRSLVIEPECRALMGSLRPVLEIAWGLHCMTQGMDYEFDNMLKDVLNDVKKSDNSHPAEQHLQAASGDAETPLSLFPGPVPSVMKEVIRRSPSAAQMAMARTSPQKMQALADGREPCKGLSQGGA
>NZ_CP018362.1|WP_076752391.1|2419727_2421011_-|P2-family-phage-major-capsid-protein
MNPLDRARALFYKNIEAMKTATPAIQAELERENQKLGEEISRLANEAEFQARNEGNSNNASPSFFSASEPGRLTPPAAVIPGDQEQRSMMTVIGNILTAVSRDDAVQLGTVPGKEAIAIYSEVTPTPALTGGLAPSHGTDFLTKINVVPVTDQEGERVLVGAGPLASINNSGRRNPQNMASLTPHRYQCRKVNLDVSIPYADLESWATVENYPELVKAAIDRQRALDRLLVGFHGTHYADPSDASAYPKRQDCGVGWLEKYRQEAPQRVISGLSVAGRDESNKIIASGDYGTVDALVLDGWQSAIAEQYRNGLVSICSAETLFRKEWPFVRHLSPDRPNYERLINDIMLKNPTIGGLPAVVVPFFPDDAVWVTTLSNISLYWQKNGVRKQAKDEPEYNRLAMYESRNDAYMVENYEAGCLIDGIDWR
>NZ_CP018362.1|WP_009651862.1|2418908_2419415_-|G/U-mismatch-specific-DNA-glycosylase
MINDILAPDLRVVFCGINPGKSSAHTGFHFAHPGNRFWKVIHQAGFTDRLLKPEEELQLLDTRCGITMLVERPTVQASEVELLELRDGGRELVRKMEEYQPRALAILGKQAFEKAFQVRGVKWGKQQVTIGATEVWVLPNPSGLNRATLDKLVEAYRELDEALATRGL
>NZ_CP018362.1|WP_038423682.1|2418176_2418839_+|TetR/AcrR-family-transcriptional-regulator
MNSKRKIQLADFNRTVILTTANTLFLSRGIESTTMDEIAHEAGFSKTTLYTYFDNKKDILDHLILEVMARFYQELIPIANRQNSFREFYRELCHALMALHETSLAYFSAIAGKIACSEKITKNNKALKNIAMTGEQIHQLIAKRITDATEKKEIGLNAPVADVMMLFWLCLTGLVEKSSYREECLLRHLEKDRKAFLDFAFDALLFMIEKGNISDCEKAD
>NZ_CP018362.1|WP_004105908.1|2416091_2417936_+|RNA-polymerase-sigma-factor-RpoD
MEQNPQSQLKLLVQRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVMEEAPDADDLLLAETNNNTDEDAEEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEIDIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDMAPTATHVGSELSQEEMDDDEDEDEEEDDDSSDDDNSIDPELAREKFAELRTQYELTRDTIKAKGRSHAAAQEEILKLSEVFKQFRLVPKQFDYLVNSMRIMMDRVRTQERIIMKLCVEQCKMPKKNFITLFTGNETSETWFNAAIAMNKPWSEKLLDVKEDVQRGLMKLQQIEQETGLTIEQVKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGREPTPEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDNTLELPLDSATTESLRAATHDVLAGLTAREAKVLRMRFGIDMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD
>NZ_CP018362.1|WP_014226898.1|2414072_2415818_+|DNA-primase
MAGRIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCPFHNEKTPSFTVNGEKQFYHCFGCGAHGNAIDFLMNYDKLEFVETVEELAAMHNLDVPYEAGSGPSQIERHQRQNLYQLMDGLNTFYQQSLMQPAAGPARQYLEKRGLSSEVITRFAIGYAPPGWDNVLKRFGGNQENRQSLIDAGMLVTNDQGRSYDRFRERVMFPIRDKRGRVIGFGGRVLGDAMPKYLNSPETDIFHKGRQLYGLYEAQQDNAEPPRLLVVEGYMDVVALAQFGINYAVASLGTSTTADHIQLLFRVTNQVVCCYDGDRAGRDAAWRALETALPYMTDGRQLRFMFLPDGEDPDTLVRKEGKAAFEARMEQAQPLSTFLFNSLLPQVDLSTPDGRAQLSTLALPLITQVPGETLRIYLRQELGNKLGILDDAQLERLMPKQSENGIQRPAPQLKRTTMRILIGLLVQNPDLAPLVPPLEGLDPRKMPGLGLFNELVKTCLAQPGLTTGLLLEQYRGTNEAATLEKLSMWDDIADKDIAEKTFTDSLNHMFDSLLELRQEELIARDRTHGLSSEERRELWTISQELAKK
>NZ_CP018362.1|WP_001144069.1|2413622_2413838_+|30S-ribosomal-protein-S21
MPVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKLARENARRTRLY
>NZ_CP018362.1|WP_014839584.1|2412371_2413385_-|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD
MRVLGIETSCDETGIAIYDDEKGLLANQLYSQVKLHADYGGVVPELASRDHVRKTVPLIQAALKEAGLTAKDIDAVAYTAGPGLVGALLVGATVGRSLAFAWNVPAIPVHHMEGHLLAPMLEDNPPQYPFVALLVSGGHTQLIGVTGIGQYELLGESIDDAAGEAFDKTAKLLGLDYPGGPMLSKMASQGTAGRFVFPRPMTDRPGLDFSFSGLKTFAANTIRSNGDDDQTRADIARAFEDAVVDTLMIKCRRALDQTGFKRLVMAGGVSANRTLRAKLAEMMKKRGGEVFYARPEFCTDNGAMIAYAGMVRLRSGAKAELGVTVRPRWPLAELPAA
>NZ_CP018362.1|WP_014226896.1|2410716_2412324_+|cytosine-permease
MSSLDIKTDLPAQTSASGSKETLEDYTLRYAPLSFRRWGPGVVAVTALGGIAYLADFSIGASIGMAWGTTNAIYAILLAALVIFLTGIPLAITAARYNIDLDLITRSAGFGYFGSVITSIIFAGFTFIFFALEGSIMAQGLLVGLGIPLWMGYLIATLMVLPLVVYGMKALTRLQVWTTPLWLVLMVVPVVWLIAKDPDLVDGFMNFAGKNNASTVDLTAIMLGAGVCLSLIMQIGEQIDYLRFMPPKTAENSKSWWLAVFSAGPGWVVLGAIKQIIGAFLGFYLLTRFPAVHNTEPVQQFVSVFDNLVPGWLALTLAVVLVVISQIKINVTNAYSGSLAWTSAWTRTTKRYPGRIIFVIVNLTIALALMEGDMFSALAWILGFYSNFAIAWVVVVATDITVNKGVLKLAPAQPEYRRGMIYNVNPVGVVSFALAAGLSISAFFGLLGETLAPFSPLIALAVAFVMTPVMGIATRGRYYIKQHDDGIAEPRYDAQGNASITVYRCLSCREEYERPDVMHSHKHQGAICSLCKSME
>NZ_CP018362.1|WP_076752394.1|2423400_2423658_-|hypothetical-protein
MIMVLMGSWLYAGFFLPAALPEMTVLDKVASTVKSDRVSRIIIVEPALTMGCAESGEKSPSETTVSDVKSPAGGSLRHTGMDRHL
>NZ_CP018362.1|WP_076752395.1|2423668_2424646_-|tyrosine-type-recombinase/integrase
MSIKKLPDGQYKVDIRPYGYAGRRIRKVFERKAEAIAFERYTIVNASQKEWSGRRSDRRHLSVLAEAWWRYYGQTLDNGKKEFNHLNKTINGLGDPVVSRLNKRGLMDYRARRLAAGIKASTINREIYRLSGMFTRLIQIDEFSGSNPVKGMPPLAEENPEMTFLEQGEISRLLKVLEGDCLLIALLCLSTGGRWGEVATLRPSNIVNCRVTFLKTKNGKKRTVPISEELENKVKKEASGKLFKVDYEKFCKILRQVKPDIPANQATHILRHTFASHFMMNGGNIIALQQILGHANIQQTMVYAHLSPEYLADAVRLGPVSGLDL
>NZ_CP018362.1|WP_076752396.1|2424663_2427330_-|DUF927-domain-containing-protein
MKNIKVSEISKQSVGKWEFILQSLGIKIPEGGKHGPCPKCGGKDRFRFDNKDGRGTWFCNHCGSGDGIDIVKLVFDIDTVPAAARIAECLPSASEVNISARKKAARQAAPVNWPAIFGQSVTGESPYLVGKGLTGYVSRLSTRELMAGGEKYPAGSLMLPVKNSLGAITGIQLIRSDGVKSLMKGSKYSGCFIPVSDFPEEAPEKVAIAEGYGTAVSVSLLSDAWPLAALSKTNLKAAAEAVRERWPEAQIIIAGDNDFMDGKPNEGREVAIKAALAVKGWVSIPPGRAKADWDDYRRDFGVQRARESFAEEMFNPGDTETRLPPGFRLTKEFLWCERTRNDGSESGQVQQIKICSPLKVTAITCDADGGNFGRLLEWDDSNGSRHEWAMPMTVLAGAGQDLREVLLENGLHFISVNGSARGLLMEYIATCRPVRKVTCVEKTGWYGGSYVLNGEVIGGETGSVIFQAARSSKNDFRVSGDTREWMKHVGRYCAGNSRLVFCVSLAFAAPLLTLLGMGGGGYHLKGESTDGKTTTMKVAASVCGGPDYWKTWRATGNALEGIALRRNDAVLMLDEISEVDGKEASRIAYMLGNGQGKARARVDGSPREQAQWTLLFLSTGEVSIAEHAAEAGERRTGAGVGVRMVQIPSNTGQFGAFEELHGFGGGKAFAEHLEQASRQYHGAVFRDWLRWLTANLNAVTERARALRKKYEKTLLPENAGNQVGRVVDRFALLAVAGELATEAGITGWEPGEAERAARKCLDAWIQDRGHTANQEDADALEKVRRFITMNQYTRFAEWEESEKNRPANMVGFRHVIKGNNNTEPDTKYYILSSGWKEICGTSDTVKTARLCSEAGWLDTDDGKRLQRKVRLPEIGSKWVYVFKSDVVG
>NZ_CP018362.1|WP_142499986.1|2427387_2427759_-|hypothetical-protein
MSQNQITENNINSQDTNLWSRDYAWLLSEESYWRLDDVINISRLLEDLLDSKAEMKHETSVSASQMGSLFKVMLKELDAIKSELPRRDGIFSQGEVDLGLRAVRLFGVHQVKEMIDKAAEGEH
>NZ_CP018362.1|WP_076752398.1|2427814_2428045_-|hypothetical-protein
MANIFRGKVTRNKTYLVSGYAVTPKGHTRSAEATVEALNRDEAIILATAQLRWEGLKYFKALRVLEITTPLISKLH
>NZ_CP018362.1|WP_076752399.1|2428037_2428232_-|hypothetical-protein
MYEIHVKARNVITGDTSFYRHSKKYNSPGKAAREARRLVDDITLNGSYLDENEYTVTVGKVKHG
>NZ_CP018362.1|WP_076752400.1|2428224_2428416_-|hypothetical-protein
MYKLIITLINYQTGDQRNLVNNWRYKTSDEAWIDANKMAYVRKGDDGKTTHECRVKVVGVSHV
>NZ_CP018362.1|WP_076752402.1|2428601_2429189_-|host-cell-division-inhibitor-Icd-like-protein
MPHGKINSKYCLTTSPDGSQNPDVAAKSATGRENPSMLSATTDAPCVFFYVAINATERHIMAWCVHSGHSIAGHEQVAHHSAMSMVAQAGQLSGWPVSDNAGILTPVWAIAIERENSGDSVLSAVIGGCLMATTPSYLHPQFIWIFLAVRRSDVLAKPQRKEVTAPDLTSARRVIARDFVASFAGRLPIREVPHV
>NZ_CP018362.1|WP_032731274.1|2429342_2429534_-|helix-turn-helix-domain-containing-protein
MEIRDRMTRKEAASYIGVSTATMANWACTGKVKLPYYKAGLKKVIYLKSDLDDYLKSTRRLQA
>NZ_CP018362.1|WP_076752403.1|2429695_2430637_-|hypothetical-protein
MKRKTINQNEPQVTNIRVPAEFFDIQSLAVDSWISFRKNNLIEGALMSVDELDSIATQFLFSIHKYGFNGIGTLDTVRDLLEQYYVDGKDIISFFEFIVRIAKDELDKKINIKFNEMSAHLKLKFNGERLIAPNVVISSIRDFLNDNGLVFIEEREIKILSGGVCLKDDYFSYETEVFSLISDYVVGRVIVSPYTNILIEFFRDNSDIRHKNEQGESKVRPSSKKGPRNPELYSYIIKIVDATLLKNPNATTYALTEKLGGHLEEYRHNHPERKNWRISENQLRRWIKEHRELTGQDSQGKHDGNLKLEGITY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP018362_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018362_2

3083408-3083498

Orphan

Consensus_repeat	Method
CCGCCTGCGATCGGGTAGCCCGGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP018362_2

>merge|NZ_CP018362|2|3083408-3083498|CRISPRCasFinder
CCGCCTGCGATCGGGTAGCCCGGATAAGGCGACAGCCGCCATCCGGGGGATTCAATCCGCTTCACAGCCGCCTGCGTTCGGGTAGCCCGGA

>NZ_CP018362|2|2|3083408-3083498|CRISPRCasFinder
CCGCCTGCGATCGGGTAGCCCGGA	TAAGGCGACAGCCGCCATCCGGGGGATTCAATCCGCTTCACAG
CCGCCTGCGTTCGGGTAGCCCGGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018362.1\|WP_014839817.1\|3076931_3077792_-\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP018362.1\|WP_014227294.1\|3085536_3088644_+\|multidrug-efflux-RND-transporter-permease-subunit-EefB	unknown	unknown	gnl\|CDD\|273335
NZ_CP018362.1\|WP_038423880.1\|3092316_3093750_+\|PTS-N-acetylmuramic-acid-transporter-subunit-IIBC	unknown	unknown	gnl\|CDD\|181971
NZ_CP018362.1\|WP_014839828.1\|3090062_3091229_+\|multidrug-effflux-MFS-transporter	unknown	unknown	gnl\|CDD\|340878
NZ_CP018362.1\|WP_038423877.1\|3080205_3081120_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176160
NZ_CP018362.1\|WP_038423878.1\|3083542_3083959_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP018362.1\|WP_014227286.1\|3077816_3078626_-\|lipoprotein-NlpA	unknown	unknown	gnl\|CDD\|182119
NZ_CP018362.1\|WP_014227299.1\|3094094_3094403_+\|CcdB-family-protein	unknown	unknown	gnl\|CDD\|376629
NZ_CP018362.1\|WP_014227287.1\|3078881_3079352_-\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|377770
NZ_CP018362.1\|WP_032695129.1\|3081116_3082613_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP018362.1\|WP_038423876.1\|3079482_3080103_-\|pyridoxamine-5'-phosphate-oxidase-family-protein	unknown	unknown	gnl\|CDD\|226105
NZ_CP018362.1\|WP_038423879.1\|3091389_3092292_+\|N-acetylmuramic-acid-6-phosphate-etherase	unknown	unknown	gnl\|CDD\|235467
NZ_CP018362.1\|WP_014839827.1\|3088647_3090012_+\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|182103
NZ_CP018362.1\|WP_038423875.1\|3076385_3076940_+\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|239516
NZ_CP018362.1\|WP_009654083.1\|3094553_3095456_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP018362.1\|WP_014227291.1\|3082693_3083341_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP018362.1\|WP_014227293.1\|3084412_3085537_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|184990
NZ_CP018362.1\|WP_032695125.1\|3075436_3076216_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|225130
NZ_CP018362.1\|WP_014227282.1\|3074468_3075422_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|181818
NZ_CP018362.1\|WP_014227298.1\|3093855_3094092_+\|type-II-toxin-antitoxin-system-CcdA-family-antitoxin	unknown	unknown	gnl\|CDD\|377822

Protein	Function_ID	Function_description	E-value
NZ_CP018362.1\|WP_014839817.1\|3076931_3077792_-\|EamA-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	1.86137e-13
NZ_CP018362.1\|WP_014227294.1\|3085536_3088644_+\|multidrug-efflux-RND-transporter-permease-subunit-EefB	gnl\|CDD\|273335	TIGR00915, Probable_aminoglycoside_efflux_pump, The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family. Proteins scoring above the trusted cutoff (1000) form a tight clade within the RND (Resistance-Nodulation-Cell Division) superfamily. Proteins scoring greater than the noise cutoff (100) appear to form a larger clade, cleanly separated from more distant homologs that include cadmium/zinc/cobalt resistance transporters. This family is one of several subfamilies within the scope of pfam00873. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Unknown substrate].	0
NZ_CP018362.1\|WP_038423880.1\|3092316_3093750_+\|PTS-N-acetylmuramic-acid-transporter-subunit-IIBC	gnl\|CDD\|181971	PRK09586, murP, PTS system N-acetylmuramic acid transporter subunits EIIBC; Reviewed.	0
NZ_CP018362.1\|WP_014839828.1\|3090062_3091229_+\|multidrug-effflux-MFS-transporter	gnl\|CDD\|340878	cd17320, MFS_MdfA_MDR_like, Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.22831e-84
NZ_CP018362.1\|WP_038423877.1\|3080205_3081120_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176160	cd08471, PBP2_CrgA_like_2, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 2. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.97744e-89
NZ_CP018362.1\|WP_038423878.1\|3083542_3083959_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	9.90495e-11
NZ_CP018362.1\|WP_014227286.1\|3077816_3078626_-\|lipoprotein-NlpA	gnl\|CDD\|182119	PRK09861, PRK09861, lipoprotein NlpA.	0
NZ_CP018362.1\|WP_014227299.1\|3094094_3094403_+\|CcdB-family-protein	gnl\|CDD\|376629	pfam01845, CcdB, CcdB protein.	9.48804e-43
NZ_CP018362.1\|WP_014227287.1\|3078881_3079352_-\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|377770	pfam07080, DUF1348, Protein of unknown function (DUF1348). This family consists of several highly conserved hypothetical proteins of around 150 residues in length. The function of this family is unknown.	5.44062e-96
NZ_CP018362.1\|WP_032695129.1\|3081116_3082613_-\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.16729e-70
NZ_CP018362.1\|WP_038423876.1\|3079482_3080103_-\|pyridoxamine-5'-phosphate-oxidase-family-protein	gnl\|CDD\|226105	COG3576, COG3576, Predicted flavin-nucleotide-binding protein structurally related to pyridoxine 5'-phosphate oxidase [General function prediction only].	7.41708e-13
NZ_CP018362.1\|WP_038423879.1\|3091389_3092292_+\|N-acetylmuramic-acid-6-phosphate-etherase	gnl\|CDD\|235467	PRK05441, murQ, N-acetylmuramic acid-6-phosphate etherase; Reviewed.	8.90289e-175
NZ_CP018362.1\|WP_014839827.1\|3088647_3090012_+\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|182103	PRK09837, PRK09837, Cu(I)/Ag(I) efflux RND transporter outer membrane protein.	6.39623e-100
NZ_CP018362.1\|WP_038423875.1\|3076385_3076940_+\|NUDIX-hydrolase	gnl\|CDD\|239516	cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate. Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+, for its activity. It also contains a highly conserved 23-residue Nudix motif (GX5EX7REUXEEXGU, where U = I, L or V) which functions as a metal binding site/catalytic site. In addition to the Nudix motif, there are additional conserved amino acid residues, distal from the signature sequence, that correlate with substrate specificity. In humans, there are four distinct ADPRase activities, three putative cytosolic enzymes (ADPRase-I, -II, and -Mn) and a single mitochondrial enzyme (ADPRase-m). Human ADPRase-II is also referred to as NUDT5. It lacks the N-terminal target sequence unique to mitochondrial ADPRase. The different cytosolic types are distinguished by their specificities for substrate and specific requirement for metal ions. NUDT5 forms a homodimer.	4.79329e-36
NZ_CP018362.1\|WP_009654083.1\|3094553_3095456_+\|DMT-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	1.4116e-51
NZ_CP018362.1\|WP_014227291.1\|3082693_3083341_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	2.23396e-14
NZ_CP018362.1\|WP_014227293.1\|3084412_3085537_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|184990	PRK15030, PRK15030, multidrug efflux RND transporter periplasmic adaptor subunit AcrA.	3.38386e-112
NZ_CP018362.1\|WP_032695125.1\|3075436_3076216_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|225130	COG2220, COG2220, Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only].	3.98085e-19
NZ_CP018362.1\|WP_014227282.1\|3074468_3075422_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|181818	PRK09393, ftrA, transcriptional activator FtrA; Provisional.	2.3633e-104
NZ_CP018362.1\|WP_014227298.1\|3093855_3094092_+\|type-II-toxin-antitoxin-system-CcdA-family-antitoxin	gnl\|CDD\|377822	pfam07362, CcdA, Post-segregation antitoxin CcdA. This family consists of several Enterobacterial post-segregation antitoxin CcdA proteins. The F plasmid-carried bacterial toxin, the CcdB protein, is known to act on DNA gyrase in two different ways. CcdB poisons the gyrase-DNA complex, blocking the passage of polymerases and leading to double-strand breakage of the DNA. Alternatively, in cells that overexpress CcdB, the A subunit of DNA gyrase (GyrA) has been found as an inactive complex with CcdB. Both poisoning and inactivation can be prevented and reversed in the presence of the F plasmid-encoded antidote, the CcdA protein.	8.08152e-21

>NZ_CP018362.1|WP_014227291.1|3082693_3083341_+|TetR/AcrR-family-transcriptional-regulator
MSAQKDNEAPRRPGRPRGQKSGSANREQLMDIALALFARHGIARISLNAIAKEAGVTPAMLHYYFSSREALVEKLVEERFMPLRSEIGQIFVAHGDDPVTAFTLLIETLAAMAEKNAWFAPLWMQEIIGEMPVLRQHMHARFGDEKYHKMLETVRRWQREGKLNPALSPELLFTTLISLVLVPFSRTHTDPRLQSVDRKMIVSHALALTGRGIGG
>NZ_CP018362.1|WP_032695129.1|3081116_3082613_-|MFS-transporter
MTSEIASQPAVPSIRLLFSALLLVMLLSALDQTIVSTALPTIVGELGGLDKLSWVVTAYILSSTIAVPLYGKFGDLFGRKIVLQVAIVLFLAGSALCGLAQNMTQLVLMRGLQGLGGGGLMVISMAAVADVIPPANRGRYQGLFGGVFGLATVIGPLIGGFLVQHASWRWIFYINLPLGLFALLVIGAVFHSSNKRSQHQIDWLGAIYLSMALLCIILFTSEGGSVRAWSDPQLWCILAFGLVGIVGFIHEERLASEPIIPLSLFRNRSFLLCSLIGFVIGMALFGSVTFLPLYLQVVKEATPTEAGLQLIPLMGGLLLTSIVSGRIISRTGKYRVFPIIGTLLGVVGMVLLTRITIHSAMWQLYLFTGVLGAGLGLVMQVLVLAVQNAMPAQMYGVATSGVTLFRSIGGSIGVALFGAVFTHVLQSNLQRLLPEGAQLPRALNPAAVQNLPAEIRLDYLDAFGSAIHAAFLMAACIMAVAFALSWLLKEAPLKTGTR
>NZ_CP018362.1|WP_038423877.1|3080205_3081120_+|LysR-family-transcriptional-regulator
MDRLSAMALLVKVAELGSMSAAARALNIPLTTVSRQIGELENTLGVRLMIRTTRKLTLTDAGVDYVAAARRILEEVENAERQAAGEYQEPKGELVLSAPTMFGRQQVLPVVTDFLARYPQIRVRLLLSDRNADLVGDHIDLAVRIGTLPDSGMVATRLGEMRIVTCAHPALLEKHGIPERPRELAALPIIRIESPMPYRGWRFNAEEAEDRLVALQPVLSLTTPESAADAARLGAGVARLLHYQAIDGLARGELKLLLQAMEPEPAPVHLLYTSRDLAPLKLRKFIDFAAPALRRALRRIAAAV
>NZ_CP018362.1|WP_038423876.1|3079482_3080103_-|pyridoxamine-5'-phosphate-oxidase-family-protein
MPAEFLDIAMTPDVMDVQHEMGSDELWQSPHRQRRGERFGASEEAMIVTRDSFYLATLSQTGWPYIQHRGGPVGFLHLLDETTLGMADFSGNRQYITTGNLRGSDRACLFLMDYPRRARLKIYATVEVVAVDADPQLLAQVAPENYRARIERIYRFHLQAFDWNCPQHIIPRYTARQVAEYSQTLQQRIDELERENQRLQQLIYPK
>NZ_CP018362.1|WP_014227287.1|3078881_3079352_-|nuclear-transport-factor-2-family-protein
MTEQRPPLPPFTRESAAQKVRAAEDGWNSRDAAKVALAYTVESEWRNRSEFVHGRTQIIDFLQRKWRKEQEYRLIKELWAWSDNRIAVRFAYEWHDDSGNWFRSYGNENWEFDEHGLMQTRYACINDLPITESERLFHWPQGRRPDDHPGLSELGL
>NZ_CP018362.1|WP_014227286.1|3077816_3078626_-|lipoprotein-NlpA
MKLRLRTAAAVMLAGLLLAGCDQKGSDAKHIKVGVINGAEQDVAEVAKKVAKEKYGLDVELVGFSGSLLPNESTNAGDLDANVFQHRPFLEQDNKAHNYRLVAVGNTFVFPMAGYSRKIKSVAELKDGATIAIPNDPTNLGRALLLLQQEKLITLKAGTGLLPTAVDIIDNPHHLKIMELEGAQLPRVIDDPKVDVAIISTTYLQQTGLSPVRDGIFIEDKNSPYVNIIVTREDNKDAENVKAFIHSYQSPEVAKAAETIFNGGAVPGW
>NZ_CP018362.1|WP_014839817.1|3076931_3077792_-|EamA-family-transporter
MTRQRQADLLLIAATVIAACGWIFSREAIAGMPVFAFLGLRFFFAALLLLPFCRGLRVERQQWPRMIISGLWFALNLCLWIYSVSTTPSLGEGAFIMSLSMLFVPLTAWVMMKARPARAYWECLPIAVVGLGLLSLHMPIAFHPSQGWFLLTALVQSIWFCYTSKSAREVPLIPLTTVQLGITGIVGLGISAAVESWTQPFTLPTFGWLLASIVIATSLRFGLQMKGQKYAAVASAAIIMVLEPLLTVIAAALWYGEQLPLQKIIGGLLILVAQLWFRWRMLKPLR
>NZ_CP018362.1|WP_038423875.1|3076385_3076940_+|NUDIX-hydrolase
MKKKLTSADMHDVEVLADTPWFSMRKVGIDMAPGDRRDFFSIHYPRPAVGIVAMQDDKVLLIRHYRYLIDRVVWAIPSGGVDEGEDPREAALRELREETGWQAQRADEIIRYNPSYGSSDQLFITWLAHNLTWVGMDEDQDEVMETGWFTLEEIGQLIARGEMPDGLSLVPLLHLMAQRRTGLA
>NZ_CP018362.1|WP_032695125.1|3075436_3076216_-|MBL-fold-metallo-hydrolase
MKITHVRNATQLIEYAGKKFLIDPMLSAKGAWAGFAGTARSELRNPLVELPFSIETIVDVDAVIVTHTHQDHWDEAAIAAIPKTLPVYVQHDADAQLLRGQGFRDIRLLSEDSAFADVALVKTTSGQHGSDRTYAVPAMAERLGEACGVVLRHPQEKTLWLVGDTIWRDEVEADMLRLRPDVVVLNAGYAHVIGFGPIIMGKEDVLKAHFVLPEAKIVASHMEAVNHCLLSRDELRQYVADNQIAEAVSIPQDGESMVF
>NZ_CP018362.1|WP_014227282.1|3074468_3075422_-|helix-turn-helix-domain-containing-protein
MKLTEVAIVAVDGFSPFHYSVPCMLFGDTVSETKRFNLHICAERPGLLSARDGFALNASGDFSLLAQADIVVVPYWGAVNQRPSQPLLDGLVRARNNGAQIVGLCLGAFVLGYAGLLDDRRAATHWEFEQDFQRQFPQVRLDINALYVDDEGIITSAGTAAALDCCLYLIRQRFGSLVANQIARRMIVPPHREGGQAQFIAQPVPKNTRDARINGLLEYLQQHIREPHNLDSLAQVAAMSRRTLTRHFAKATGMGIADWLAAERLRRSQILLEAGDLPVGQVAEEVGYRSAVTWRQQFKARFGVSPAEWRRTFRRGA
>NZ_CP018362.1|WP_038423878.1|3083542_3083959_-|GNAT-family-N-acetyltransferase
MTLIITENINPADQEELLAGLREYNLRFLDPAQFGELGVYSRDDAGAMRGGLIGKRKGSWLCIDYLWVSEASRGSGLGSELMHEAENQARARGCSHVLVDTFSFQALPFYQKLGYQLQMSLPDFPHVGMQRHYVSKVL
>NZ_CP018362.1|WP_014227293.1|3084412_3085537_+|efflux-RND-transporter-periplasmic-adaptor-subunit
MKYTLAPIAAALFLLSGCDNAQNASPQQMTQEVGVVTLHGQPVPVVSSLTGRTTASLSAEVRPQVGGIVQKRLFTEGDMVKAGQALYQIDPSSYRATFNEAAASLKQAQALVIADCQKAQRYAVLVKDNGVSRQDADDAIATCNQDKASVESKKAALESARINLNWTTVTAPIAGRIGISSVTPGALVSADQDTALATIRGLDTMYVDLTRSSVDLLRLRKQSLASNSDTLNVTLTLEDGSTYSEKGRLALTEVAVDESTGSVTLRAVFPNPQHVLLPGMFVRARIDEGIMNDAILAPQQGITRDAKGDATALVVDANNKVEQRSVETGETYGDKWLIVNGLKSGDRLIVEGTGKVAPGQQVKAAEVKNDGGNA
>NZ_CP018362.1|WP_014227294.1|3085536_3088644_+|multidrug-efflux-RND-transporter-permease-subunit-EefB
MFSRFFVRRPVFAWVIAILIMLAGILAIRTLPVAQYPDVAPPAIKISATYTGASAETLENSVTQVIEQQLTGLDNLLYFTSTSSSDGSVSITVTFEQGTDPDTAQVQVQNKVQQAESRLPSEVQQSGVTVEKSQSSFLLILAVYDKNNKATSSDISDWLVSNMQDPMARIEGVGSLQVFGAEYAMRIWMDPTKLASYSLMPSDVQSAIEAQNVQVSAGKIGALPASNAQQLTATVRAQSRLQTVAQFKEIIVKSKSDGSVVRLSDVARVEMGSEDYTASANLNGHPAAGIAVMMAPGANALNTATLVKNKIAEFQRQMPQGYDIAYPKDSTEFIKISVEDVIQTLFEAIILVVCVMYLFLQNFRATLIPAVAVPVVLLGTFGVLALFGYSINTLTLFAMVLAIGLLVDDAIVVVENVERIMRDEGLPAREATEKSMGEISGALIAIALVLSAVFLPMAFFGGSTGVIYRQFSVTIISAMMLSVVVALTLTPALCGALLSHSKPHTKGFFGAFNRLWGRTEQGYQHRVVGGLRRSAMMMGAFVLICGGMALAMWKLPGSFLPTEDQGEIMVQYTLPAGATAVRTAEVRRQVTDWFLTKEKANTDVIFTVDGFSFSGSGQNAGMAFVSLKNWSERKGEENTAQAIALRATKELGGIRDATLFAMTPPSVDGLGQSNGFTFELLASGGTDRDSLMKMRSQLLAAANQSTELQSVRANDLPQMPQLQVDIDNNKAVSLGLSLSDVTDTLSSAWGGTYVNDFIDRGRVKKVYIQGESDARAVPSDLGKWFVRGSDDSMTPFSAFATTRWQYGPESLVRYNGSAAFEIQGENASGFSSGAAMDKMEALANNLPAGTTWAWSGMSLQEKLASGQAMSLYAISILVVFLCLAALYESWSVPFSVIMVIPLGLLGAALAAWMRGLSNDVYFQVALLTTIGLSSKNAILIVEFAESAVEEGYSLSRAAMRAAQTRLRPIVMTSLAFIAGVLPLAIATGAGANSRVAIGTGIIGGTLTATLLAVFFVPLFFVLVKRFFTRHRSSQE
>NZ_CP018362.1|WP_014839827.1|3088647_3090012_+|efflux-transporter-outer-membrane-subunit
MFRFTLVFVALLTAGCVSLDPHYERPAAPVPATLPGSHGEATAVVSDWQQVVNDARLKKVVNIALTSNRDVQKALADIEAARAQFGETRASLFPTLDAELSHTRSKTVASGLTSSAEADGAVSSFELDLFGKNQSLTRAARETWLASEFTAQNTRLTMIADLTTAWITLAADNSNLALAQDTMASAENSRRIVTRQMEVGTASAGDLSDAESVYQQARASVASYRTLVAQDKNALNLLAGETVPDSLLPGTLESLGDRSITLVPAGVSSSVLLRRPDIQEAEHNLKSANADIGAARANFFPSISLTASAGVGSDSLSSLFSHGMQVWSFAPSISLPLFTGGSNLAQLRYAEAEKKGLIATYEKTIQSAFKDVADALARRETLSEQLDAQNKYVAAEQKSLNIAMKSYQAGVGDYLSVLTAQRTLWSAQATLISLQQTDLENRITLWQSLGGGAS
>NZ_CP018362.1|WP_014839828.1|3090062_3091229_+|multidrug-effflux-MFS-transporter
MSRISLSWVVVLGLLSAIGPLCTDFYLPALPEITQQLSATGTQTQLSLTAALIGLGLGQLFFGPLSDRIGRKKPLALSLLLFIFSSAMCAITYDIHMLIAWRFLQGFAGAGGSVLSRSIARDRYQGTLLTQFFALLMTVNGIAPVLSPVLGGWIITAFDWRILFWAMAAIGVVLLLLSLTVLHETLPAKSTASATRQQADAPVLKNRRFMRYCLIQAFMMAGLFSYIGSSSFVIQSEYAMSAMQFSLLFGLNGIGLIIAALIFSRLARRFSAEALLRGGQLLAVAFAAITLLVAWLPQPTLALVGLFFTVSMMSGISTVAGSEAMNAIHARQSGTASALMGTLMFVFGGIAAPLAGLGGETMLKMSFAMTLCYLAALLIGLKKPRPIA
>NZ_CP018362.1|WP_038423879.1|3091389_3092292_+|N-acetylmuramic-acid-6-phosphate-etherase
MSIDLSKLLTERRNANSANIDILTTEQMLTVINQEDQQVAHAITPYLPQIAQVVDKVAAALQAGGRLIYIGAGTSGRLGILDASECPPTFGTRPEQVVGIIAGGHKAILSAVENVEDNKAQGVMDLQNLNFSSRDVLVGLAASGRTPYVIGAMEYAHSQNAFVAIVSCNPHGEMAQLADVAITPVVGPEVVTGSTRLKAGTAQKLVLNMISTGAMIRIGKVYSNLMVDVEATNAKLIERQVSIVMEATECDRATAQSALEACDRHCKTAIVMVLADLSAADAQALLAKNNGYIRKALSHS
>NZ_CP018362.1|WP_038423880.1|3092316_3093750_+|PTS-N-acetylmuramic-acid-transporter-subunit-IIBC
MAKINKEMIARILQHVGGAGNVAQAGNCMTRLRLTLRDESRADSAAIRQIDGVMGVIVSDEQFQVVLGPGKAQSAAEMMNALLEEAPADAPSLADVAAKKKQALKSKQTSGIQKFLAKFATIFTPLIPGFIAVGLLLGFATLAEQIFVLENAHPNATLIALIGYMKVFSKGMFTFLSILIGYNAQKAFGGSGVNGAIIAALFVLGYNPEATSGFYSGISTFFGHGIDPRGNIIGVLIAAIIGAWVERQVRRIMPANLDMILTSAVTLLIMGAITFTVIMPIGGWLFTGMSWLFLHLNGNPFGSAVLAGLFLLAVMFGVHQGFVPVYFALVDAQGFNSLFPILAMAGAGQVGAALALFWRAKHGSLLRTQIKGAIIPGFLGIGEPLIYGVTLPRMKPFITACLGGACGGFFLGLIAWLGLPVGLNTVFGPSGLVALPLMTSGSGIYAGMAVYAAGLAVSYLCGFALTWLFGSKNVDLS
>NZ_CP018362.1|WP_014227298.1|3093855_3094092_+|type-II-toxin-antitoxin-system-CcdA-family-antitoxin
MPAAKRNKQNVSVTLDPGLVKQAREVGINLSLTLTNALKSEIHSLEIARWQKENAQAIDYLNNLTEENGLLSDEYRTF
>NZ_CP018362.1|WP_014227299.1|3094094_3094403_+|CcdB-family-protein
MQYYVYKNTGRIAAYPYLLDVQSDIIGKRNTRVVIPLFPLKNYKGPRADRLTPLVTVEGEEYVVMTHELASIPHRVLGEEVCNLNHQREVVKASMDFLFDGI
>NZ_CP018362.1|WP_009654083.1|3094553_3095456_+|DMT-family-transporter
MGSSKKGMLNVLIAAVLWGSSGVCAQYIMQQSQMSSPFLTMTRLLFAGLILLMLSFFHGDKIFRVLQNRKDAVSLLIFSLFGALTVQYTFLMTIEQSNAATATVLQFLSPTIIVAWFAIARKTRPSPLVLAAIATSLAGTFLLVTHGNPTTLSISPTALFWGIASAFAAAFYTTYPSTLIARYGTLPIVGWSMLLGGAMLLPFYAGQGNHFVVTGGLLLAFFYLVVIGTSLTFSLYLNGAQKIGGAKAGILSCAEPLSSALLSLLLLGITFTLPDWLGTLLILSSVVLIAMDSRRRVKTA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP018362_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018362_3

3733606-3733715

Orphan

Consensus_repeat	Method
CGCCGCCTCCGGGAAGCAGCGCGCAATG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP018362_3

>merge|NZ_CP018362|3|3733606-3733715|CRISPRCasFinder
CGCCGCCTCCGGGAAGCAGCGCGCAATGTCACCTCCGCTGTTCTCCCGGCTCGCGCTGCGCTTAGGCGGGCTACGGGTTTACCGCCGCCTCCGGGAAGCAGCGCGCAATG

>NZ_CP018362|3|3|3733606-3733715|CRISPRCasFinder
CGCCGCCTCCGGGAAGCAGCGCGCAATG	TCACCTCCGCTGTTCTCCCGGCTCGCGCTGCGCTTAGGCGGGCTACGGGTTTAC
CGCCGCCTCCGGGAAGCAGCGCGCAATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018362.1\|WP_014227648.1\|3733837_3735046_-\|aldose-1-epimerase-family-protein	unknown	unknown	gnl\|CDD\|379620
NZ_CP018362.1\|WP_014227647.1\|3733039_3733585_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP018362.1\|WP_004098062.1\|3738857_3739409_-\|ribosome-associated-protein	unknown	unknown	gnl\|CDD\|235377
NZ_CP018362.1\|WP_004098073.1\|3742285_3742585_+\|DUF4312-family-protein	unknown	unknown	gnl\|CDD\|213831
NZ_CP018362.1\|WP_004098072.1\|3741920_3742283_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|132616
NZ_CP018362.1\|WP_014837210.1\|3735372_3736515_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341458
NZ_CP018362.1\|WP_004098039.1\|3724378_3724723_+\|gamma-glutamylcyclotransferase	unknown	unknown	gnl\|CDD\|225016
NZ_CP018362.1\|WP_032695164.1\|3740892_3741279_+\|cytochrome-b562	unknown	unknown	gnl\|CDD\|185018
NZ_CP018362.1\|WP_004098053.1\|3730427_3731426_-\|class-1-fructose-bisphosphatase	unknown	unknown	gnl\|CDD\|236458
NZ_CP018362.1\|WP_004098041.1\|3724874_3725402_-\|inorganic-diphosphatase	unknown	unknown	gnl\|CDD\|179262
NZ_CP018362.1\|WP_004098075.1\|3742606_3743383_+\|DUF4311-domain-containing-protein	unknown	unknown	gnl\|CDD\|274659
NZ_CP018362.1\|WP_014227645.1\|3728384_3729410_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224093
NZ_CP018362.1\|WP_004098056.1\|3731601_3732975_+\|UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl--meso-diaminopimelate-ligase	unknown	unknown	gnl\|CDD\|130153
NZ_CP018362.1\|WP_014837206.1\|3726871_3728374_+\|sugar-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224053
NZ_CP018362.1\|WP_076752456.1\|3720599_3724376_+\|autotransporter-assembly-complex-protein-TamB	unknown	unknown	gnl\|CDD\|225463
NZ_CP018362.1\|WP_004098067.1\|3739503_3740856_+\|metalloprotease-PmbA	unknown	unknown	gnl\|CDD\|182922
NZ_CP018362.1\|WP_004098061.1\|3736709_3738221_-\|CoA-acylating-methylmalonate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143404
NZ_CP018362.1\|WP_004098043.1\|3725805_3726762_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380532
NZ_CP018362.1\|WP_076752457.1\|3741570_3741909_+\|PRD-domain-containing-protein	unknown	unknown	gnl\|CDD\|132621
NZ_CP018362.1\|WP_004098052.1\|3729396_3730383_+\|sugar-ABC-transporter-permease-YjfF	unknown	unknown	gnl\|CDD\|183235

Protein	Function_ID	Function_description	E-value
NZ_CP018362.1\|WP_014227648.1\|3733837_3735046_-\|aldose-1-epimerase-family-protein	gnl\|CDD\|379620	pfam14486, DUF4432, Domain of unknown function (DUF4432).	3.50107e-157
NZ_CP018362.1\|WP_014227647.1\|3733039_3733585_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	2.98254e-07
NZ_CP018362.1\|WP_004098062.1\|3738857_3739409_-\|ribosome-associated-protein	gnl\|CDD\|235377	PRK05255, PRK05255, ribosome-associated protein.	1.13256e-86
NZ_CP018362.1\|WP_004098073.1\|3742285_3742585_+\|DUF4312-family-protein	gnl\|CDD\|213831	TIGR03578, EF_0831, conserved hypothetical protein EF_0831/AHA_3912. Members of this family of small (about 100 amino acid), relatively rare proteins are found in both Gram-positive (e.g. Enterococcus faecalis) and Gram-negative (e.g. Aeromonas hydrophila) bacteria, as part of a cluster of conserved proteins. The function is unknown. [Hypothetical proteins, Conserved].	1.52003e-39
NZ_CP018362.1\|WP_004098072.1\|3741920_3742283_+\|hypothetical-protein	gnl\|CDD\|132616	TIGR03577, EF_0830, conserved hypothetical protein EF_0830/AHA_3911. Members of this family of small (about 120 amino acid), relatively rare proteins are found in both Gram-positive (e.g. Enterococcus faecalis) and Gram-negative (e.g. Aeromonas hydrophila) bacteria, as part of a cluster of conserved proteins. The function is unknown. [Hypothetical proteins, Conserved].	3.22261e-62
NZ_CP018362.1\|WP_014837210.1\|3735372_3736515_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341458	cd08179, NADPH_BDH, NADPH-dependent butanol dehydrogenase involved in the butanol and ethanol formation pathway in bacteria. NADPH-dependent butanol dehydrogenase (BDH) is involved in the butanol and ethanol formation pathway of some bacteria. The fermentation process is characterized by an acid producing growth phase, followed by a solvent producing phase. The latter phase is associated with the induction of solventogenic enzymes such as butanol dehydrogenase. The activity of the enzyme requires NADPH as cofactor, as well as divalent ions zinc or iron. This family is a member of the iron-containing alcohol dehydrogenase superfamily. Protein structure has a dehydroquinate synthase-like fold.	0
NZ_CP018362.1\|WP_004098039.1\|3724378_3724723_+\|gamma-glutamylcyclotransferase	gnl\|CDD\|225016	COG2105, COG2105, Uncharacterized conserved protein [Function unknown].	1.5424e-38
NZ_CP018362.1\|WP_032695164.1\|3740892_3741279_+\|cytochrome-b562	gnl\|CDD\|185018	PRK15058, PRK15058, cytochrome b562; Provisional.	1.00557e-55
NZ_CP018362.1\|WP_004098053.1\|3730427_3731426_-\|class-1-fructose-bisphosphatase	gnl\|CDD\|236458	PRK09293, PRK09293, class 1 fructose-bisphosphatase.	0
NZ_CP018362.1\|WP_004098041.1\|3724874_3725402_-\|inorganic-diphosphatase	gnl\|CDD\|179262	PRK01250, PRK01250, inorganic diphosphatase.	3.11886e-130
NZ_CP018362.1\|WP_004098075.1\|3742606_3743383_+\|DUF4311-domain-containing-protein	gnl\|CDD\|274659	TIGR03580, EF_0832, conserved hypothetical protein EF_0832/AHA_3913. Members of this family of relatively rare proteins are found in both Gram-positive (e.g. Enterococcus faecalis) and Gram-negative (e.g. Aeromonas hydrophila) bacteria, as part of a cluster of conserved proteins. The function is unknown. [Unknown function, General].	3.7826e-160
NZ_CP018362.1\|WP_014227645.1\|3728384_3729410_+\|ABC-transporter-permease	gnl\|CDD\|224093	COG1172, AraH, Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components [Carbohydrate transport and metabolism].	1.78156e-71
NZ_CP018362.1\|WP_004098056.1\|3731601_3732975_+\|UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl--meso-diaminopimelate-ligase	gnl\|CDD\|130153	TIGR01081, mpl, UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase. Alternate name: murein tripeptide ligase [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NZ_CP018362.1\|WP_014837206.1\|3726871_3728374_+\|sugar-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	0
NZ_CP018362.1\|WP_076752456.1\|3720599_3724376_+\|autotransporter-assembly-complex-protein-TamB	gnl\|CDD\|225463	COG2911, COG2911, Uncharacterized protein conserved in bacteria [Function unknown].	0
NZ_CP018362.1\|WP_004098067.1\|3739503_3740856_+\|metalloprotease-PmbA	gnl\|CDD\|182922	PRK11040, PRK11040, peptidase PmbA; Provisional.	0
NZ_CP018362.1\|WP_004098061.1\|3736709_3738221_-\|CoA-acylating-methylmalonate-semialdehyde-dehydrogenase	gnl\|CDD\|143404	cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2. Methylmalonate semialdehyde dehydrogenase (MMSDH, EC=1.2.1.27) [acylating] from Bacillus subtilis is involved in valine metabolism and catalyses the NAD+- and CoA-dependent oxidation of methylmalonate semialdehyde into propionyl-CoA. Mitochondrial human MMSDH ALDH6A1 and Arabidopsis MMSDH ALDH6B2 are also present in this CD.	0
NZ_CP018362.1\|WP_004098043.1\|3725805_3726762_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380532	cd06309, PBP1_galactofuranose_YtfQ-like, periplasmic binding domain of ABC-type galactofuranose YtfQ-like transport systems. Periplasmic binding domain of ABC-type YtfQ-like transport systems. The YtfQ protein from Escherichia coli is up-regulated under glucose-limited conditions and shares homology with a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein superfamily. Members of this group are predicted to be involved in the transport of sugar-containing molecules across cellular and organellar membranes; however their ligand specificity is not determined experimentally.	6.22124e-142
NZ_CP018362.1\|WP_076752457.1\|3741570_3741909_+\|PRD-domain-containing-protein	gnl\|CDD\|132621	TIGR03582, EF_0829, PRD domain protein EF_0829/AHA_3910. Members of this family of relatively uncommon proteins are found in both Gram-positive (e.g. Enterococcus faecalis) and Gram-negative (e.g. Aeromonas hydrophila) bacteria, as part of a cluster of conserved proteins. This protein contains a PRD domain (see pfam00874). The function is unknown. [Unknown function, General].	1.07421e-39
NZ_CP018362.1\|WP_004098052.1\|3729396_3730383_+\|sugar-ABC-transporter-permease-YjfF	gnl\|CDD\|183235	PRK11618, PRK11618, inner membrane ABC transporter permease protein YjfF; Provisional.	2.27862e-180

>NZ_CP018362.1|WP_014227647.1|3733039_3733585_+|GNAT-family-N-acetyltransferase
MLNSERVTSTDSAHFPALDALYGRAFPWHEQREAEAKQQALDNPHYELEAWFDDGQFIGLSGCWRFADYRYVEHLAIDDTLRSRGYGKRLLAEILQRAPLTVLEIDPLTSEVAHKRLRFYQTMGFCANPWAHRHPTYHQGIADHELIVLSYPQPINEAQYQRFAQDLRLVVMEQAGAVKVL
>NZ_CP018362.1|WP_004098056.1|3731601_3732975_+|UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl--meso-diaminopimelate-ligase
MRIHILGICGTFMGGLAMLARSLGHEVTGSDANVYPPMSTLLENQGIELIQGYDASQLDPQPDLVIIGNAMTRGNPCVEAVLENNIPYMSGPQWLHDFVLRDRWVLAVAGTHGKTTTAGMATWILEACGYKPGFVIGGVPGNFDVSARLGDSPFFVIEADEYDCAFFDKRSKFVHYCPRTLILNNLEFDHADIFDDLKAIQKQFHHLVRIVPGKGKIILPENDINLKQTMAMGCWSEQELVGEQGHWQAKKLTTDASSWEVWLDGEKVGEVKWALVGEHNMHNGLMAIAAARHVGVLPADAANALGSFINARRRLELRGEANGVTVYDDFAHHPTAILATLQALRGKVGGTARILAVLEPRSNTMKMGICKDDLAPSLGRADEVFLLQPQHIPWQVAEVADACVQPAHWSADVDALVDMIVKTAHPGDHILVMSNGGFGGIHQKLLDKLAKKAEAAE
>NZ_CP018362.1|WP_004098053.1|3730427_3731426_-|class-1-fructose-bisphosphatase
MKTLGEFIVEKQHEFSHATGELTALLSAIKLGAKIIHRDINKAGLVDILGASGAENVQGEVQQKLDLFANEKLKAALRARDIVAGIASEEEDEIVVFEGCEHAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRRVTPVGTPVTEEDFLQPGNRQVAAGYVVYGSSTMLVYTTGCGVHAFTYDPSLGVFCLCQERMRFPEKGNTYSINEGNYIKFPMGVKKYIKHCQEEDKETQRPYTSRYIGSLVADFHRNLLKGGIYLYPSTASHPDGKLRLLYECNPMAFLAEQAGGKASDGKERILDIIPESLHQRRSFFVGNNHMVEDVENFIKEFPDA
>NZ_CP018362.1|WP_004098052.1|3729396_3730383_+|sugar-ABC-transporter-permease-YjfF
MIKRNLPLMITLAVFVLGYLYCLTQFPGFASTRVICNILTDNAFLGIIAVGMTFVILSGGIDLSVGSVIAFTGVFLAKAIGFWGISPLVAFPLVLVMGCAFGAFMGLLIDALKIPAFIITLAGMFFLRGVSYLVSEESIPINHPVYDALSGLAWTIPGGGRLSAMGLLMLLVVIGGIFMAHRTRFGNQVYAIGGNATSANLMGISTRSTTIRIYMLSTGLATLAGIVFSIYTQAGYALAGVGVELDAIASVVIGGTLLSGGVGTVLGTLFGVAIQGLIQTYINFDGTLSSWWTKIAIGILLFIFIALQRGLTVLWENRQSSPVTRVGH
>NZ_CP018362.1|WP_014227645.1|3728384_3729410_+|ABC-transporter-permease
MMPQSVPKTGQPKRRFNWPKGMPQIIALLLVLVVDSLVAPHFYQIVLQDGRLFGSPIDILNRAAPVALLAIGMTLVIATGGIDLSVGAVMAIAGATAASMTVAGHSLTVVLLASLGAGALAGLWNGILVAVLKIQPFVATLILMVAGRGVAQLITSGQIVTFDSPHLAWLGSGSLLLFPTPVIIAIVTLVLFWLFTRKTALGMFIEAVGINIRAAKNAGVNTRIVVMLAYVLSGVCAAIAGIIVAADIRGADANNAGLWLELDAILAVVIGGGSLMGGRFNLLLSVVGALIIQGMNTGILLSGFPPELNQVVKAVVVLCVLIVQSPRFISILKGMRGHDKT
>NZ_CP018362.1|WP_014837206.1|3726871_3728374_+|sugar-ABC-transporter-ATP-binding-protein
MNGELHQEILRTEGLSKFFPGVKALDNVNFSLRRGEIMALLGENGAGKSTLIKALTGVYHADRGAIWLEGREIAPKNTAHAQQLGIGTVYQEVNLLPNMSVADNLFIGREPRRFGLLRRKEMEKRATALMASYGFSLDVREPLNRFSVAMQQIVAICRAIDLSAKVLILDEPTASLDTQEVEMLFTLMRQLRDSGVSLIFVTHFLDQVYAVSDRITVLRNGGFVGCRETRELPQIELVKMMLGRELEHNALQRAGRTLLSDKPVAAFEDFGKKGTIAPFSLQVRPGEIVGLAGLLGSGRTETAEVIFGIKPADSGKAWIKGKPQTLRSPHQASCLGIGFCPEDRKTDGIIAAASVRENIVLALQAQRGWLRPIGRREQNEIAERFIRQLGIRTPSAEQPIEFLSGGNQQKVLLSRWLLTKPQFLILDEPTRGIDVGAHAEIIRLIETLCADGLALLVISSELEELVGYADRVIIMRDRQQVAELALSELSVPAIMNAIAA
>NZ_CP018362.1|WP_004098043.1|3725805_3726762_+|ABC-transporter-substrate-binding-protein
MWKRLLLVTAVSAAMSSMVMAAPLTVGFSQVGSESGWRAAETNVAKEEAAKRGITLKIADAQQKQENQIKAVRSFIAQGVDAIFIAPVVATGWEPVLKEAKEAKIPVFLLDRSIDVKDKDLYMTTVTANNVLEGQLIGEWLVKTVDGKPCNVVELQGTVGASVAIDRKKGFAEAISKASNIKIIRSQSGDFTRSKGKEVMESFIKAENNGKNICMVYAHNDDMVIGAIQAIKEAGLKPGKDILTGSIDGVPDIYKAMMAGEANASVELTPNMAGPAFDALEKYKKDGTLPEKVTITKSTLYLPDTAKEELEKKKNMGY
>NZ_CP018362.1|WP_004098041.1|3724874_3725402_-|inorganic-diphosphatase
MSLLNVPAGKDLPEDIYVVIEIPANADPIKYEVDKESGALFVDRFMSTAMFYPCNYGYINHTLSLDGDPVDVLVPTPYPLEPGSVIRCRPVGVLKMTDESGEDAKLVAVPHTKLSKEYDHIKDVNDLPELLKAQITHFFEHYKDLEAGKWVKVDGWDNAEAAKAEIVASFERAKK
>NZ_CP018362.1|WP_004098039.1|3724378_3724723_+|gamma-glutamylcyclotransferase
MRIFVYGSLRRKQGNSHWMTNAQWLGDHSVNDYQLYSLGHYPGAVPGDGTVHGEVYRIDASTLAELDALRTKGGEYARHLIQTPYGSAWMYVYQRPVEGFTLIESGNWLDKDQY
>NZ_CP018362.1|WP_076752456.1|3720599_3724376_+|autotransporter-assembly-complex-protein-TamB
MSLWKKISLGVLIFLLLLLGTVGFLVGTTTGLHLVIKAADRWVPGLEIGKATGGWRDLTLENVRFEQPGVAVTAGQFHLGVKLRCLWDSSLCVNDISLRDIYVAIDTSKMPPAAPVEEEESGPLNLSTPYPVTLSRVALHNVNVKIDDTAVSVRDFSTGLNWQEKNLTLTPTSLQGLLIALPKVAKVAQEQVVEPKIDNPQPEEKPLGETMKELFSKPVLPEMTDVHLPLNLNIQAFRGEQLRLTGDTDITIYNLLLKVSSIDGQMKLDALDVDSDQGKVTASGNAQLQDNWPVDITLNGTLNIDPLKGEKVQLKVGGEVRKKLTVGVDLNGPVAMTLRAETQLAEAGLPLDMEVKSKQLYWPFTGEKAYQADDLLLKFNGKMTDYTLAFSTAVKGQSLPPAKINLNAKGNEQQVNLDKLTVAALEGKTELKALLDWQQAISWRGELTLDGINTAKEVPDWPSKLNGLIKTQGSLYGGSWQMSVPELKITGNVKQNKVDVSGSLQGNSYMQWKIPGLHLALGPNSADVKGELGVKDLNLDATIDAPHLDNALPGLGGTAKGLVKVRGTVDAPQLLADITARALRWQELSVAQVNVKGDVKSTDQIGGNLDVRVDRISQPGVNISLVQLNAKGNEKQHDLQLRVQGDPVSGQLSLAGSFDRKAERWKGTLSNTRFQTPVGPAALTRDIALDYRNLEQKISIGPHCWTNPNAELCVPQTIDAGASGRAVVNLNRFDLAMLKPFMPEATQASGVFSGNADVSWDTTKEGLPQGKVTLSGRNVKVTQTVNDAPLPVAFDTLNLTADLHNNRAQLGWLIRLTNNGQLDGQVQVTDPQGRRNLGGNVNISNFSLAMINPIFSRGEKAEGRLNARLTLGGNVQSPQLFGQMQLNGVDIDGNFMPFDMQPSQLAMNFTGTRSTLQGTVNTRQGQIALSGNADWTQIDNWRAQIAAKGSRVRITVPPMVRLDVSPDVVFTATPSLFNLDGSVDVPWARIVVNEVPESAVGVSSDEVMLDKNLQPIKQQSAGIPINSNLTIHVGNNVRLDAFGLKARLTGDLKVAQDKQGLGLNGQINIPEGRFHAYGQDLIVRKGELLFSGPPDQPLLNIEAIRNPDATEDDVIAGVRVTGSADQPKAEIFSDPAMSQQEALSYLLRGQGLGSGQSDSAAMTSMLIGMGVAQSGQVVGKIGETFGVSNLALDTEGVGDSSQVVVSGYVLPGLQVKYGVGIFDSLATLTLRYRLMPKLYMEAVSGVDQALDLLYQFEF
>NZ_CP018362.1|WP_014227648.1|3733837_3735046_-|aldose-1-epimerase-family-protein
MKKTLALTAIAMLVSGPVVAKTWVLTSAESGMDKGNWQITSDQLKIKDHNFSIEQKVLHGGKQEGSKILVIHSKDGLTITLSPTRGMNLLKIEGFGSRMGWDSPVKEVVNPAFINLESRNGLGWLEGFNEMMVRCGYEWTGHPVTADGQIYTLHGKVGNTPASQVEVEVADTAPYEIRVRGLVKESTFKKADLQTMTELRYVPGSNSFSLHDVLTNHADYPHDYQIIYHSNFGKPILEEGARFMAPIASISPFNDYAKAGLKTWQTYAGPTKDFDEMVFNMQPLADENHQTLAAVVNKAGDKGASIQFDTRQLPVLTLWKNTDTEKQGYVTGIEPGTSYAYPVTIEREQKRVKQLQPGASTQFDLTYTLLHSSEQVADVEKKIAAIQGDTKVAEDETPIAKE
>NZ_CP018362.1|WP_014837210.1|3735372_3736515_-|iron-containing-alcohol-dehydrogenase
MTQAFSIPRSIIYGENALEHLSTLSGKKAALVTGGSSMKRFGFLDKAVSELNKAGMECIIIDNVEPNPSIKTVWRGAKAMQAFEPDWIVAIGGGSALDAAKVMWCFYEHPQLKFEDILPVGSMPALRNKARFVAIPSTSGSASEITAFSVITDTANHIKYPIVAADLVPDIAILDPTIPAKMPPHVTVHTGMDVLTHAIEAYVSTAANSFTDPYAVEAIRLVFTYLEIAWRSPDDLNARMHMHNASALAGIAFTNASLGLVHSMAHKIGGEFGITHGLANAIMLPYIIQYNAKFTKKYRQLEAALGIKNLIEAINALNQRLGVPKTLSQCGEVEINEITFVNVLDRMSHHAVDDPCTLTNPNYPSVQDVKGLYTKAFYGA
>NZ_CP018362.1|WP_004098061.1|3736709_3738221_-|CoA-acylating-methylmalonate-semialdehyde-dehydrogenase
MTTVPRLKYFVDGQWRVSQTERYMDVYNPSTGEVMAQAPCCTEQEVLDAVAAARKAFPAWSDTPAIKRSQIMFRVRELLIQHQDRLTELVAKENGKAWGDAQGDVLKAKEGTELACSIPTLMAGENLMDASAGIDTNLYREPIGVFAGIVPFNFPAMIPMGWMAPLCVASGNTMVIKAASMTPMTCMEITKLYQEAGVPDGVINVVTCSRNEADILLTHPDVNGVSFVGSTSVGLHVYSKAAAHGKRVQALCEAKNHALVLADAPINRTAAGIINAAFGCAGERCMALPVVVVQEEIADKLIAAVVEKAKQLKIGPGYLRDTDMGPVISKDHKQSVINWINKGIEEGAKLVLDGRAIQVPGQENGFYVGPTILDRVTEEMSVGTQEIFGPVLCFKRVKTFEEGLQLMNNNPFANGSVIFTQSGYYAREFQKRTHGGMVGINVGIPVPVGVFPFSGHKQSFFGDLHCLGKDGVRFYTESKCVTSRWFDEEEAKREKVDSWDGTI
>NZ_CP018362.1|WP_004098062.1|3738857_3739409_-|ribosome-associated-protein
MTKQPEDWLDDVPGDDVEDEDDEIIWVSKSEIKRDAEELKRLGAEMVELGKNALDKIPLDTDLRDAIELAQRIKKEGRRRQMQLIGKMLRSRDVEPIRQALDKLKNRHNQQVALFHKLEQIRDRLIDNGDDAVAEVLNLWPDADRQQLRSLIRNAKKEKEGNKPPKSARLIFQYLRELAESEG
>NZ_CP018362.1|WP_004098067.1|3739503_3740856_+|metalloprotease-PmbA
MALAMKVISQVAQQRKTLEEAVTTALELAAGKSDGAEVSVSKTTGIGVSTRYGEVENVEFNSDGALGITVYHQNRKGSASSTDLSPQAIARTVQAALDIARYTSPDPCAGVADKELLAFEAPDLDLFHPAEVSPDEAIELASRAEQAALKADKRISNTEGGSFNSHYGIKVFGNSHGMLQSYCSTRHSLSSCVIAEENGDMERDYAYTIGRAIDDLQSPEWVGEECARRTLSRLAPRKLSTMKAPVIFANEVATGLFGHLVGAIAGGSVYRKSTFLLDALGSQILPDWLTIEEHPHLLKGLASTPFDSEGVRTERRDIIKDGVLTQWLLTNYSARKLGLKSTGHAGGIHNWRINGRGLSFAKLLKEMGTGLVVTELMGQGVSGVTGDYSRGASGFWVENGEIQYPVSEITIAGNLKDMWRNIVTIGDDIETRSNIQCGSVLLPEMKIAGQ
>NZ_CP018362.1|WP_032695164.1|3740892_3741279_+|cytochrome-b562
MRKKLLAMLAVSAFALGSASAFADLGEDMDTLAENLQVVQKTSDAGELKAALNKMRTAAADAQKETPPKLEGKAADSAEMKDYRHGFDVLIGQIDGALKLADEGKVKEAQAAAEEFKTTRNTYHKKYR
>NZ_CP018362.1|WP_076752457.1|3741570_3741909_+|PRD-domain-containing-protein
MNNGAVTHVPEEQATLTEQLADKMLQQVFALLSRRNIVPNDVQEQMLTSHVRAMAHRSNSGEPLPEVDASLFEEISEDSMMLAREVVAQFGNLPDEEAWLLSVHFEVAKDNL
>NZ_CP018362.1|WP_004098072.1|3741920_3742283_+|hypothetical-protein
MEQITVVIGDRLGKGQKVAAGAEKAGARAVVVPGVAADMKLGDMMKAENATFGISFCGSGGAGAITAQNKHGYKAKYGMRSVDEGVTAINEGYNVLGFGFMDKEELGERLVEAWKKKYGA
>NZ_CP018362.1|WP_004098073.1|3742285_3742585_+|DUF4312-family-protein
MKEQFTTTVSVTGKGESKTRAFADALNHVQAAVMKTSPHILLRIEPQDVEVVHAREAVRKEAFLFFFLRRERRTYSVELKVTVTVTAINLDKVDFVTQT
>NZ_CP018362.1|WP_004098075.1|3742606_3743383_+|DUF4311-domain-containing-protein
MFLIILIKSLIIGGLVGVGVGAGAARMFHAPTTQGMGAFRTLGELNSCEGDPASHFSFGLGFFFNAWASSVAAGSFTQDVDHRIIPNWGAAALMIKNRNVGETLHDPKKMAIACGIIGMIVVAFLNLTASSVPEALQVTAVKVLVPAANLLVNTVMPVIFWLAAIDAGKKSGFWATIFGGAAQLIMGNAVPGLVLGILIGKGVEESGWHRVTKVMMVAIVALFVLSGFFRGFDMKMIESFHLTVPNWLELIHNSLSGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP018362_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018362_4

4786973-4787082

Orphan

Consensus_repeat	Method
GCGCTGCGCTTACCCGGGCTACGGGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP018362_4

>merge|NZ_CP018362|4|4786973-4787082|CRISPRCasFinder
GCGCTGCGCTTACCCGGGCTACGGGTAACGCGCCGTCTGTGGTTCCGGCCAACTCACCGTCGTCTGCGGTGTGCTTCCCCGGTGGCGCTGCGCTTACCCGGGCTACGGGT

>NZ_CP018362|4|4|4786973-4787082|CRISPRCasFinder
GCGCTGCGCTTACCCGGGCTACGGGT	AACGCGCCGTCTGTGGTTCCGGCCAACTCACCGTCGTCTGCGGTGTGCTTCCCCGGTG
GCGCTGCGCTTACCCGGGCTACGGGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018362.1\|WP_038423277.1\|4778630_4780748_-\|chitinase	unknown	unknown	gnl\|CDD\|225862
NZ_CP018362.1\|WP_038424204.1\|4775545_4776553_-\|Fe(3+)-siderophore-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|182464
NZ_CP018362.1\|WP_014228361.1\|4784930_4785782_+\|isochorismatase	unknown	unknown	gnl\|CDD\|224452
NZ_CP018362.1\|WP_032694351.1\|4782124_4783300_+\|isochorismate-synthase-EntC	unknown	unknown	gnl\|CDD\|184977
NZ_CP018362.1\|WP_004848703.1\|4795631_4796873_+\|LVIVD-repeat-containing-protein	unknown	unknown	gnl\|CDD\|227601
NZ_CP018362.1\|WP_014228365.1\|4790679_4791768_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|182570
NZ_CP018362.1\|WP_032694346.1\|4793427_4794426_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224093
NZ_CP018362.1\|WP_014228363.1\|4787459_4789565_+\|carbon-starvation-protein-CstA	unknown	unknown	gnl\|CDD\|184976
NZ_CP018362.1\|WP_038424207.1\|4783309_4784917_+\|(2,3-dihydroxybenzoyl)adenylate-synthase-EntE	unknown	unknown	gnl\|CDD\|236803
NZ_CP018362.1\|WP_032718732.1\|4789814_4790219_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|238045
NZ_CP018362.1\|WP_071889099.1\|4790199_4790493_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|224937
NZ_CP018362.1\|WP_014228366.1\|4791928_4793431_+\|sugar-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224053
NZ_CP018362.1\|WP_004130340.1\|4789620_4789818_+\|YbdD/YjiX-family-protein	unknown	unknown	gnl\|CDD\|225434
NZ_CP018362.1\|WP_158657244.1\|4778023_4778230_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018362.1\|WP_032694345.1\|4797000_4798200_-\|S-methyl-5-thioribose-kinase	unknown	unknown	gnl\|CDD\|236561
NZ_CP018362.1\|WP_038424209.1\|4786537_4786951_+\|proofreading-thioesterase-EntH	unknown	unknown	gnl\|CDD\|182337
NZ_CP018362.1\|WP_014228354.1\|4776665_4777907_+\|enterobactin-transporter-EntS	unknown	unknown	gnl\|CDD\|236700
NZ_CP018362.1\|WP_038424208.1\|4785781_4786537_+\|2,3-dihydro-2,3-dihydroxybenzoate-dehydrogenase-EntA	unknown	unknown	gnl\|CDD\|236190
NZ_CP018362.1\|WP_014228368.1\|4794570_4795635_+\|sugar-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380528
NZ_CP018362.1\|WP_038424206.1\|4780977_4781937_-\|Fe2+-enterobactin-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|236806

Protein	Function_ID	Function_description	E-value
NZ_CP018362.1\|WP_038423277.1\|4778630_4780748_-\|chitinase	gnl\|CDD\|225862	COG3325, ChiA, Chitinase [Carbohydrate transport and metabolism].	9.41372e-126
NZ_CP018362.1\|WP_038424204.1\|4775545_4776553_-\|Fe(3+)-siderophore-ABC-transporter-permease	gnl\|CDD\|182464	PRK10441, PRK10441, Fe(3+)-siderophore ABC transporter permease.	2.10015e-179
NZ_CP018362.1\|WP_014228361.1\|4784930_4785782_+\|isochorismatase	gnl\|CDD\|224452	COG1535, EntB, Isochorismate hydrolase [Secondary metabolites biosynthesis, transport, and catabolism].	1.91369e-131
NZ_CP018362.1\|WP_032694351.1\|4782124_4783300_+\|isochorismate-synthase-EntC	gnl\|CDD\|184977	PRK15016, PRK15016, isochorismate synthase EntC; Provisional.	0
NZ_CP018362.1\|WP_014228365.1\|4790679_4791768_-\|oxidoreductase	gnl\|CDD\|182570	PRK10586, PRK10586, putative oxidoreductase; Provisional.	0
NZ_CP018362.1\|WP_032694346.1\|4793427_4794426_+\|ABC-transporter-permease	gnl\|CDD\|224093	COG1172, AraH, Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components [Carbohydrate transport and metabolism].	1.14379e-68
NZ_CP018362.1\|WP_014228363.1\|4787459_4789565_+\|carbon-starvation-protein-CstA	gnl\|CDD\|184976	PRK15015, PRK15015, carbon starvation protein CstA.	0
NZ_CP018362.1\|WP_038424207.1\|4783309_4784917_+\|(2,3-dihydroxybenzoyl)adenylate-synthase-EntE	gnl\|CDD\|236803	PRK10946, entE, (2,3-dihydroxybenzoyl)adenylate synthase.	0
NZ_CP018362.1\|WP_014228368.1\|4794570_4795635_+\|sugar-ABC-transporter-substrate-binding-protein	gnl\|CDD\|380528	cd06305, PBP1_methylthioribose_binding-like, similar to methylthioribose-binding protein of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein (PBP1) superfamily. Proteins similar to methylthioribose-binding protein of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein (PBP1) superfamily, which consists of two alpha/beta globular domains connected by a three-stranded hinge. This Venus flytrap-like domain undergoes transition from an open to a closed conformational state upon ligand binding. The sugar-binding domain of the periplasmic proteins in this group is also homologous to the ligand-binding domain of eukaryotic receptors such as metabotropic glutamate receptor (mGluR), DNA-binding transcriptional repressors such as LacI and GalR.	3.42076e-123
NZ_CP018362.1\|WP_071889099.1\|4790199_4790493_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|224937	COG2026, RelE, Cytotoxic translational repressor of toxin-antitoxin stability system [Translation, ribosomal structure and biogenesis / Cell division and chromosome partitioning].	1.17291e-08
NZ_CP018362.1\|WP_014228366.1\|4791928_4793431_+\|sugar-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	0
NZ_CP018362.1\|WP_004130340.1\|4789620_4789818_+\|YbdD/YjiX-family-protein	gnl\|CDD\|225434	COG2879, COG2879, Uncharacterized small protein [Function unknown].	7.34639e-36
NZ_CP018362.1\|WP_032718732.1\|4789814_4790219_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	6.09993e-10
NZ_CP018362.1\|WP_032694345.1\|4797000_4798200_-\|S-methyl-5-thioribose-kinase	gnl\|CDD\|236561	PRK09550, mtnK, methylthioribose kinase; Reviewed.	0
NZ_CP018362.1\|WP_038424209.1\|4786537_4786951_+\|proofreading-thioesterase-EntH	gnl\|CDD\|182337	PRK10254, PRK10254, proofreading thioesterase EntH.	2.8754e-87
NZ_CP018362.1\|WP_014228354.1\|4776665_4777907_+\|enterobactin-transporter-EntS	gnl\|CDD\|236700	PRK10489, PRK10489, enterobactin transporter EntS.	0
NZ_CP018362.1\|WP_038424208.1\|4785781_4786537_+\|2,3-dihydro-2,3-dihydroxybenzoate-dehydrogenase-EntA	gnl\|CDD\|236190	PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated.	2.22393e-168
NZ_CP018362.1\|WP_004848703.1\|4795631_4796873_+\|LVIVD-repeat-containing-protein	gnl\|CDD\|227601	COG5276, COG5276, Uncharacterized conserved protein [Function unknown].	5.4488e-149
NZ_CP018362.1\|WP_038424206.1\|4780977_4781937_-\|Fe2+-enterobactin-ABC-transporter-substrate-binding-protein	gnl\|CDD\|236806	PRK10957, PRK10957, iron-enterobactin transporter periplasmic binding protein; Provisional.	0

>NZ_CP018362.1|WP_038424209.1|4786537_4786951_+|proofreading-thioesterase-EntH
MAWKRQLTLDELNATSVNTMVAHLGIVYTRLEEGVLEAEMPVDVRTHQPFGLLHGGASAALAETLGSMAGWLMTEEGQCVVGTELNATHHRAVSSGKVRGECRALHLGRQGQSWEIAVFDERGRRCCTCRLGTAVLG
>NZ_CP018362.1|WP_038424208.1|4785781_4786537_+|2,3-dihydro-2,3-dihydroxybenzoate-dehydrogenase-EntA
MNGLDFHGRTVWITGAGKGIGYATALAFVEAGAQVTGFDLAFDGESYPFTTETLDVADAQQVAQTCGRLLAGIARLDVLVNAAGILRMGATDVLSQEDWQQTFAVNVGGAFNLFQQTMGQFRRQKGGAIVTVASDAAHTPRIGMSAYGASKAALKSLALTVGLELAGSGVRCNLVSPGSTDTDMQRTLWVSDDAEQQRIRGFGEQFKLGIPLGKIARPQEIANTILFLASDHASHITLQDIVVDGGSTLGA
>NZ_CP018362.1|WP_014228361.1|4784930_4785782_+|isochorismatase
MAIPKLQAYALPEASDIPANKVNWAFEPSRAALLIHDMQEYFLNFWGENSAMMEKVVANIAALREFCKQNHIPVFYTAQPKEQSDEDRALLNDMWGPGLTRSPEQQQVIAALAPDDNDTVLVKWRYSAFHRSPLEEMLKDAGRDQLIITGVYAHIGCMTTATDAFMRDIKPFFVADALADFSREEHLMALNYVAGRSGRVVMTEELLPLPASKAALRALVLPLLDESDEPMDDENLIDYGLDSVRMMALAARWRKVHGDIDFVVLAKNPTIDAWWALLSREVK
>NZ_CP018362.1|WP_038424207.1|4783309_4784917_+|(2,3-dihydroxybenzoyl)adenylate-synthase-EntE
MIEFTRWPEEFAARYRQKGYWQDLPLTYLITRHAENDAPAIIDGDKSYSYREFNRLVDNLASSLQRQGLKRGETALVQLGNVAEFYITFFALLRIGVAPVNALFSHQRSELNAYAAQIEPALLIADREHALFADDDFLNAFVAQHASVRVALLLNDGGERSLAAAIARPDDNFVAHPTPADEVAFFQLSGGSTGTPKLIPRTHNDYEYSIRRSNQLCGVSAETRYLNALPAAHNYAMSSPGSLGVFLAGGVVVLAHDPSATLCFPLLEKHQINLTSLVPPAVSLWLQEIHESGSNARLQSLRLLQVGGARLSATLAARIPAEIGCQLQQVFGMAEGLVNYTRLNDSPERIINTQGCPMCPDDEVWVADAQGNPLPRGEVGRLMTRGPYTFRGYYKSPQHNAEAFDADGFYCSGDLISIDEDGYITVQGREKDQINRGGEKIAAEEIENLLLRHPAVIHVALVSMEDSLLGEKSCAYLVVKEPLRAVAVRRFLREQGVAEFKLPDRVECVDALPLTPVGKVDKKQLRQWLAERKLG
>NZ_CP018362.1|WP_032694351.1|4782124_4783300_+|isochorismate-synthase-EntC
METSLAEEVREKKMTLPPESFFFMSPYRSFTTAGCFSRFSHPAADGENLDGEFQRKMAAAFAAARAAGIAKPIMVGAIPFDTSEPSELFIPTSWETFSRPEKQHSARYASGQQPMDVVQRREIPEQDTFMAMVARAAALTATPEVDKVVLSRLIDITTRERVDSGALLERLIAQNPASYNFHVPLSDGGVLLGASPELLLRKEGAHFSSLPLAGSARRQPDDVLDREAGHRLLASEKDRHEHELVTQAMKAVLAPRSSELSLPDSPQLITTPTLWHLATQIQGAALANENAMSLACLLHPTPALSGFPHQAAKRLINELEPFDRQLFGGIVGWCDDEGNGEWVVTIRCARLQQRTLRLFAGAGIVPASSPLGEWRETGVKLTTMLNVFGLQ
>NZ_CP018362.1|WP_038424206.1|4780977_4781937_-|Fe2+-enterobactin-ABC-transporter-substrate-binding-protein
MNFSTFCRRTLLASGLAIFGISSALAADWPRQITDSRGPHTLESQPLRIVSTSVTLTGSLLAIDAPVVASGATTPNNRVADGQGFLRQWSDVAKERKLSRLYIGEPSAEAVAAQMPDLILISATGGDSAMMLYDQLSTIAPTLIINYDDKSWQALLIQLGEITGHEKQAAERIAEFDKKLAALKEKMKLPPQPVTALVYTAAAHSANIWTKESAQGQLLEQLGFTLADLPGGLHASQSQGKRHDIVQLGGENLAAGLNGQSLFLFAGDQKDADAINANPLLAHLPAVEGKRVYPLGTETFRLDYYSAVLVLQRLAALFA
>NZ_CP018362.1|WP_038423277.1|4778630_4780748_-|chitinase
MATSKLIKGDTLTETSNAADGFNPATEVSAYSYTSARVAKPVYNKYKASTTKPKVFGYYTDWSQYDGRLQGDNSKDNRGRGYDLTNVSPTAYDKIIVGFVGVTGFHKVDNLWRDVVAEGADQCGKVKYEPTFLDPWGDFQSYVNVGHTVSGWDVDPKTVTQSNTKGLLGGLRDLQAKAKQQGHDLVLSMSIGGWSMSNGFHETAASDASRKVFAKGVVKLFKQFPMFSEVDIDWEYPNAEGAGNPYGPEDGENYALLIGELRKQLDAAGLSNVKISIASSAVVKTLGYSNVNALLKAGLYGINVMTYDFFGTPWAESVTHHTNLKALEEGGWGVDTVVGHLLSEGFPAERINIGYAAYTRNGRNAELESLSPLKGTYSPGTGTTVGSFESGTTEWYDIIYNYLDLENQKGRNGFNVYTDKVADADYLYNPDSKLFMSLDTPRTVKAKGEYAASLGLGALFTWTIDQDNGVLVNAAREGLGYEMASEVIDMEPFYFEGINVDPADEPAEPEEEEEDTVQPEPSVNHAPKAAIELMVVGGSRVRLSGEKSSDEDNDELTFSWGVPAAINVADKTAAVIEFDVPKVAEDTEYTFTLFVRDTWGEPSTQQRFVLSVVAATQTDDTEDEPADDQDRTDDTPQPADDDVVPSDETTPYPLWNASTVYGSNWGSFEIVSWKGHNYQVKWWSQGNQPDLNCGQFQVWSDLGAY
>NZ_CP018362.1|WP_158657244.1|4778023_4778230_+|hypothetical-protein
MYLSRRIPGGGALRLSWLPARRRRWTRSPGKRSATREEAAPMYLSRRIPGLRRKRLTRATGPQTAVDS
>NZ_CP018362.1|WP_014228354.1|4776665_4777907_+|enterobactin-transporter-EntS
MNRQSWLLNLSLLKTHPAFRAVFIARFISILSLGLLGVAIPVQIQLMTHSTWQVGLSVTLTGGSMFVGLMIGGVLADRYERKRLILLARGTCGIGFVGLCLNAMLPEPSLIAIYLLGIWDGLFASIGVTALLAATPALVGRENLMQAGAITMLTVRLGSVISPMIGGLLLATGGVAWNYGLAAAGTFITTLTLLRLPRLAPPPQPREHPLKSLYAGLKFLFNSPLIGGIALLGGLLTMASAVRVLYPALAGSWQMSTSQIGLLYAAIPLGAAFGALTSGQLAQTARPGVLMLATTVGSFVAIALFSLMPVWALGALCLALFGWLSAISSLLQYTLIQTQTPENMLGRINGLWTAQNVTGDAIGAALLGGLGAILTPAASASASGWALVIVGVVLVGLLRELRRFQRPETASEN
>NZ_CP018362.1|WP_038424204.1|4775545_4776553_-|Fe(3+)-siderophore-ABC-transporter-permease
MSSSTTAARAFAVPGLLIVLIIAVALSLLVGAKPLPFSVVIDAFTGTCQSADCTIVLDARLPRTLAGLLAGAALGLAGALMQTLTRNPLADPGILGVNSGASFAIVLGAALFGLSSPQEQLLMAFCGAFGASLLVAFTGSQGGGQLSPVRLTLAGVALAAVLEGLSSGIALLNPDVYDQLRFWQAGSLDVRTLQTLKIVLIPVLIAGLVTLLLSRALNSLSLGNDTATALGSRVARTQLIGLLAITVLCGSATAVVGPIAFIGLMMPHMARWLVGADHRWSLPVTLLATPTLLLFADVLGRLLVPGELRVSVVSAFIGAPVLIWLVRRQPRGGGM
>NZ_CP018362.1|WP_014228363.1|4787459_4789565_+|carbon-starvation-protein-CstA
MNNSGKYLIWTLLSVIGAFALGYIALNRGEQINALWIVVAAVCVYLIAYRFYGLYIAKNVLAVDPTRMTPAVRHNDGLDYVPTDKKVLFGHHFAAIAGAGPLVGPVLAAQMGYLPGMIWILAGVVLAGAVQDFMVLFVSTRRDGRSLGELVKEEMGPTAGVLALVACFMIMVIILAVLAMIVVKALTHSPWGTYTVAFTIPLAIFMGIYIRYLRPGRIGEVSVIGLVMLVFAIISGGWVAESPTWAPWFDYTGVQLTWILVGYGFIAAVLPVWLLLAPRDYLSTFLKIGTIVGLAIGILIMRPTLTMPALTKFIDGTGPVWSGSLFPFLFITIACGAVSGFHALIASGTTPKMLANEGQACFIGYGGMLMESFVAIMALVAACIIDPGVYFAMNSPMAVLAPAGVTDVVASAAQVVSSWGFTVTPDTLNQIATEVGEQSIISRAGGAPTLAVGMAYILHGSLGGLMDVSFWYHFAILFEALFILTAVDAGTRAARFMLQDLLGVISPGLKQTSSLPANLLATALCVLAWGYFLHQGVVDPLGGINTLWPLFGIANQMLAGMALMLCAVVLFKMKRQRYAWVALLPTSWLLICTLTAGWQKSFSTDTKVGFLAIANKFQAMIDSGNIPPQYTESQLAQLVFNNRLDAGLTIFFMVVVVVLALFSIKTALAALKEDKPTAKETPYQAMPADADSLVTQAKRAH
>NZ_CP018362.1|WP_004130340.1|4789620_4789818_+|YbdD/YjiX-family-protein
MFDTLSKAGKYLGQAAKMMIGVPDYDNYVEHIRATHPEQTPMTYEEFFRERQDARYGGKGGAKCC
>NZ_CP018362.1|WP_032718732.1|4789814_4790219_-|helix-turn-helix-domain-containing-protein
MAVQIIKDDEGKAQYAVIPYDEYFQMCLQLAELDDETEADLEDIAVEHDIYDNVMLPGDVCDIMDKEKVSLQAAWRILRGLSQQEVANKLGISQSAVSQLEAIDSRPQKRTREKLAAIYGCTQEQISLYLPKEG
>NZ_CP018362.1|WP_071889099.1|4790199_4790493_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MLIWSKVAKKELANTDYRYQQRIKSRLADLGDRTAPRPDVRKLSKPENHYRLRVGDYRVIFTRQGLTLSDLFIVSVKRRTSTTYLHEENMPYGCSDN
>NZ_CP018362.1|WP_014228365.1|4790679_4791768_-|oxidoreductase
MSHSDIRVVPGPANYYSHPGSLARLQDFYSEEQLSRAVWVYGERAIAGAQAFLPAAFNAPGAKKILFKGHCSESDVSELARASGDDRSVVIGVGGGALLDTAKALARRLGLPVVAIPTIAATCAAWTPLSVWYNDAGQALQFEIFDDANFLVLVEPHIILNAPAEYLLAGIGDTLAKWYEAVVLAPQPETLPLTVRLGINGALAIRDVLLESSETALADQQRGELTQAFRDVVDAVIAGGGMVGGLGERYTRVAAAHAVHNGLTVLPQTEKYLHGTKVAYGILVQSALLGQDDVLAQLVQAYRRFNLPTTLAALEVDINNREQLDKVIAHTLRPVESIHFLPVELNAETLRAAFEKVERFAG
>NZ_CP018362.1|WP_014228366.1|4791928_4793431_+|sugar-ABC-transporter-ATP-binding-protein
MTGNRLEMQNISLAFSGFRALSNVAFTLTGGSVHALTGANGAGKSTLMAVLCGTHAHYEGEVVINNQSVSIRSPRDAKQLGIHLVQQEVDVALVPGLSIAENIMLDRLAEPGIAFRWGRLRQLAREALAQLDVSLDVRRSIDSCTLAEKQQILLARALSHHCRFLILDEPTAPLDQNESERLFAVVRRLQRQGIGIVFISHRIHELKAVCDTLTVLRDGRLIESGPMADLSGEQIVEKMLGHELSDIFPPKRPPHSDEVLLQVEGLHDEGLLQDISLRLRKGEILGIAGLAGAGKTELCKALFGASKSRLTRGELNSQPWRPRDPADSVARGLALVPEERRKEGIFIEEPVAMNLAVSADSSFSRWSLFGHRQAWRWAEEVIARVGIRTSGPAQTLRRLSGGNQQKVAIGKWLRGNANVLIFDEPTKGVDVKAKTDLFNAIDGLAREGKGVIYASGEFAELVGLCDRICVLWDGRIVAEIPGAEAREENILYYSTGGAAA
>NZ_CP018362.1|WP_032694346.1|4793427_4794426_+|ABC-transporter-permease
MSKALAVNATVSGRQRFFDFLYKWGMLLTVVLLIAVFGLASDNFLDPFNIINILRSIAIVTVIAIGVSISLTIGGFDLSVGSTASLANALVISLFVWHGFGTTEAILITLALCTLVGLFNAFLIVILRIPDMLATLASLFVIQGVAMTYSYGGSITENMVLPSGDMAEGVIPAAFGSLGQVPTIVIIMLVVTVIAQLALSFTTHGRRMYAIGGNPEAARLSGLRITRYKVAAYVIASLLAGLGGILLASRIGSSQVNAGGGYLMDAVAAAWIGFSLAGSGKPNALGTLVGAVILGVLSNGLVMLSVPYYAMDIIKGLVLAGALALTYFQRRT
>NZ_CP018362.1|WP_014228368.1|4794570_4795635_+|sugar-ABC-transporter-substrate-binding-protein
MKKITFSLIALGLFNAAAAFAETPTPLPAAIAEHSGPIRIAVIRNLGSDDNTTQFVSGAIQEGKKLGFKISTFLSNGDDAKFQDFVNQAISQKYDGIILSQGRDPYATALVKKAVDAGIKVSVFDTAVNGQIPGVTVTQQDDASLTELSFGQLVKDFNGKANIVKLWVAGFPPMERRQAAYQTLLKQNPGIKELESIGAVSSDVQGDTANKVGAILAKYPKGKIDAIWGTWDAFSQGAYKALKENGRTEIKLYSIDISNQDLQLMRESGSPWKVSVAVDPKLIGATNVRLIANKIAGEPTPATYDFKAAAIPQALLAAQPGAVNVASLGKIIPGWGQTEDFIAPWFATLEAKNK
>NZ_CP018362.1|WP_004848703.1|4795631_4796873_+|LVIVD-repeat-containing-protein
MSVLPTPEYSRNMRLIGHSDQGGRPDGVQLMVHRGFAYIGHMVSQGFSVVDVRDPKHPQTVNYIAAPPGTWNVHLQAHDDLLLVINARDLFADARFADEKVYYTRSVGETVSDVRDRGWSAGLRIFDISTPDKPREIAFLSLNGIGIHRIWYVGGRWAYVSALIDGFSDYIFLTIDLADPRKPEVAGRWWLPGMNQAAGETAQWPEGKRYALHHAIIAGDTAYGSWRDGGLTLLDVQDRTQPKLISHRNWSPPFGGGTHTALPLPDRDLLVVLDEAVLDNQQDGEKLIWLFDIRDPTNPVSIATFPQPDEADYVAKGAHFGPHNLHENRPGSFVSSTLIFATYQNAGVRAYDISNPYRPVETGALVPAAPAKMMDTRPGRPRVIQSCDVFVDAQGIIYSTDYNGGLSVIEYLG
>NZ_CP018362.1|WP_032694345.1|4797000_4798200_-|S-methyl-5-thioribose-kinase
MSQYHTFTASDAVAYAQQFGGIDNPSELVSAQEVGDGNLNLVFKIFDIRGVSRIIVKQALPYVRCVGESWPLTLDRARLEAQTLVAHYQHCPQHTVRIVHFDPELAVMVMEDLSDHRIWRGELINNVYYPQAASQLGEYLAQTLFHTSEFYLHPHEKKAQVAQFINPEMCEITEDLFFNDPYQVHERNSYPAALEADVAALRDDAQLKLAVAALKHRFFSHAEALLHGDIHSGSIFVAEGSFKAIDAEFGFFGPIGFDIGTAIGNLLLNYCGLPGHLGIRDAAAAREQRLSDIQQFWTTFAERFQALAAERSRDAALAWPGYASAFLKKVWADAVGFCGTELIRRSVGLSHVADIDTIQDEAMRHECLRHAITLGKALIVIADRIDSVDELIARIRQYG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP018362_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018362_5

5140765-5140972

Orphan

I-F

Consensus_repeat	Method
GTTCACTGCCGTACAGGCAGCTTAGAAA	PILER-CR
GTTCACTGCCGTACAGGCAGCTTAGAAA	CRISPRCasFinder
GTTCACTGCCGTACAGGCAGCTTAGAAA	CRT

3 spacers

The CRISPR arrays of NZ_CP018362_5

>merge|NZ_CP018362|5|5140765-5140972|PILER-CR,CRISPRCasFinder,CRT
GTTCACTGCCGTACAGGCAGCTTAGAAAGTAAAAAACTCCCTACTGTGCTTTACCGGCAGGTTCACTGCCGTACAGGCAGCTTAGAAAAGGTGACCGAAAGGTACTTATCAGGTTCAAACGTTCACTGCCGTGCAGGCAGCTTAGAAACTGGACAGCCAATGCGACAGGTTATGGCTTTACTTCACTGCCGTACAGGCAGCTTATGGT

>NZ_CP018362|5|1|5140765-5140912|PILER-CR
GTTCACTGCCGTACAGGCAGCTTAGAAA	GTAAAAAACTCCCTACTGTGCTTTACCGGCAG
GTTCACTGCCGTACAGGCAGCTTAGAAA	AGGTGACCGAAAGGTACTTATCAGGTTCAAAC
GTTCACTGCCGTGCAGGCAGCTTAGAAA

>NZ_CP018362|5|5|5140765-5140972|CRISPRCasFinder
GTTCACTGCCGTACAGGCAGCTTAGAAA	GTAAAAAACTCCCTACTGTGCTTTACCGGCAG
GTTCACTGCCGTACAGGCAGCTTAGAAA	AGGTGACCGAAAGGTACTTATCAGGTTCAAAC
GTTCACTGCCGTGCAGGCAGCTTAGAAA	CTGGACAGCCAATGCGACAGGTTATGGCTTTA
CTTCACTGCCGTACAGGCAGCTTATGGT

>NZ_CP018362|5|1|5140765-5140972|CRT
GTTCACTGCCGTACAGGCAGCTTAGAAA	GTAAAAAACTCCCTACTGTGCTTTACCGGCAG
GTTCACTGCCGTACAGGCAGCTTAGAAA	AGGTGACCGAAAGGTACTTATCAGGTTCAAAC
GTTCACTGCCGTGCAGGCAGCTTAGAAA	CTGGACAGCCAATGCGACAGGTTATGGCTTTA
CTTCACTGCCGTACAGGCAGCTTATGGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018362.1\|WP_002211347.1\|5141143_5141362_-\|translation-initiation-factor-IF-1	unknown	unknown	gnl\|CDD\|178954
NZ_CP018362.1\|WP_004849433.1\|5145987_5146956_-\|thioredoxin-disulfide-reductase	unknown	unknown	gnl\|CDD\|182343
NZ_CP018362.1\|WP_014228619.1\|5134263_5135379_+\|macrolide-transporter-subunit-MacA	unknown	unknown	gnl\|CDD\|183211
NZ_CP018362.1\|WP_014228628.1\|5144106_5145873_-\|cysteine/glutathione-ABC-transporter-permease/ATP-binding-protein-CydD	unknown	unknown	gnl\|CDD\|236870
NZ_CP018362.1\|WP_009653254.1\|5154484_5155777_+\|serine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235461
NZ_CP018362.1\|WP_004100628.1\|5137944_5138262_+\|ATP-dependent-Clp-protease-adapter-ClpS	unknown	unknown	gnl\|CDD\|225038
NZ_CP018362.1\|WP_014837945.1\|5128529_5130182_-\|hydroxylamine-reductase	unknown	unknown	gnl\|CDD\|235391
NZ_CP018362.1\|WP_042944805.1\|5127550_5128519_-\|NADH-oxidoreductase	unknown	unknown	gnl\|CDD\|236735
NZ_CP018362.1\|WP_025108294.1\|5135375_5137322_+\|macrolide-ABC-transporter-ATP-binding-protein/permease-MacB	unknown	unknown	gnl\|CDD\|182528
NZ_CP018362.1\|WP_042944808.1\|5148117_5152308_+\|DNA-translocase-FtsK	unknown	unknown	gnl\|CDD\|236669
NZ_CP018362.1\|WP_002439523.1\|5147487_5147982_+\|leucine-responsive-transcriptional-regulator-Lrp	unknown	unknown	gnl\|CDD\|183009
NZ_CP018362.1\|WP_038424266.1\|5142384_5144106_-\|cysteine/glutathione-ABC-transporter-ATP-binding-protein/permease-CydC	unknown	unknown	gnl\|CDD\|236865
NZ_CP018362.1\|WP_014228618.1\|5132429_5134088_+\|ATP-dependent-endonuclease	unknown	unknown	gnl\|CDD\|226121
NZ_CP018362.1\|WP_038424265.1\|5141641_5142346_-\|leucyl/phenylalanyl-tRNA--protein-transferase	unknown	unknown	gnl\|CDD\|234720
NZ_CP018362.1\|WP_014837946.1\|5130326_5131226_-\|lysine-exporter-LysO-family-protein	unknown	unknown	gnl\|CDD\|225287
NZ_CP018362.1\|WP_004130911.1\|5152429_5153041_+\|outer-membrane-lipoprotein-chaperone-LolA	unknown	unknown	gnl\|CDD\|129638
NZ_CP018362.1\|WP_004849425.1\|5138292_5140575_+\|ATP-dependent-Clp-protease-ATP-binding-subunit-ClpA	unknown	unknown	gnl\|CDD\|236828
NZ_CP018362.1\|WP_004100627.1\|5137389_5137620_-\|cold-shock-like-protein-CspD	unknown	unknown	gnl\|CDD\|184960
NZ_CP018362.1\|WP_014228617.1\|5131351_5132047_-\|aquaporin-Z	unknown	unknown	gnl\|CDD\|235453
NZ_CP018362.1\|WP_004849446.1\|5153049_5154393_+\|replication-associated-recombination-protein-RarA	unknown	unknown	gnl\|CDD\|237355

Protein	Function_ID	Function_description	E-value
NZ_CP018362.1\|WP_002211347.1\|5141143_5141362_-\|translation-initiation-factor-IF-1	gnl\|CDD\|178954	PRK00276, infA, translation initiation factor IF-1; Validated.	2.9822e-48
NZ_CP018362.1\|WP_004849433.1\|5145987_5146956_-\|thioredoxin-disulfide-reductase	gnl\|CDD\|182343	PRK10262, PRK10262, thioredoxin reductase; Provisional.	0
NZ_CP018362.1\|WP_014228619.1\|5134263_5135379_+\|macrolide-transporter-subunit-MacA	gnl\|CDD\|183211	PRK11578, PRK11578, macrolide transporter subunit MacA; Provisional.	0
NZ_CP018362.1\|WP_014228628.1\|5144106_5145873_-\|cysteine/glutathione-ABC-transporter-permease/ATP-binding-protein-CydD	gnl\|CDD\|236870	PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed.	0
NZ_CP018362.1\|WP_009653254.1\|5154484_5155777_+\|serine--tRNA-ligase	gnl\|CDD\|235461	PRK05431, PRK05431, seryl-tRNA synthetase; Provisional.	0
NZ_CP018362.1\|WP_004100628.1\|5137944_5138262_+\|ATP-dependent-Clp-protease-adapter-ClpS	gnl\|CDD\|225038	COG2127, COG2127, Uncharacterized conserved protein [Function unknown].	2.44335e-47
NZ_CP018362.1\|WP_014837945.1\|5128529_5130182_-\|hydroxylamine-reductase	gnl\|CDD\|235391	PRK05290, PRK05290, hybrid cluster protein; Provisional.	0
NZ_CP018362.1\|WP_042944805.1\|5127550_5128519_-\|NADH-oxidoreductase	gnl\|CDD\|236735	PRK10684, PRK10684, HCP oxidoreductase, NADH-dependent; Provisional.	0
NZ_CP018362.1\|WP_025108294.1\|5135375_5137322_+\|macrolide-ABC-transporter-ATP-binding-protein/permease-MacB	gnl\|CDD\|182528	PRK10535, PRK10535, macrolide ABC transporter ATP-binding protein/permease MacB.	0
NZ_CP018362.1\|WP_042944808.1\|5148117_5152308_+\|DNA-translocase-FtsK	gnl\|CDD\|236669	PRK10263, PRK10263, DNA translocase FtsK; Provisional.	0
NZ_CP018362.1\|WP_002439523.1\|5147487_5147982_+\|leucine-responsive-transcriptional-regulator-Lrp	gnl\|CDD\|183009	PRK11169, PRK11169, leucine-responsive transcriptional regulator Lrp.	6.83837e-117
NZ_CP018362.1\|WP_038424266.1\|5142384_5144106_-\|cysteine/glutathione-ABC-transporter-ATP-binding-protein/permease-CydC	gnl\|CDD\|236865	PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed.	0
NZ_CP018362.1\|WP_014228618.1\|5132429_5134088_+\|ATP-dependent-endonuclease	gnl\|CDD\|226121	COG3593, COG3593, Predicted ATP-dependent endonuclease of the OLD family [DNA replication, recombination, and repair].	0
NZ_CP018362.1\|WP_038424265.1\|5141641_5142346_-\|leucyl/phenylalanyl-tRNA--protein-transferase	gnl\|CDD\|234720	PRK00301, aat, leucyl/phenylalanyl-tRNA--protein transferase; Reviewed.	4.18744e-137
NZ_CP018362.1\|WP_014837946.1\|5130326_5131226_-\|lysine-exporter-LysO-family-protein	gnl\|CDD\|225287	COG2431, COG2431, Predicted membrane protein [Function unknown].	6.86179e-115
NZ_CP018362.1\|WP_004130911.1\|5152429_5153041_+\|outer-membrane-lipoprotein-chaperone-LolA	gnl\|CDD\|129638	TIGR00547, Outer-membrane_lipoprotein_carrier_protein, periplasmic chaperone LolA. This protein, LolA, is known so far only in the gamma and beta subdivisions of the Proteobacteria. The E. coli major outer lipoprotein (Lpp) of E. coli is released from the inner membrane as a complex with this chaperone in an energy-requiring process, and is then delivered to LolB for insertion into the outer membrane. LolA is involved in the delivery of lipoproteins generally, rather than just Lpp, and is an essential protein in E. coli, unlike Lpp itself. [Protein fate, Protein and peptide secretion and trafficking].	1.41927e-116
NZ_CP018362.1\|WP_004849425.1\|5138292_5140575_+\|ATP-dependent-Clp-protease-ATP-binding-subunit-ClpA	gnl\|CDD\|236828	PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional.	0
NZ_CP018362.1\|WP_004100627.1\|5137389_5137620_-\|cold-shock-like-protein-CspD	gnl\|CDD\|184960	PRK14998, PRK14998, cold shock-like protein CspD; Provisional.	1.34932e-46
NZ_CP018362.1\|WP_014228617.1\|5131351_5132047_-\|aquaporin-Z	gnl\|CDD\|235453	PRK05420, PRK05420, aquaporin Z; Provisional.	8.1442e-145
NZ_CP018362.1\|WP_004849446.1\|5153049_5154393_+\|replication-associated-recombination-protein-RarA	gnl\|CDD\|237355	PRK13342, PRK13342, recombination factor protein RarA; Reviewed.	0

>NZ_CP018362.1|WP_004849425.1|5138292_5140575_+|ATP-dependent-Clp-protease-ATP-binding-subunit-ClpA
MLNQELELSLNMAFARAREHRHEFMTVEHLLLALLSNPSAREALEACSVDLVALRQELEAFIEQTTPVLPATEEERDTQPTLSFQRVLQRAVFHVQSSGRSEVTGANVLVAIFSEQESQAAYLLRKHEVSRLDVVNFISHGTRKDEPSQSSDNSGSQPGSSEEQAGGEDRMENFTTNLNQLARVGGIDPLIGREKELERAIQVLCRRRKNNPLLVGESGVGKTAIAEGLAWRIVQGDVPEVMADCTIYSLDIGSLLAGTKYRGDFEKRFKALLKQLEQDTNSILFIDEIHTIIGAGAASGGQVDAANLIKPLLSSGKIRVIGSTTYQEFSNIFEKDRALARRFQKIDITEPSVEETVQIINGLKPKYEAHHDVRYTAKAVRAAVELAVKYINDRHLPDKAIDVIDEAGARARLMPVSKRKKTVNVADIESVVARIARIPEKSVSRSDRDTLKNLGDRLKMLVFGQDKAIEALTEAIKMARAGLGHEHKPVGSFLFAGPTGVGKTEVTVQLAKSLGIELLRFDMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDAVIKHPHAVLLLDEIEKAHPDVFNLLLQVMDNGTLTDNNGRKADFRNVVLVMTTNAGVRETERKSIGLIHQDNSPDAMDEIKKIFTPEFRNRLDNIIWFDHLSTTVIHQVVDKFIVELQVQLDQKGVSLEVSQEARDWLAEKGYDRAMGARPMARVIQDNLKKPLANELLFGSLVDGGQVTVELDKEKNALTYDFQSAQKHKPEAAH
>NZ_CP018362.1|WP_004100628.1|5137944_5138262_+|ATP-dependent-Clp-protease-adapter-ClpS
MSKRDWLDFDQLIEDEVKDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLTVHYQGKAICGVFTAEVAETKVSMVNQYARENEHPLLCTLEKA
>NZ_CP018362.1|WP_004100627.1|5137389_5137620_-|cold-shock-like-protein-CspD
MEMGTVKWFNNAKGFGFICPEGGGEDIFAHYSTIQMDGYRTLKAGQAVRFDVHQGPKGNHASVIVPVEAEETETAA
>NZ_CP018362.1|WP_025108294.1|5135375_5137322_+|macrolide-ABC-transporter-ATP-binding-protein/permease-MacB
MTALLELRDIRRSYPSGDGNVEVLKGITLNIAAGEMVAIVGASGSGKSTLMNILGCLDKPTGGTYRVAGTDVARLNGDELARLRREHFGFIFQRYHLLSHLTAAQNVEVPAVYAGAERKARLARAHELLVRLGLGDRAEYQPSQLSGGQQQRVSIARALMNGGEVILADEPTGALDSRSGEEVMGILHQLKAQGHTVIIVTHDPQVAAQAERVIEIHDGEIVRNPPALSPAQGGVLRQRTAAEPSAWRQFSSGFREALIMAWRAMAANKMRTLLTMLGIIIGIASVVSIVVVGDAAKQMVLADIRAIGTNTIDVYPGKDFGDDDPRYQQSLKYDDLLAIQKQPWVSSATPAVSKSLRLRADNIDVAASAEGVGAQYFNVYGMTFSEGNTFNELQLNSRAQVVVLDSNARRQLFPHKARVVGEVILVGNMPATVIGVADEKQSMFGSSKILRVWLPYTTMAGRVMGQSWLNSITVRVNEGYDSAVAEQQLLRLLELRHGKKDVFTWNMDSILKTAERTTHTLQLFLTLVAVIALVVGGIGVMNIMLVSVTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALGVTLSLLIAFVLQLFLPGWEIGFSPLALLTAFLCSTLTGVLFGWLPARNAARLDPVDALARE
>NZ_CP018362.1|WP_014228619.1|5134263_5135379_+|macrolide-transporter-subunit-MacA
MKLNGKRRKVWWLLAIVVLALAVWGWRILNAPLPQYQTLVVRKGDLQQSVLATGKLDALKKVDVGAQVSGQLKTLRVEIGDKVKKDQLLGVIDPEQAENQIKEVEATLMELRAQLNQARAERKLSAATLARQQQLAQRQLVSRQDLDTAATDLAVKEAQIGTIEAQVKRNQATLDTAKTNLDYTKILAPMSGEVTQITTLQGQTVIAAQQAPNILTLADLSTMLVKAQVSEADVIHLKPGQKAWFTVLGDPLTRYEGTLKDILPTPEKVNDAIFYYARFEVPNPQGILRLEMTAQVHIQLSEVKNVITIPLSALGEAIGDNRYHVRLLRTGEVKEREIVIGARNDTDVAVVKGLDEGDEVIIGEGAAGAAK
>NZ_CP018362.1|WP_014228618.1|5132429_5134088_+|ATP-dependent-endonuclease
MHLERVEIVGFRGINRLSLMLEQNNVLIGENAWGKSSLLDALTLLLSPEFDLYHFVREDFWFPPGDIQGREHHLHIILTFRENEPGRHRVRRYRPLSSCWVPCDDGYQRVFYRLEGELADDDSVMTLRSFIDGEGKALELDDIDELARHLVRLMPVLRLRDARFMRRIHNGTVPHSPQIEITARQLDFLSRELVHHPQNLTDGQIRQGLSAMVQLLEHYFAEQSSAQSRHRLMRRHSHDEQRSWRYLDIINRMIDKPGGRSHRVILLGLFSTLLQAKGTVRLDRDARPLLLIEDPETRLHPIMLSVAWHLLNLLPLQRVTTTNSGELLSLTPVEHVCRLVRESSRVSAWRLGPGGMNAEDSRRIAFHIRFNRASSLFARCWLLVEGETETWVINELARQCGHHFDAEGVKVIEFAQSGLKPLIKFARRMGIEWHVLVDGDEAGKKYAATVRSLLNDDKMLERDHLTALPAMDMEHFMYRQGFDDVYHRVAQLPMNIPMNMRRVITKAIHRSSKPDLAIEVAMEAGRRGVDAIPALLKKMFSRVLWLARGRAD
>NZ_CP018362.1|WP_014228617.1|5131351_5132047_-|aquaporin-Z
MFRKLAAECFGTFWLVFGGCGSAVLAAAFPELGIGFAGVALAFGLTVLTMAYAVGHISGGHFNPAVTLGLWAGGRFPARDVIGYIIAQVVGGIIAAAILYVVASGKAGFDAAASGFASNGYGEHSPGGFSMLSAIVIEIVLTCGFLLVIHGATDKNAPAGFAPVAIGLALTLIHLISIPVTNTSVNPARSTAVAIFQGGWALQQLWLFWVMPIIGGILGGVLYRTLLEKRS
>NZ_CP018362.1|WP_014837946.1|5130326_5131226_-|lysine-exporter-LysO-family-protein
MFSGLLIILLPLVIGYLIPLHRPSALKLIARLLSWIVYVILFFMGISLAFLDNLASNLLAILHYAAVSVVIILLCNIAALMWLEQKMPWQNHHRQEKLPSRLAMALESLQLCGVVFIGFMIGLSGISFLQHATEASEYTLIFLLFLIGIQLRNNGMTLRQIVLNRRGMIVAVVVMVSSLLGGIINAFILDLPLKTGLAMASGFGWYSLSGILLTESYGPVIGSAAFFNDLARELLAIMLIPGLVRRSRSTALGLCGATSMDFTLPVLQRSGGVEIVPAAIVHGFILSLLVPILMAFFSA
>NZ_CP018362.1|WP_014837945.1|5128529_5130182_-|hydroxylamine-reductase
MFCVQCEQTIRTPAGNGCSYAQGMCGKTAETSDLQDLLIASLQGLSAWALKAREYGIIDHDIDSFAPRAFFSTLTNVNFDSPRIVGYAREAITLREALKAQCLNIDAQATVNNPMADLQLASDDLGDLQRQAAEFTPNKDKAAIGENILGLRLLCLYGLKGAAAYMEHAHVLGQYDNDIYAQYHKIMAWLGTWPADMNALLECSMEIGQMNFKVMSILDAGETTKYGHPTPTQVNVKATEGKCILISGHDLKDLYNLLEQTEGTGVNVYTHGEMLPAHGYPELRKFKHLIGNYGSGWQNQQVEFARFPGPIVMTSNCIIDPTVGAYDDRIWTRSIVGWPGVNHLEGEDFAPVIAQAQQMAGFPYSEIPHLITVGFGRQTLLGAADTLIDLVSREKLRHIFLVGGCDGARGERNYFTDFATSVPDDCLILTLACGKYRFNKLEFGDIEGLPRLVDAGQCNDAYSAIILAVTLAEKLGCGVNDLPLSLVLSWFEQKAIVILLTLLSLGVKNIVTGPTAPGFFTPDLLAVLNEKFGLRSVTTVEEDMKQLLSA
>NZ_CP018362.1|WP_042944805.1|5127550_5128519_-|NADH-oxidoreductase
MTMPTHQCPWRMQVHHIHQETPDVWTISLLCHDYYPYRAGQYALVSVRHSAETLRAYTISSTPGVSEYITLTIRRIDDGAGSQWLTRDVKRGDYIWLSDAMGEFTCEDKAEDKFLMLAAGCGVTPIMSMRRWLAKYRPQADVQVIFNVRSPQDVIFADEWREYPVTLVAENNATHGFVSGRLTIDLLKSVPDLTSRTVMTCGPAPYMDWVEQEVKALGATRFFKEQFFTLVAEAATSGLKFTKLQPAKAFYAPVGTTLLEALESNKVPVTVACRAGVCGCCKTKVVSGEYTVSSTMTLTDAEIAEGYVLACSCHPQGDLVLA
>NZ_CP018362.1|WP_002211347.1|5141143_5141362_-|translation-initiation-factor-IF-1
MAKEDNIEMQGTVLDTLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLSKGRIVFRSR
>NZ_CP018362.1|WP_038424265.1|5141641_5142346_-|leucyl/phenylalanyl-tRNA--protein-transferase
MRLVQLSHHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPDKFHLSRSMKRFHQRSPYRVTLNHAFGQVIEGCADHRDEGTWITPGIVQAYHQLHELGHAHSVEVWQGKKLVGGMYGVAQGALFCGESMFSRAENASKTALLVFSQIFSHDGGKLIDCQVLNKHTASLGAVEIPRRDYLDYLSVLRTYRLSERFWVPRVLFAGEA
>NZ_CP018362.1|WP_038424266.1|5142384_5144106_-|cysteine/glutathione-ABC-transporter-ATP-binding-protein/permease-CydC
MRALWPYLALYKRHKWLLLLGIVLAIVTLLASIGLLTLSGWFLSASAVVGVAGIYSFNYMLPAAGVRGAAIIRTAGRYFERLVSHDATFRVLQHLRVFTFSKLLPLSPAGLARFRQGELLNRVVADVDTLDHLYLRVISPLVGALVVILVVTVGLSVLDATLALTLGGIMLLTLLVMPPLFYRAGKPAGESITRLRGQYRQHLTSWLQGQAELMLFNASDRYRQQMEKTEARWLDAQRRQAELTALSQALMLLIGGIAVIAMLWLASAGVGGDTQPGALIALFVFCALAAFEALAPVTGAFQHLGQVIASAKRITQITEQEPEVTFTHGEGQTLENVSLRLHQVTFSYPQQPSPALEKVSLQIEAGEHIAILGRTGCGKSTLLQLLTRAWDPAEGEILLNNQPLGQFNEATLRRAMSVVPQRVHLFSATLRDNLLLASPGASDARLAQTLERVGLAKLLEDSGLNSWLGEGGRQLSGGELRRLAIARALLHDAPLMLLDEPTEGLDATTESQILDLLAEVMREKTVLMVTHRLRGLARFNQIIVMDNGKIIEQGSHAELLAEQGRYYQFKQRL
>NZ_CP018362.1|WP_014228628.1|5144106_5145873_-|cysteine/glutathione-ABC-transporter-permease/ATP-binding-protein-CydD
MNKTRQQELTRWLKDQSIISRRWLMISRVLGVVSGLLIVAQAWFLARILHRMIMENIPATALLLPFTLLVLVFVLRAWVVWLRERVGFQAGQHIRLEIRRQVLDRLQQAGPAWIQGKPAGSWATLILEQIDDMHDYYARYLPQMTLAASVPLLIVITIFPINWAAALILLGTAPLIPLFMALVGMGAADANRRNFLALARLSGHFLDRLRGMETLRIFHRGEAETDNIREASQDFRQRTMEVLRLAFLSSGVLEFFTSLSIALVAVYFGFSYLGELNFGHYGAGVTLMSGFLALILAPEFFQPLRDLGTFYHAKAQAIGAADSLKTFMEAPLAQAERGEKALKDDETVSLEARDLLIKSPEGKVLAGPLNFSLRAGERVVLVGQSGSGKSSLLNTLTGFLPYDGSLKVNGVELKSLDADRWRRLLSWVGQNPQLPAATLRENVLLSCPEATEAQLQLALDKAWVSEFVSLLPQGINTPVGDQAGRLSVGQAQRVAVARALLVPCRLLLLDEPAASLDAHSEQRVMQALTNASTQQTTLMVTHQLEGLANWDAIWVMQDGRIVEQGSYSQLAAAGGPFATLLAHRQEEI
>NZ_CP018362.1|WP_004849433.1|5145987_5146956_-|thioredoxin-disulfide-reductase
MGTAKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEIIFDHINSVDLQNRPFRLVGDSGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVESGNIVLHTHRTLEEVTGDQMGVSGLRLRDTQNADNVESLEVAGLFVAIGHSPNTAIFAGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLADACK
>NZ_CP018362.1|WP_002439523.1|5147487_5147982_+|leucine-responsive-transcriptional-regulator-Lrp
MVDSKKRPGKDLDRIDRNILNELQKDGRISNVELSKRVGLSPTPCLERVRRLERQGFIQGYTALLNPHYLDASLLVFVEITLNRGAPDVFEQFNSAVQKLEEIQECHLVSGDFDYLLKTRVPDMSAYRKLLGETLLRLPGVNDTRTYVVMEEVKQSNRLVIKTR
>NZ_CP018362.1|WP_042944808.1|5148117_5152308_+|DNA-translocase-FtsK
MSQEYTEDKEVKFTKLSSGRRLLEALLILCSLFAIWLMAALLSFNPSDPSWSQTAWHEPIHNIGGTPGAWLADTLFFIFGVMAYTIPVIIIGGCWFAWRHQENDEYIDYFAVSLRLIGALALILTSCGLAAINADDIWYFASGGVIGSLLSTTLQPLLHSSGGTIALLCIWAAGLTLFTGWSWVSIAEKLGGAILSILTFASNRTRRDDTWVDEGEYEDDEEEYEDDEPAKQQGSRRARILRSALARRQRLAEKFSNPMGRKTDAALFSGKRMDDAEDEVQYSAGGAPVAADDVLFSGSSAARPANADDVLFSGVSAARPGDFDPYDPLLNGHSIADPVALAAQDTAAPQAWSEPLPGYEAQPVYHPEQAPVQQPAYQPEPAYQPQHAYQPEQAPVQQPAYQPAPAYQPQHAYQPEQAPVQQPAYQPAPAYQPQHAYQPEQAPVQQPAYQPEPAYPPQHAYQPEQAPVQQPAYQPEPAYQPQHAYQPEQAPVQQPAYQPEPAYQPQHAYQPEQAPVQQPAYQPEPAYQPQHAYQPEQAPVQQPEPYAASVEPEPPQEEVKPQRPPMYYFEEVEEKRAREREQLAAWYQPIPEPVSPVATKPIAPPPAPAADVAAVSALAAGVHQATGAASASAAAASVASTASSAAPLFSPASGGPRAQVKEGIGPKLPRPNRVRVPTRRELASYGIKLPSQRLAEERARQAEHQHYDDDALTDEEVAELEQGELARQFAAAQNQRYGDSYAAEEDDVDEDSAAEAELARQFAASQQQRYASEQPPGSHPSSAADYEFSPMKTLVDDTPSEPVFTPLPEVQQPAPQYQQPAQHSQPVQQPMPHQQMPQPPQHAQQQAYQPAQQQPVHHQPMPQQAPGSYPQQQAPQQPIPQPQESLIHPLLMRNGDSRPLQKPTTLLPSLDLLTPPPAEVEPIDTFALEQMARLVEARLADFRIKADVVNYSPGPVITRFELNLAPGVKAARISNLSRDLARSLSTAAVRVVEVIPGKPYVGLELPNKKRQTVYLREVLDNAKFRDNPSPLTVVLGKDIAGEPVTADLAKMPHLLVAGTTGSGKSVGVNAMILSMLYKAQPEDVKFIMIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWSVNEMERRYKLMSALGVRNLAGYNEKIAEAARMGRPIPDPYWKPGDSMDATHPVLKKEPYIVVLVDEFADLMMTVGKKVEELIARLAQKARAAGIHLVLATQRPSVDVITGLIKANIPTRIAFTVSSKIDSRTILDQGGAESLLGMGDMLYSAPNSTIPVRVHGAFVRDEEVHAVVQDWKARGRPQYVDGITSDSESEGGGGGYEGGEELDPLFDQAVNFVTEKRKASISGVQRQFRIGYNRAARIIEQMEAQGIVSEQGHNGNREVLAPPPFE
>NZ_CP018362.1|WP_004130911.1|5152429_5153041_+|outer-membrane-lipoprotein-chaperone-LolA
MKKLAITCALLSSFVVSQVWADAASDLKSRLDKVSSFHSSFTQKVTDGSGNAVQDGQGDLWVKRPNLFNWHMTQPDESVLVSDGKTLWFYNPFVEQATATWLKDATSNTPFMLIARNQASDWQNYNIKQNGDDFVLTPKNGSGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDASKFTFTPPQGVTVDDQRK
>NZ_CP018362.1|WP_004849446.1|5153049_5154393_+|replication-associated-recombination-protein-RarA
MSNLSLDFSDNAFQPLAARMRPENLAQYIGQQHLLAPGKPLPRAIEAGHLHSMILWGPPGTGKTTLAEVIARYASADVERISAVTSGVKEIREAIERARQNRNAGRRTILFVDEVHRFNKSQQDAFLPHIEDGTITFIGATTENPSFELNSALLSRARVYLLKSLTSDDIEQVLNQAMSDKTRGYGGQNIVLPDETRKAIADLVNGDARRALNTLEMMADMAEADASGNRVLKVELLTEIAGERSARFDNKGDRFYDLISALHKSVRGSAPDAALYWYARIITAGGDPLYVARRCLAIASEDVGNADPRAMQVAISAWDCFTRVGPAEGERAIAQAIVYLACAPKSNAVYTAFKAAMADARERPDYDVPVHLRNAPTKLMKEMGYGQEYRYAHDEPNAYAAGEQYFPQEMAQTRYYKPTNRGLEGKIGEKLAWLTEQDQNSPIKRYR
>NZ_CP018362.1|WP_009653254.1|5154484_5155777_+|serine--tRNA-ligase
MLDPNLLRTEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVQTENLQAERNSRSKSIGQAKARGEDIEPLRLEVNKLGEQLDAAKTELDALLAEIRDIALAIPNIPHDDVPAGRDENDNVEVSRWGTPREFDFDVRDHVTLGEMHGGLDFAAAVKLTGSRFVVMKGQLARLHRALAQFMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTAEVPLTNLVRDEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRPEDSMAALEEMTGHAEKVLQLLGLPYRKVALCTGDMGFSACKTYDLEVWVPAQNTYREISSCSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEIPEVLRPYMRGLEFIG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP018362_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018362_6

5246397-5247445

Orphan

Consensus_repeat	Method
GANTCNGANTCNGACAGCGANTCGGANTC	CRT

16 spacers

The CRISPR arrays of NZ_CP018362_6

>merge|NZ_CP018362|6|5246397-5247445|CRT
GATACCGACTCCGACAGCGACTCGGATTCAGACAGTGACTCCGACTCGGACAGCGATGCTGACTCTGACAGTGATTCCGATTCTGACAGCGACTCGGATTCGGACAGTGATTCGGATTCGGACAGTGATTCGGATTCGGACAGTGACTCCGACTCGGATTCAGACAGCGATTCGGACTCTGACAGCGACTCTGACTCTGACAGTGACTCCGACTCTGACAGCGACTCGGATTCCGACAGCGACTCGGATTCAGACAGCGATTCGGACTCTGACAGCGACTCTGACAGCGATTCGGATTCTGACAGTGACTCCGATTCCGACAGCGATTCTGATTCTGACAGTGACTCCGATTCTGACAGCGACTCGGATTCTGACAGCGACTCGGATTCTGACAGTGACTCGGATTCTGATAGTGATTCCGACTCTGACAGCGACTCGGACTCTGACAGCGACTCTGACTCCGACAGTGATTCGGATTCGGACAGCGATTCGGACTCGGATAGCGATTCGGACTCCGACAGCGACTCGGATTCCGACAGTGATTCCGACTCTGACAGCGACTCTGACTCCGACAGCGATTCGGATTCAGACAGCGATTCGGACTCTGACAGCGACTCTGACAGCGATTCGGATTCTGACAGTGACTCCGATTCCGACAGCGATTCTGATTCTGACAGTGACTCCGATTCTGACAGCGACTCGGATTCTGACAGCGACTCGGATTCTGACAGTGACTCGGATTCTGATAGTGATTCCGACTCTGACAGCGACTCGGACTCTGACAGCGACTCTGACTCCGACAGTGATTCGGATTCGGACAGCGATTCGGACTCGGATAGCGATTCGGACTCCGACAGCGACTCGGATTCCGACAGTGATTCCGACTCTGACAGCGACTCTGACTCCGACAGCGATTCGGACTCTGACAGCGATTCCGACTCCGATAGTGATTCCGATTCTGACAGCGACTCCGACTCGGACAGCGATTCGGACTCTGACAGTGATTCGGATTCAGACAGCGATGCCGACTCTGATAGCGACTCGGATAT

>NZ_CP018362|6|2|5246397-5247445|CRT
GATACCGACTCCGACAGCGACTCGGATTC	AGACAGTGACTCCGACTCGGACAGCGATGCTGACTCTGACAGT
GATTCCGATTCTGACAGCGACTCGGATTC	GGACAGTGATTCGGATTCGGACAGTGATTCG
GATTCGGACAGTGACTCCGACTCGGATTC	AGACAGCGATTCGGACTCTGACAGCGACTCTGACTCTGACAGT
GACTCCGACTCTGACAGCGACTCGGATTC	CGACAGCGACTCGGATTCAGACAGCGATTCGGACTCT
GACAGCGACTCTGACAGCGATTCGGATTC	TGACAGTGACTCCGATTCCGACAGCGATTCTGATTCTGACAGT
GACTCCGATTCTGACAGCGACTCGGATTC	TGACAGCGACTCGGATTCTGACAGTGACTCGGATTCTGATAGT
GATTCCGACTCTGACAGCGACTCGGACTC	TGACAGCGACTCTGACTCCGACAGT
GATTCGGATTCGGACAGCGATTCGGACTC	GGATAGCGATTCGGACTCCGACAGC
GACTCGGATTCCGACAGTGATTCCGACTC	TGACAGCGACTCTGACTCCGACAGC
GATTCGGATTCAGACAGCGATTCGGACTC	TGACAGCGACTCTGACAGC
GATTCGGATTCTGACAGTGACTCCGATTC	CGACAGCGATTCTGATTCTGACAGTGACTCCGATTCTGACAGC
GACTCGGATTCTGACAGCGACTCGGATTC	TGACAGTGACTCGGATTCTGATAGTGATTCCGACTCTGACAGC
GACTCGGACTCTGACAGCGACTCTGACTC	CGACAGTGATTCGGATTCGGACAGCGATTCGGACTCGGATAGC
GATTCGGACTCCGACAGCGACTCGGATTC	CGACAGTGATTCCGACTCTGACAGC
GACTCTGACTCCGACAGCGATTCGGACTC	TGACAGCGATTCCGACTCCGATAGTGATTCCGATTCTGACAGC
GACTCCGACTCGGACAGCGATTCGGACTC	TGACAGTGATTCGGATTCAGACAGC
GATGCCGACTCTGATAGCGACTCGGATAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018362.1\|WP_014228672.1\|5255825_5257031_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|130902
NZ_CP018362.1\|WP_014228663.1\|5234183_5234636_+\|macrodomain-Ter-protein-MatP	unknown	unknown	gnl\|CDD\|235344
NZ_CP018362.1\|WP_004849520.1\|5234738_5235809_-\|porin-OmpA	unknown	unknown	gnl\|CDD\|236764
NZ_CP018362.1\|WP_014228669.1\|5243163_5243577_+\|CoA-binding-protein	unknown	unknown	gnl\|CDD\|224745
NZ_CP018362.1\|WP_014228664.1\|5236162_5236672_-\|cell-division-inhibitor-SulA	unknown	unknown	gnl\|CDD\|129710
NZ_CP018362.1\|WP_014228668.1\|5242550_5243009_-\|methylglyoxal-synthase	unknown	unknown	gnl\|CDD\|179969
NZ_CP018362.1\|WP_014837988.1\|5264869_5265658_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|197666
NZ_CP018362.1\|WP_004849527.1\|5239898_5240345_-\|YccF-domain-containing-protein	unknown	unknown	gnl\|CDD\|225841
NZ_CP018362.1\|WP_032695057.1\|5237745_5239881_-\|TIGR01666-family-membrane-protein	unknown	unknown	gnl\|CDD\|130727
NZ_CP018362.1\|WP_009651933.1\|5262526_5262844_-\|heat-shock-protein-HspQ	unknown	unknown	gnl\|CDD\|184526
NZ_CP018362.1\|WP_014228673.1\|5257228_5260372_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340855
NZ_CP018362.1\|WP_014228674.1\|5260414_5261353_+\|peptidase	unknown	unknown	unknown
NZ_CP018362.1\|WP_038424275.1\|5240467_5242522_+\|DNA-helicase-IV	unknown	unknown	gnl\|CDD\|182930
NZ_CP018362.1\|WP_014228411.1\|5243728_5244163_+\|IS200/IS605-family-transposase	unknown	unknown	gnl\|CDD\|376616
NZ_CP018362.1\|WP_004849540.1\|5253681_5255829_+\|type-I-secretion-system-permease/ATPase	unknown	unknown	gnl\|CDD\|274550
NZ_CP018362.1\|WP_014228676.1\|5264298_5264853_+\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	unknown	unknown	gnl\|CDD\|182092
NZ_CP018362.1\|WP_014228665.1\|5237134_5237758_+\|TfoX/Sxy-family-DNA-transformation-protein	unknown	unknown	gnl\|CDD\|377438
NZ_CP018362.1\|WP_014228675.1\|5261366_5262068_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|374267
NZ_CP018362.1\|WP_014228671.1\|5252248_5253685_+\|TolC-family-outer-membrane-protein	unknown	unknown	gnl\|CDD\|273829
NZ_CP018362.1\|WP_076752536.1\|5262904_5264107_-\|23S-rRNA-(cytosine(1962)-C(5))-methyltransferase-RlmI	unknown	unknown	gnl\|CDD\|185082

Protein	Function_ID	Function_description	E-value
NZ_CP018362.1\|WP_014228672.1\|5255825_5257031_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|130902	TIGR01843, Hemolysin_secretion_protein_D_plasmid, type I secretion membrane fusion protein, HlyD family. Type I secretion is an ABC transport process that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C-terminus of the transported protein. This model represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This model selects a subfamily closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins. [Protein fate, Protein and peptide secretion and trafficking].	1.72603e-97
NZ_CP018362.1\|WP_014228663.1\|5234183_5234636_+\|macrodomain-Ter-protein-MatP	gnl\|CDD\|235344	PRK05097, PRK05097, macrodomain Ter protein MatP.	4.82387e-101
NZ_CP018362.1\|WP_004849520.1\|5234738_5235809_-\|porin-OmpA	gnl\|CDD\|236764	PRK10808, PRK10808, outer membrane protein A; Reviewed.	0
NZ_CP018362.1\|WP_014228669.1\|5243163_5243577_+\|CoA-binding-protein	gnl\|CDD\|224745	COG1832, COG1832, Predicted CoA-binding protein [General function prediction only].	2.71906e-74
NZ_CP018362.1\|WP_014228664.1\|5236162_5236672_-\|cell-division-inhibitor-SulA	gnl\|CDD\|129710	TIGR00623, Cell_division_inhibitor_SulA, cell division inhibitor SulA. All proteins in this family for which the functions are known are cell division inhibitors. In E. coli, SulA is one of the SOS regulated genes. [DNA metabolism, DNA replication, recombination, and repair].	1.42664e-97
NZ_CP018362.1\|WP_014228668.1\|5242550_5243009_-\|methylglyoxal-synthase	gnl\|CDD\|179969	PRK05234, mgsA, methylglyoxal synthase; Validated.	3.41087e-95
NZ_CP018362.1\|WP_014837988.1\|5264869_5265658_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	2.89692e-19
NZ_CP018362.1\|WP_004849527.1\|5239898_5240345_-\|YccF-domain-containing-protein	gnl\|CDD\|225841	COG3304, COG3304, Predicted membrane protein [Function unknown].	3.39054e-72
NZ_CP018362.1\|WP_032695057.1\|5237745_5239881_-\|TIGR01666-family-membrane-protein	gnl\|CDD\|130727	TIGR01666, Uncharacterized_protein_HI_1680, TIGR01666 family membrane protein. This model represents a clade of sequences from gamma and beta proteobacteria. These proteins are >700 amino acids long and many have been annotated as putative membrane proteins. The gene from Salmonella has been annotated as a putative efflux transporter. The gene from E. coli has the name yccS. [Cell envelope, Other].	0
NZ_CP018362.1\|WP_009651933.1\|5262526_5262844_-\|heat-shock-protein-HspQ	gnl\|CDD\|184526	PRK14129, PRK14129, heat shock protein HspQ; Provisional.	6.30947e-73
NZ_CP018362.1\|WP_014228673.1\|5257228_5260372_+\|glycosyltransferase	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	7.34394e-50
NZ_CP018362.1\|WP_038424275.1\|5240467_5242522_+\|DNA-helicase-IV	gnl\|CDD\|182930	PRK11054, helD, DNA helicase IV; Provisional.	0
NZ_CP018362.1\|WP_014228411.1\|5243728_5244163_+\|IS200/IS605-family-transposase	gnl\|CDD\|376616	pfam01797, Y1_Tnp, Transposase IS200 like. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS200 from E. coli.	1.63084e-47
NZ_CP018362.1\|WP_004849540.1\|5253681_5255829_+\|type-I-secretion-system-permease/ATPase	gnl\|CDD\|274550	TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. This model is related to models TIGR01842 and TIGR01846, and to bacteriocin ABC transporters that cleave their substrates during export. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	0
NZ_CP018362.1\|WP_014228676.1\|5264298_5264853_+\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	gnl\|CDD\|182092	PRK09818, PRK09818, kinase inhibitor.	1.06676e-80
NZ_CP018362.1\|WP_014228665.1\|5237134_5237758_+\|TfoX/Sxy-family-DNA-transformation-protein	gnl\|CDD\|377438	pfam04993, TfoX_N, TfoX N-terminal domain. TfoX may play a key role in the development of genetic competence by regulating the expression of late competence-specific genes. This family corresponds to the N-terminal presumed domain of TfoX. The domain is found as an isolated domain in some proteins suggesting this is an autonomous domain.	4.23909e-28
NZ_CP018362.1\|WP_014228675.1\|5261366_5262068_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|374267	pfam15977, HTH_46, Winged helix-turn-helix DNA binding.	3.03328e-22
NZ_CP018362.1\|WP_014228671.1\|5252248_5253685_+\|TolC-family-outer-membrane-protein	gnl\|CDD\|273829	TIGR01844, Proteases_secretion_protein_PrtF, type I secretion outer membrane protein, TolC family. Members of this model are outer membrane proteins from the TolC subfamily within the RND (Resistance-Nodulation-cell Division) efflux systems. These proteins, unlike the NodT subfamily, appear not to be lipoproteins. All are believed to participate in type I protein secretion, an ABC transporter system for protein secretion without cleavage of a signal sequence, although they may, like TolC, participate also in the efflux of smaller molecules as well. This family includes the well-documented examples TolC (E. coli), PrtF (Erwinia), and AprF (Pseudomonas aeruginosa). [Protein fate, Protein and peptide secretion and trafficking, Transport and binding proteins, Porins].	1.8752e-70
NZ_CP018362.1\|WP_076752536.1\|5262904_5264107_-\|23S-rRNA-(cytosine(1962)-C(5))-methyltransferase-RlmI	gnl\|CDD\|185082	PRK15128, PRK15128, 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI.	0

>NZ_CP018362.1|WP_014228411.1|5243728_5244163_+|IS200/IS605-family-transposase
MGLYRSSSHVYWRCKYHIVWTPKYRFRILKDKLGKELYRTIYILCGIKDCEVLELNVQPDHVHLVVIIPPKISISTLMGHLKGRSAIRLYNRFPHIRKKLWGNHFWSRGYFVDTVGVNEEIIRRYVRHQEKTEQTYEQQMELLE
>NZ_CP018362.1|WP_014228669.1|5243163_5243577_+|CoA-binding-protein
MKENDIAGILTSTRTIALVGASDKPDRPSYRVMKYLLEQGYHVIPVSPKVAGTTLLGQKGYATLADVPEKVDMVDVFRNSEAAWGVAQEAVAIGAKTLWLQLGVINEQAAVLARDAGLNVVMDRCPAIEIPRLGLAR
>NZ_CP018362.1|WP_014228668.1|5242550_5243009_-|methylglyoxal-synthase
MELTTRTLPARKHIALVAHDHCKDMLMKWVERHQPLLAQHTLSATGTTGNLVSRATGLEVHAMLSGPMGGDQQVGALISEGKIDVLIFFWDPLNAVPHDPDVKALLRLATVWNIPVATNVSTADFIIQSPHFSDPVDILIPDYQRYLAERLK
>NZ_CP018362.1|WP_038424275.1|5240467_5242522_+|DNA-helicase-IV
MELRATTLGKRMAQHPYDRVQLLNAGVKVSGDSHEYLIPFNQLLSIHCKRGLVWGELEFTLPGEKVVRLHGTEWSETQRFYHHLNTLWQQWSAEMSDIAADVLRQQLAEVARSSAEGKWLTRQQVSDIQRKIRHALSGLPVPTVRLDAFDNCRELWRQCQSWLSNTEKARLEHNQTFTESMLEQYRGFFAAVESSPLNPAQARAVVNGERSLLVLAGAGSGKTSVLVARAGWLLTRGEAAAEQILLLAFGRQAAQEMDERIRERLGTEEISARTFHSLALHIIQQGSKKAPTISKLESDSAARQKLLVQSWQQQCQEKKAQAKGWRLWLEEEMGWQIPEGDFWQDKKLQRRVASRLDRWVSLMRMHGGSQAEMIAGAPEEVRDLFGKRVKLMAPLLKAWKTALKDENAVDFSGLIHQAINILDKGRFVSPWKHILVDEFQDIAPQRASLLAALRRQNTQTTLFAVGDDWQAIYRFSGAQLSLTTAFNHYFGEGDCCALDTTYRFNSRIGEIANGFIQQNPHQLTKPLNSLVAGDKKAVTLLAEDKLDDLLDKMSGYVKREQRILLLARYHHLKPAALEKAATRWPHLQLDFMTIHASKGQQADYVIILGLQEGDDAFPAPARESIMEQALLPQPEDFPDAEERRLLYVAITRARLRVWLLFNKEQPSPFVEMLEALDVPVARKP
>NZ_CP018362.1|WP_004849527.1|5239898_5240345_-|YccF-domain-containing-protein
MRTVLNILNFILGGFATTLGWLLATLVSIVLIFTLPLTRSCWEITKLSLFPYGNEAVHVDELDPQGKNSLLNAGGTLLNILWFIFFGWWLCLMHIFCGIAQCLTIIGIPVGIANFKIAAIALWPVGRRVVSVETARAAREANARRRFQ
>NZ_CP018362.1|WP_032695057.1|5237745_5239881_-|TIGR01666-family-membrane-protein
MLTPLLRRYTWNSAWLYNIRIFIALCGTTAFPWWLGEVKLTIPLTLGVVAAALTDLDDRLTGRLRNLAITLVCFFIASASVELLFPWPWLFAAGLTVSTIGFILLGGLGQRYATIAFGALLIAIYTMLGVTLYSHWYLQPLFLLAGAVWYNLLTLSGHLIFPIRPLQDNLARSYEQLARYLELKSRLFDPDIEDESQAPLYDLAIANGQLVATLNQTKVSLLTRLRGDRGQRGTRRTLQYYFVAQDIHERASSSHIQYQTLRDHFRYSDVMFRFQRMLSMQAQACQKLSRSILLREPYLHDTHFERAFMHLDAALDRVKASGAPAEQIKALGFLLNNLRAIDAQLATIESVQTTVQSSHNTENLLADDQPGSFSDIWLRLRNNMTPESALFRHAVRMSLVLCAGYAFIQLTGLNHGYWILLTSLFVCQPNYNATRHRLALRIIGTLIGVAIGLPVLLLVPSVEGQLLLIVLTGVLFFAFRNVQYAHATMFITLLVLLCFNLLGEGFEVALPRIFDTLIGCAIAWAAVSFIWPDWKFRNLPRVLEQAINANCRYLDAILEQYHQGRDNRLAYRIARRAAHSRDGELASVVSNLSTEPRAGSQMRETAFRLLCLNHTFTSYISALGAHREKLTTPDILALLDDAVCYVDDALHHSPADEQRVQQALTSLQTRIQHLDPRADSKEPLVLQQIGLLLALLPEICRLQRQVEIQPE
>NZ_CP018362.1|WP_014228665.1|5237134_5237758_+|TfoX/Sxy-family-DNA-transformation-protein
MKKVICLRIHQFRACLSPLGKISCRPLFGGYSLAIDNTVFAMMAEGEIYLRVCEQSAEYRVAHKNPLLKMQKNGRLVALKYYHIDEELWRDSKMLFHLSALSLQSARHEKHRQRHSGRLKNLPNISFHMELQLINSGITDELMLRKIGAKEAWLRLRKINKALTVNILYSLQGAIEGVHAATLPTQQRQELETWATEQMRESESYSG
>NZ_CP018362.1|WP_014228664.1|5236162_5236672_-|cell-division-inhibitor-SulA
MFTSAHANRSPLTSTSVRRLSHDAAEQPANGLISEIVYREDQPMMTQLLLLPLLQQLGQQSRWQLWLTPQQKLSREWVQSSGLPLSKVMQISQLSPANTLESMVRSLRTGNYSVVIGWLSEELSIEEHERLVAAAEEGHAMGFIMRPVRNTAQPGRQLSGLKIHSNLYH
>NZ_CP018362.1|WP_004849520.1|5234738_5235809_-|porin-OmpA
MKKTAIAIAVALAGFATVAQAAPKDNTWYAGAKLGWSQYHDTGFYGNGFQGNNGPTRNDQLGAGAFGGYQVNPYLGFEMGYDWLGRMAYKGSVDNGAFKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADSKGNYASTGVSRSEHDTGVSPVFAGGLEWAVTRDIATRLEYQWVNNIGDAGTVGTRPDNGMLSLGVSYRFGQDDVAPVVAPAPAPAPEVTTKHFTLKSDVLFNFNKSTLKPEGQQALDQLYTQLSNMDPKDGSAVVLGYTDRIGSDAYNQQLSEKRAQSVVDYLVSKGIPASKISARGMGESNPVTGNTCDNVKARAALIDCLAPDRRVEIEVKGYKDVVTQPQA
>NZ_CP018362.1|WP_014228663.1|5234183_5234636_+|macrodomain-Ter-protein-MatP
MKYQQLENLESGWKWTYLVKKHREGELITRYIEASAAQAAVDLLLTLENEPVLVNTWIEQHINPALVNRMKQTIRARRKRHFNAEHQHTRKKSIDLEFMVWQRLAGLAQRRGKTLSETIVQLIEDAEHKEKYASKMSSLKHDLQVLLGKE
>NZ_CP018362.1|WP_014228671.1|5252248_5253685_+|TolC-family-outer-membrane-protein
MRLFKQKRNVITCGYTALFIALNPPFSGHAENSYLMPNDISSQRLTDSQQVAGYNEEIINSQTRISGPLDIKKAVKNAVNWHPAITQEVSKLQEMAQKVDVAKAKYYPQISAGMNNGYSNTYSDAGYTPSLVVSVSQMLYDFGKVSSSVRAADSGVAQQQATVMLNIDQVAHDTAAAVVQVQGYQKLVDIAKAQVDSLKQIGDLIRQRNDAGASSLSDVVQTDTRVEGAQSTLLQYQAALQRWKATLATYIGIGGIATVTDDLPQGMDAACAVSKIDYRSVPAVLAALAQAGQAQAQLDNANAQMLPTISLEPEVTHYLNDNYANSAVLNKTQYSAWVKVQMPIYQGGAMTASRDAAQQSLAAANAAIKTAQLDASQKLNASRDEAVNLAQSLGIQKRQQQLGEQTRALYQDQYLQLGSRPLLDLLNVDQEIYQARFSQVLTESQLRSLELDCLFSTGKMRSVFALEKQNIQGVEIRP
>NZ_CP018362.1|WP_004849540.1|5253681_5255829_+|type-I-secretion-system-permease/ATPase
MTSQNERAGIPHLLDWSNAIAFIANHYRQSFSPGTLHAAAEWATQKTLPEALRHLARHAGLNCQFLSPGDEKMSAWRLPLVVQLRDGQVAVLESFDVNNAVGVRFVKELALLSYCPLETLLPEIEKTIAFRPSAPERDIRTESYLARFQPDWLRKIVLKDIRPYLHVMLASFAINVLALSGILFSMQVYDRVIPAQSYPTLYVLFSGVLLAAVFAFVLKIMRGHVTDLLGKRGDIRVSDRVFGHALRLKNSAVPRSTGSFISQIRELEQVREMMTSTMMTIVADLPFFLLFQVVLFIVSPWLSWIAPVATILMILPGLLLQRKLAALANKNQHENTLRNAILVESIQGLQDIKMMQAESRFLHQWNSYIAITAESGVKTRRLTHGLVSWGMSVQNLLYATVVVVGAPLVINGDITTGAMVAASMLSTRMVAPMTALCGVLARWQQVKTAKASLDNLMALPVEGGQDETRVHRAVLHGNYEFRQAEFRYGLNDAAIPLRINQLSIKAGERIAILGRIGAGKSTLLQAMMGNVELVSGELRLDDLSLPQIDLADIRRNATLLTQEARLFHGTLRENLILGRPAATDDEIFSVLTLCGALEFVRKLPLGLEHVIMEGGLGLSGGQRQSLLLARTLLRDPNIILLDEPTSFFDERTEKAFVEQLAQWAGERTMIIATHKAAVLNIVDRILVIQDGQLALDKPKATVFEQEKARGQVVNI
>NZ_CP018362.1|WP_014228672.1|5255825_5257031_+|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit
MSKIPLMADHDPVALLPDSEEDEAKIVKSRRLILLLAVMLLVGGIWAWFAVLDEVSTGTGKVIPSSREQVIQTLDGGILTELNVREGSKVQAGQVVARLDPTRSESNVGESQAKYRASLAASIRLTAEVNNQPLAFPDSLKAWPALLAEETRLYHSRKEQLSKSTRQLDESLKLVNSELAITERLAKTGAASNVEVLRLRQQVADISFKKIDLNTRYFVDAREQLSKANADVASLAEVIKGRADSVTRLTVRSPVQGIVKNIKVNTIGGVIAPNGELMEIVPVDGRLLIEARISPRDIAFIHPDQQALVKITAYDYAIYGALNGVVETISPDTTQDEAKPDVYYYRVFIRTDYDYLENKSGKRFLIGPGMIATVDIKTGEKTVMDYLVKPFNRAKEALRER
>NZ_CP018362.1|WP_014228673.1|5257228_5260372_+|glycosyltransferase
MALSDLLQQACFQAKKLKSTVLPSDYPAWVIFFSVSDGQSRAHMHISRGTSFDLAWLAGARALQEWRKKQDREPQWLRVDVVDSVEKLSWQSLNEKFMVTKRNYFRFGLAFDPQFNCAMLEQEIAGNALLYDGDNGVVAPNSVNLENYARRRFKQTLSWPQDPQQPLWRFKTQGIFCDRFGTKVMEQSGRGSGYRVIGENWQDECLAEVIKKGTDYLARQVKQDGLYHYGWFPCFDRPVRSYNALRHASSTYSLIEGWEATRQPSVRQAIDRAIAYLVNTLIEVRTLDDGREAAFLCDVGDEIKLGGNAVSILALVKYTETTGDRQYLPLMAQLATGIAFMQDPLSGQFVHVLNSHDLSLKAKFRIIYYDGEAAFALMRLYGLTKAPQWLEMVEKAFAYFIKNKHWQHHDHWLSYCVNELTRFRPEEKYFRFGLNNVRDHLDFVLHRVTTYPTLLELMMAASEMVTRLDASPEHRHLLADFDQQKFWQALEVRARYLLNGFFWPELAMFFKNPARIVNSFFIRHHSYRVRIDDVEHYLSGFIAYQKYHLAAKKPLLPQDDAPPSNNAIPVFLLETLRDVGNGIEVAAMRRAKLFTEHLRTVPWIVTATWNPELSRAVRALKARGALPEEVPVYNLYEWLSDCFEMNAIAALAPLVGNIELRHAVNPGADVAVGKHNFLLRPQGRIIEDYIDSAGNILLRKSFDEKKGNVQLSHLEIALAGGEVKRFAQEEAFYAWMLETRLAEKGRWHFIVDKNKTWKSFVCSRPAQRMACTLSAIIHSHHQLSNGALKSSYRHILEQPELVDRLIVLTDEQWQDLQLEGFPAARMAVIPNHLDNGNIPANPQKAPSQTVIYLARYSEEKQHALLLNAFRKVLTAIPDAQLHTYGVGPLRRSLSARVAEWGLEKAIHINGFTSDIAQAHKTACCTVLCSTQEGQSLSAVEAMAYGTPLISFAIKYGPRDILQDREAGILVPCGDEEALAAALIAVISDKSLQQSMQQAALRNAQRYYGSAIAGRWAAWLQTSERQLDAGAERGNGLEKKRPRAVNVG
>NZ_CP018362.1|WP_014228674.1|5260414_5261353_+|peptidase
MRRVIALLLASCCCSPLLARDVVQVSRCVPGSLLHAHRLEKAHIVDDFHIYYSLQGRDALQYPQDSTGDGVPDVVKDIASQLQAAKYLYTSLLGLRSPLQQKIYRQARQINIYLLTLPKGHGLAFDRVAAETMGDGTALPCGLKIVLNAALRPARNITPAHELFHLYQYGYGVFKQKWYLEGMARWMENAFRPAQERVVPSPGEVTCESNVSRGYSAATFWASYAQQAFAATLVPDNALAYRYVDGSPVFQTRTVPGGAMLAPFFQQLALSSRRISGEMKLPNIRWSEQQQRDGRYSRLICQALSATAQNKK
>NZ_CP018362.1|WP_014228675.1|5261366_5262068_-|helix-turn-helix-domain-containing-protein
MKRNNHSLLRDEILSKVVKPTDHIEKLIEIIAKEHTPCTISKKRNISLTRNGERQCLILFDGSVALNRISDGMILNAESAPFIFGASCQLAYTRHLYVKTKETSRLLLIPQRFFHEQVVKYHLWQSLAMLQDYSSAKVYAHCMTISQLSAYEIIRSHLLELIDEPNVIKNNITAVNYIMDHSFLSRSGIMRVLSKLKSDGYIHLSRGILTDIIDLPEKMNRLYSKSGPAQPAE
>NZ_CP018362.1|WP_009651933.1|5262526_5262844_-|heat-shock-protein-HspQ
MIASKFGIGQQVRHTLLGYLGVIVDVDPEYSLTEPEEDEIAANDELRLAPWYHVVMEDDDGQPIHTYLAEAQLSSEPSDEHPEQPSLDELARTIRQQLQAPRLRN
>NZ_CP018362.1|WP_076752536.1|5262904_5264107_-|23S-rRNA-(cytosine(1962)-C(5))-methyltransferase-RlmI
MTDSIFPRLVLTKGREKSLLRRHPWIFSGAVARMEGKARSGETIDIVDSQGKWLARGAYSPSSQIRARVWSFDRNEAIDNAFFERRLQQAQTWREWLAARDGLDSYRLIAGESDGLPGVTIDRFGDFFVLQLLSAGAEYQRASIVSALQTLFPNCAIYDRSDVAVRKKEGLELAQGPVVGELPPALLPITEHGMQLLVDIQGGYKTGYYLDQRDSRLATRRYVADKRVLNCFSYTGGFAISALMGGCRQVVSVDTSQEALDVAKQNVELNKLDLSKAEFIRDDVFKLLRKYRDAGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNPGGVLLTFSCSGLMTTDLFQKIIADAALDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRIM
>NZ_CP018362.1|WP_014228676.1|5264298_5264853_+|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein
MKTGLKVAAAMMVIMSGTVIAAPFSVSSADMRDGQTLAQTHWFGGFGCTGGNISPQIAWKNAPAGTRSFAVTAYDPDAPTGSGWWHWTVVNIAQQVTGLAAGAGDKNNAKLPAGAIQGRNDFGYAGFGGACPPAGDKPHRYRFTVWALDTPTLPIDGEASGALVGFMLHSHAIASAQLTALAGR
>NZ_CP018362.1|WP_014837988.1|5264869_5265658_+|helix-turn-helix-domain-containing-protein
MRNIHFHHNALTAAEITTRRLCKLHRVTLFSPAICRVNRGSKVIVQGASEMLATPQQLIILPAEVELEVINQPENGLFCSDLLSLTPELLADFKHRYMSEPQTGRLTSLCAPLAPEMSFMWQSVLRAVREGLSAELQHHQAMGLLLALYQAGYAGPLLNERREDITGQVRQIIMLSPAEAWSVAKVAKMLFLGESTLRRRLQQESRSFRQIVEEVRMAYALGQLQSTSRPIGDIAQSSGYLSGSRFSARFRQHYGLLPKHVR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP018362.1	5248319-5248343	0	1.0
NZ_CP018362_5	5.1\|5140793\|32\|NZ_CP018362\|PILER-CR,CRISPRCasFinder,CRT	5140793-5140824	32	NZ_CP018362.1	1054004-1054035	1	0.969
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP018362.1	5248541-5248565	1	0.96
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP018362.1	5248523-5248547	1	0.96
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP018362.1	5248781-5248805	1	0.96
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP018362.1	5248925-5248949	1	0.96
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP018362.1	5249015-5249039	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP018362.1	5248673-5248697	1	0.96
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP018362.1	5248391-5248415	1	0.96
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP018362.1	5248409-5248433	1	0.96
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP018362.1	5248559-5248595	2	0.946
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP018362.1	5248853-5248877	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP018362.1	5249051-5249075	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP018362.1	5248337-5248361	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP018362.1	5248871-5248895	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP018362.1	5248961-5248985	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP018362.1	5248997-5249021	2	0.92
NZ_CP018362_6	6.10\|5247002\|19\|NZ_CP018362\|CRT	5247002-5247020	19	NZ_CP018362.1	5248679-5248697	2	0.895
NZ_CP018362_6	6.12\|5247122\|43\|NZ_CP018362\|CRT	5247122-5247164	43	NZ_CP018362.1	5248469-5248511	2	0.953
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP018362.1	5248505-5248529	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP018362.1	5248763-5248787	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP018362.1	5248907-5248931	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP018362.1	5249069-5249093	2	0.92

1. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to position: 5248319-5248343, mismatch: 0, identity: 1.0

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattccgactctgacagc	Protospacer
*************************

2. spacer 5.1|5140793|32|NZ_CP018362|PILER-CR,CRISPRCasFinder,CRT matches to position: 1054004-1054035, mismatch: 1, identity: 0.969

gtaaaaaactccctactgtgctttaccggcag	CRISPR spacer
gtaaaaaactccctactgtgctttaccgccag	Protospacer
**************************** ***

3. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to position: 5248541-5248565, mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactctgactccgactgt	Protospacer
********************** **

4. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to position: 5248523-5248547, mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactctgactctgacagc	Protospacer
******************.******

5. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to position: 5248781-5248805, mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactccgacagc	Protospacer
************ ************

6. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to position: 5248925-5248949, mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactccgacagc	Protospacer
************ ************

7. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to position: 5249015-5249039, mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactccgacagc	Protospacer
************ ************

8. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to position: 5248673-5248697, mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgactccgactctgacagc	Protospacer
*********.***************

9. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to position: 5248391-5248415, mismatch: 1, identity: 0.96

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgattcggattctgacagc	Protospacer
****************** ******

10. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to position: 5248409-5248433, mismatch: 1, identity: 0.96

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagcgattcggattcagacagc	Protospacer
******.******************

11. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to position: 5248559-5248595, mismatch: 2, identity: 0.946

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgactgtgactcggattcagacagcgattcggactct	Protospacer
**** *.******************************

12. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to position: 5248853-5248877, mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggactctgacagt	Protospacer
************ *****.******

13. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to position: 5249051-5249075, mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggactctgacagt	Protospacer
************ *****.******

14. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to position: 5248337-5248361, mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagc	Protospacer
*********.** ************

15. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to position: 5248871-5248895, mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagtgactcagactccgacagc	Protospacer
******.***** ************

16. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to position: 5248961-5248985, mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactctgacagc	Protospacer
************ *****.******

17. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to position: 5248997-5249021, mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactctgacagc	Protospacer
************ *****.******

18. spacer 6.10|5247002|19|NZ_CP018362|CRT matches to position: 5248679-5248697, mismatch: 2, identity: 0.895

tgacagcgactctgacagc	CRISPR spacer
tgactccgactctgacagc	Protospacer
****  *************

19. spacer 6.12|5247122|43|NZ_CP018362|CRT matches to position: 5248469-5248511, mismatch: 2, identity: 0.953

tgacagtgactcggattctgatagtgattccgactctgacagc	CRISPR spacer
tgacagtgactcggattctgatagtgattccgattccgacagc	Protospacer
*********************************.**.******

20. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to position: 5248505-5248529, mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagcgattcggactctgacagc	Protospacer
******.***** ************

21. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to position: 5248763-5248787, mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgactcggattctgacagc	Protospacer
*********.******** ******

22. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to position: 5248907-5248931, mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgactcggattctgacagc	Protospacer
*********.******** ******

23. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to position: 5249069-5249093, mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgactcggattcggacagc	Protospacer
*********.********.******

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	7-31	0	1.0
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	43-67	0	1.0
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1792-1816	0	1.0
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2440-2464	0	1.0
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2704-2728	0	1.0
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3130-3154	0	1.0
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156331-156361	1	0.968
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153877-153913	1	0.973
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155029-155065	1	0.973
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155263-155299	1	0.973
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	7-31	1	0.96
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	43-67	1	0.96
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1792-1816	1	0.96
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2440-2464	1	0.96
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2704-2728	1	0.96
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1270-1294	1	0.96
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1576-1600	1	0.96
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3112-3136	1	0.96
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3256-3280	1	0.96
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3412-3436	1	0.96
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156619-156643	1	0.96
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157441-157465	1	0.96
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151384-151408	1	0.96
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151420-151444	1	0.96
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155059-155083	1	0.96
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155293-155317	1	0.96
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1072-1096	1	0.96
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	964-988	1	0.96
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1036-1060	1	0.96
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1090-1114	1	0.96
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2908-2932	1	0.96
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1432-1456	1	0.96
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1672-1696	1	0.96
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2482-2506	1	0.96
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2590-2614	1	0.96
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151251-151275	1	0.96
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153541-153565	1	0.96
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156217-156241	1	0.96
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156769-156793	1	0.96
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156919-156943	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3394-3418	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3706-3730	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1768-1792	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1954-1978	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3166-3190	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153253-153277	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153733-153757	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154357-154381	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154519-154543	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154789-154813	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155005-155029	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155185-155209	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155239-155263	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155419-155443	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155455-155479	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156235-156259	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154273-154297	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155485-155509	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155845-155869	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156265-156289	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156637-156661	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156787-156811	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157585-157609	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1126-1150	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	982-1006	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16748-16772	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17744-17768	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18506-18530	1	0.96
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19226-19250	1	0.96
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153853-153877	1	0.96
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156127-156151	1	0.96
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP022118	Salmonella enterica subsp. enterica serovar Macclesfield str. S-1643 plasmid unnamed1, complete sequence	380154-380185	2	0.938
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP030176	Salmonella enterica subsp. enterica serovar Milwaukee str. SA19950795 plasmid pIncFII.1, complete sequence	104205-104236	2	0.938
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153055-153085	2	0.935
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154639-154669	2	0.935
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156349-156379	2	0.935
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1552-1582	2	0.935
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3052-3082	2	0.935
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1624-1654	2	0.935
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3034-3064	2	0.935
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3556-3586	2	0.935
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157063-157105	2	0.953
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151390-151426	2	0.946
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151498-151534	2	0.946
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153457-153493	2	0.946
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154597-154633	2	0.946
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155617-155653	2	0.946
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155653-155689	2	0.946
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153139-153175	2	0.946
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154867-154903	2	0.946
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156793-156829	2	0.946
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2374-2410	2	0.946
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	964-988	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1036-1060	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1090-1114	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2908-2932	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1432-1456	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1672-1696	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2482-2506	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2590-2614	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1342-1366	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2080-2104	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3376-3400	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3688-3712	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151251-151275	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153541-153565	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154753-154777	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154951-154975	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155149-155173	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155383-155407	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156043-156067	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156217-156241	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156391-156415	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156769-156793	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156919-156943	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151654-151678	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151708-151732	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151912-151936	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153097-153121	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153805-153829	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153949-153973	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154219-154243	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154339-154363	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154483-154507	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155437-155461	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155743-155767	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156079-156103	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156733-156757	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156883-156907	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157063-157087	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157117-157141	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157315-157339	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157531-157555	2	0.92
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157603-157627	2	0.92
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153649-153673	2	0.92
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153667-153691	2	0.92
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153685-153709	2	0.92
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156823-156847	2	0.92
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156841-156865	2	0.92
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156991-157015	2	0.92
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157009-157033	2	0.92
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151293-151317	2	0.92
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151492-151516	2	0.92
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151600-151624	2	0.92
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153007-153031	2	0.92
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153451-153475	2	0.92
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154147-154171	2	0.92
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154627-154651	2	0.92
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154861-154885	2	0.92
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157477-157501	2	0.92
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1126-1150	2	0.92
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1504-1528	2	0.92
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1750-1774	2	0.92
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2404-2428	2	0.92
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3004-3028	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1234-1258	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1270-1294	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1306-1330	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1360-1384	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1414-1438	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1468-1492	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1522-1546	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1576-1600	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1990-2014	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2218-2242	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2572-2596	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2818-2842	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2986-3010	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3112-3136	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3256-3280	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3412-3436	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3778-3802	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1000-1024	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1090-1114	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1126-1150	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1750-1774	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1828-1852	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1864-1888	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1936-1960	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2236-2260	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2404-2428	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2782-2806	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2836-2860	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2872-2896	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3004-3028	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3604-3628	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153289-153313	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153307-153331	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153769-153793	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156619-156643	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157441-157465	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151726-151750	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152989-153013	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153415-153439	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154075-154099	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154111-154135	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154447-154471	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154771-154795	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155167-155191	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155221-155245	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155401-155425	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155953-155977	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156841-156865	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157009-157033	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157045-157069	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157225-157249	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157243-157267	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157459-157483	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16676-16700	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17018-17042	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17534-17558	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16766-16790	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16808-16832	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17642-17666	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17762-17786	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17804-17828	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18890-18914	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19244-19268	2	0.92
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19286-19310	2	0.92
NZ_CP018362_6	6.13\|5247194\|43\|NZ_CP018362\|CRT	5247194-5247236	43	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3526-3568	2	0.953
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1018-1042	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1054-1078	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2800-2824	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3292-3316	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1144-1168	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1540-1564	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1612-1636	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1810-1834	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2608-2632	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2632-2656	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3448-3472	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3544-3568	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154393-154417	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154465-154489	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156181-156205	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156427-156451	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157153-157177	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157621-157645	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151528-151552	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151564-151588	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151798-151822	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151876-151900	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153985-154009	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154735-154759	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154933-154957	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155131-155155	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155365-155389	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155725-155749	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156409-156433	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156517-156541	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156601-156625	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156955-156979	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157099-157123	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157261-157285	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157297-157321	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157423-157447	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157639-157663	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16076-16100	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16208-16232	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16340-16364	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17366-17390	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17516-17540	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17582-17606	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18098-18122	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18242-18266	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18680-18704	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18830-18854	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19580-19604	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19724-19748	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19784-19808	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19904-19928	2	0.92
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20090-20114	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156553-156577	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156601-156625	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151636-151660	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151690-151714	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151744-151768	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151762-151786	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151780-151804	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153025-153049	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153907-153931	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154321-154345	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154429-154453	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155827-155851	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155935-155959	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156535-156559	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157189-157213	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157351-157375	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157513-157537	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157549-157573	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21229-21253	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16454-16478	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17132-17156	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15850-15874	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1252-1276	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1486-1510	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1612-1636	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2608-2632	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3094-3118	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3358-3382	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3544-3568	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1054-1078	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1882-1906	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2062-2086	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2098-2122	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2182-2206	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2272-2296	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2668-2692	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3484-3508	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3622-3646	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9787-9811	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9931-9955	2	0.92
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1108-1132	2	0.92
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP026283	Klebsiella oxytoca strain KONIH2 plasmid pKOR-e6bf, complete sequence	32224-32255	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP014073	Klebsiella quasipneumoniae strain FDAARGOS_93 plasmid unnamed2, complete sequence	121749-121780	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP032197	Klebsiella pneumoniae strain AR_0097 plasmid unnamed3, complete sequence	61807-61838	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_KP345882	Escherichia coli strain BK32533 plasmid pBK32533, complete sequence	15850-15881	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP043048	Klebsiella pneumoniae strain KLP268 plasmid pKLP268-2, complete sequence	36554-36585	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP019900	Raoultella planticola strain GODA plasmid unnamed1, complete sequence	31159-31190	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP029448	Serratia marcescens strain CAV1761 plasmid pCAV1761-205, complete sequence	184972-185003	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_KJ721789	Klebsiella pneumoniae strain NJ HT1872 plasmid pUSKPC3, complete sequence	87219-87250	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP025039	Klebsiella pneumoniae strain NU-CRE047 plasmid pNU-CRE047_2, complete sequence	1948-1979	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP031811	Klebsiella pneumoniae strain INF014-sc-2279884 plasmid unnamed1, complete sequence	160072-160103	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP020851	Klebsiella variicola strain KPN1481 plasmid pKPN1481-2, complete sequence	86044-86075	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	MN310379	Klebsiella quasipneumoniae strain A2508 plasmid pA2508-NR, complete sequence	180553-180584	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	MN310380	Raoultella ornithinolytica strain 170602815 plasmid p602815-NR, complete sequence	153684-153715	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP023840	Klebsiella pneumoniae strain 4/1-2 plasmid p4_1_2.1, complete sequence	13418-13449	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP018815	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0002 plasmid tig00000003, complete sequence	96313-96344	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP042483	Klebsiella pneumoniae strain C51 plasmid pC51_002, complete sequence	198101-198132	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP027616	Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed4, complete sequence	96499-96530	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP010881	Escherichia coli strain MNCRE44 plasmid pMNCRE44_5, complete sequence	110494-110525	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP009275	Klebsiella variicola strain DX120E plasmid pKV1, complete sequence	63439-63470	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NC_025131	Klebsiella pneumoniae strain BK30683 plasmid pBK30683, complete sequence	83844-83875	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP029583	Klebsiella pneumoniae strain DA33140 plasmid pDA33140-112, complete sequence	98483-98514	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP010363	Enterobacter hormaechei subsp. oharae strain 34978 plasmid p34978-139.941kb, complete sequence	30013-30044	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP029598	Klebsiella quasipneumoniae subsp. similipneumoniae strain ATCC 700603 plasmid pDA33145-152, complete sequence	150899-150930	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	CP008701	Klebsiella variicola strain Kp5-1 plasmid pKp5-1, complete sequence	123521-123552	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP009773	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH33 plasmid pKPC-63d, complete sequence	15852-15883	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP009776	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH32 plasmid pKPC-def, complete sequence	15844-15875	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP006926	Klebsiella pneumoniae 30660/NJST258_1 plasmid pNJST258N2, complete sequence	15852-15883	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP022825	Klebsiella quasivariicola strain KPN1705 plasmid pKPN1705-2, complete sequence	45342-45373	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP015387	Klebsiella pneumoniae strain NY9 plasmid pNY9_2, complete sequence	83836-83867	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP038276	Raoultella ornithinolytica strain WLK218 plasmid pWLK-107717, complete sequence	26799-26830	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NC_021199	Klebsiella pneumoniae subsp. pneumoniae KPX plasmid pKPX-2 DNA, complete sequence	15327-15358	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP011641	Serratia marcescens strain CAV1492 plasmid pCAV1492-199, complete sequence	129965-129996	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP011633	Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-150, complete sequence	34201-34232	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP011633	Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-150, complete sequence	47402-47433	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP014697	Klebsiella quasipneumoniae strain ATCC 700603 isolate K6 plasmid pKQPS1, complete sequence	42078-42109	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP018361	Klebsiella oxytoca strain CAV1752 plasmid pCAV1752-278, complete sequence	256525-256556	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP013986	Klebsiella variicola strain LMG 23571 plasmid unnamed, complete sequence	15757-15788	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP035211	Klebsiella pneumoniae strain TH164 plasmid pTH164-2, complete sequence	125920-125951	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP024543	Klebsiella pneumoniae strain INF042 plasmid unnamed1, complete sequence	56886-56917	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP045691	Klebsiella pneumoniae strain TK421 plasmid pTK421_1, complete sequence	67607-67638	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP026016	Klebsiella variicola strain 13450 plasmid p13450-2, complete sequence	103997-104028	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP021900	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0136 plasmid tig00001437_pilon, complete sequence	18960-18991	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP021778	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0053 plasmid unitig_3, complete sequence	6216-6247	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP044049	Klebsiella variicola strain FDAARGOS_627 plasmid unnamed1, complete sequence	108487-108518	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_LR130540	Klebsiella variicola strain AJ055 isolate AJ055 plasmid 2	151980-152011	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP032357	Klebsiella variicola strain 15WZ-82 plasmid p15WZ-82_res, complete sequence	155914-155945	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP032357	Klebsiella variicola strain 15WZ-82 plasmid p15WZ-82_res, complete sequence	171530-171561	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP032357	Klebsiella variicola strain 15WZ-82 plasmid p15WZ-82_res, complete sequence	171657-171688	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_MG462728	Escherichia coli strain AMA1416 plasmid pAMA1416, complete sequence	180671-180702	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP033755	Klebsiella pneumoniae strain FDAARGOS_566 plasmid unnamed1, complete sequence	19828-19859	3	0.906
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	NZ_CP054255	Klebsiella variicola strain FH-1 plasmid unnamed, complete sequence	96507-96538	3	0.906
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151888-151918	3	0.903
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153019-153049	3	0.903
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153073-153103	3	0.903
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154657-154687	3	0.903
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154873-154903	3	0.903
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155071-155101	3	0.903
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155305-155335	3	0.903
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156313-156343	3	0.903
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156547-156577	3	0.903
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156565-156595	3	0.903
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3088-3118	3	0.903
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1066-1096	3	0.903
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1606-1636	3	0.903
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2266-2296	3	0.903
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3538-3568	3	0.903
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157243-157285	3	0.93
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157459-157501	3	0.93
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151366-151408	3	0.93
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151654-151696	3	0.93
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151708-151750	3	0.93
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155953-155995	3	0.93
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157531-157573	3	0.93
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2986-3028	3	0.93
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1576-1618	3	0.93
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151426-151462	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153175-153211	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155581-155617	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151534-151570	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151570-151606	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151606-151642	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151936-151972	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151972-152008	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153013-153049	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153367-153403	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153421-153457	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154417-154453	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154633-154669	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154669-154705	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154885-154921	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155065-155101	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155083-155119	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155209-155245	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155299-155335	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155317-155353	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155527-155563	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155851-155887	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155977-156013	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156925-156961	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156961-156997	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157267-157303	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2032-2068	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2278-2314	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2410-2446	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2860-2896	3	0.919
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3628-3664	3	0.919
NZ_CP018362_6	6.5\|5246696\|43\|NZ_CP018362\|CRT	5246696-5246738	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156517-156559	3	0.93
NZ_CP018362_6	6.5\|5246696\|43\|NZ_CP018362\|CRT	5246696-5246738	43	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1810-1852	3	0.93
NZ_CP018362_6	6.6\|5246768\|43\|NZ_CP018362\|CRT	5246768-5246810	43	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1882-1924	3	0.93
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1234-1258	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1306-1330	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1360-1384	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1414-1438	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1468-1492	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1522-1546	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1990-2014	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2218-2242	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2572-2596	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2818-2842	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2986-3010	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3778-3802	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1000-1024	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1090-1114	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1126-1150	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1504-1528	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1750-1774	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1828-1852	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1864-1888	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1936-1960	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2116-2140	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2200-2224	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2236-2260	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2404-2428	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2782-2806	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2836-2860	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2854-2878	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2872-2896	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3004-3028	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3604-3628	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153289-153313	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153307-153331	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153769-153793	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151275-151299	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151366-151390	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151726-151750	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152989-153013	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153169-153193	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153415-153439	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154003-154027	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154057-154081	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154075-154099	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154111-154135	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154447-154471	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154771-154795	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155167-155191	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155203-155227	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155221-155245	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155401-155425	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155773-155797	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155917-155941	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155953-155977	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156145-156169	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156841-156865	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157009-157033	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157045-157069	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157225-157249	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157243-157267	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157405-157429	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157459-157483	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16676-16700	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17018-17042	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17534-17558	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16766-16790	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16808-16832	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17642-17666	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17762-17786	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17804-17828	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18890-18914	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19244-19268	3	0.88
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19286-19310	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153097-153121	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153169-153193	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154219-154243	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155743-155767	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157117-157141	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151251-151275	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151329-151353	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151528-151552	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151564-151588	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151798-151822	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151894-151918	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153133-153157	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153289-153313	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153307-153331	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153631-153655	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153769-153793	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153871-153895	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153907-153931	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153967-153991	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154003-154027	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154075-154099	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154111-154135	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154183-154207	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154237-154261	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154255-154279	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154411-154435	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154951-154975	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155575-155599	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155611-155635	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155647-155671	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156217-156241	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156769-156793	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156919-156943	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156955-156979	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157027-157051	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157135-157159	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157261-157285	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157495-157519	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157567-157591	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1018-1042	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3376-3400	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3688-3712	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1000-1024	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1396-1420	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1594-1618	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1630-1654	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1864-1888	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2236-2260	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2818-2842	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3526-3550	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3562-3586	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21247-21271	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21193-21217	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15868-15892	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15814-15838	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9805-9829	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9949-9973	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9751-9775	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9895-9919	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16790-16814	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17624-17648	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17786-17810	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18872-18896	3	0.88
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19268-19292	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1072-1096	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1108-1132	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1342-1366	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1810-1834	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1918-1942	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2080-2104	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2632-2656	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3274-3298	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3376-3400	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3448-3472	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3688-3712	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3742-3766	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3760-3784	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154753-154777	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154951-154975	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155149-155173	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155383-155407	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156043-156067	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156391-156415	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151384-151408	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151420-151444	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151528-151552	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151546-151570	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151564-151588	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151582-151606	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151600-151624	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151654-151678	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151672-151696	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151708-151732	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151858-151882	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151912-151936	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151984-152008	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152056-152080	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153097-153121	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153187-153211	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153361-153385	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153649-153673	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153667-153691	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153685-153709	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153787-153811	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153805-153829	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153949-153973	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154147-154171	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154219-154243	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154303-154327	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154339-154363	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154483-154507	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154681-154705	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154699-154723	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154717-154741	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154897-154921	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154915-154939	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155059-155083	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155095-155119	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155113-155137	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155293-155317	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155329-155353	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155347-155371	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155437-155461	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155683-155707	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155725-155749	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155743-155767	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155863-155887	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155971-155995	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155989-156013	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156061-156085	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156079-156103	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156733-156757	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156805-156829	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156823-156847	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156883-156907	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156955-156979	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156973-156997	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156991-157015	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157063-157087	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157099-157123	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157117-157141	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157279-157303	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157315-157339	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157333-157357	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157531-157555	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157603-157627	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16094-16118	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16226-16250	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16358-16382	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16634-16658	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16658-16682	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16700-16724	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16868-16892	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16946-16970	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16970-16994	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17036-17060	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17384-17408	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17438-17462	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17600-17624	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17828-17852	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17846-17870	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17870-17894	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17942-17966	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18302-18326	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18326-18350	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18350-18374	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18584-18608	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18602-18626	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18698-18722	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18752-18776	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18848-18872	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18938-18962	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19046-19070	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19070-19094	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19310-19334	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19328-19352	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19352-19376	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19424-19448	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19802-19826	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19976-20000	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21121-21145	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21283-21307	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21301-21325	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21319-21343	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21355-21379	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15760-15784	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15904-15928	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15922-15946	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9679-9703	3	0.88
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9985-10009	3	0.88
NZ_CP018362_6	6.11\|5247050\|43\|NZ_CP018362\|CRT	5247050-5247092	43	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1882-1924	3	0.93
NZ_CP018362_6	6.11\|5247050\|43\|NZ_CP018362\|CRT	5247050-5247092	43	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2062-2104	3	0.93
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1000-1024	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1594-1618	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1864-1888	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2236-2260	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2272-2296	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2668-2692	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2782-2806	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3040-3064	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3742-3766	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155521-155545	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156301-156325	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156445-156469	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151600-151624	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151636-151660	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151690-151714	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153007-153031	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153133-153157	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153325-153349	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153451-153475	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153853-153877	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153907-153931	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153967-153991	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154075-154099	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154111-154135	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154147-154171	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154183-154207	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154237-154261	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154255-154279	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154411-154435	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154447-154471	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154537-154561	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154627-154651	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154807-154831	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154861-154885	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155611-155635	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155647-155671	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156007-156031	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156127-156151	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156319-156343	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156481-156505	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156499-156523	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157027-157051	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157045-157069	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157135-157159	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157189-157213	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157351-157375	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157477-157501	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157513-157537	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157567-157591	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1144-1168	3	0.88
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1018-1042	3	0.88
NZ_CP018362_6	6.15\|5247320\|43\|NZ_CP018362\|CRT	5247320-5247362	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153985-154027	3	0.93
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153061-153085	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151456-151480	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151876-151900	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151966-151990	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153151-153175	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153205-153229	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153325-153349	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153631-153655	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154645-154669	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154663-154687	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154735-154759	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154879-154903	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154933-154957	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155077-155101	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155131-155155	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155311-155335	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155365-155389	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155485-155509	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155503-155527	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156265-156289	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156283-156307	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156319-156343	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156409-156433	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156655-156679	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157297-157321	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157423-157447	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157585-157609	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21031-21055	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16076-16100	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16208-16232	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16340-16364	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17366-17390	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17516-17540	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17582-17606	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18098-18122	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18242-18266	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18680-18704	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18830-18854	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19580-19604	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19724-19748	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19784-19808	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19904-19928	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20090-20114	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15418-15442	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15508-15532	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15634-15658	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1558-1582	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	25-49	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1072-1096	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1288-1312	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1324-1348	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1540-1564	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1768-1792	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1846-1870	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1900-1924	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1954-1978	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2254-2278	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2368-2392	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2422-2446	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2458-2482	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3040-3064	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3148-3172	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3166-3190	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3466-3490	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9553-9577	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	982-1006	3	0.88
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1144-1168	3	0.88
NZ_CP018362_5	5.3\|5140913\|32\|NZ_CP018362\|CRISPRCasFinder,CRT	5140913-5140944	32	MN310379	Klebsiella quasipneumoniae strain A2508 plasmid pA2508-NR, complete sequence	173343-173374	4	0.875
NZ_CP018362_6	6.1\|5246426\|43\|NZ_CP018362\|CRT	5246426-5246468	43	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3742-3784	4	0.907
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151834-151864	4	0.871
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153337-153367	4	0.871
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153607-153637	4	0.871
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155497-155527	4	0.871
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156277-156307	4	0.871
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157183-157213	4	0.871
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1246-1276	4	0.871
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1480-1510	4	0.871
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2680-2710	4	0.871
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3142-3172	4	0.871
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3352-3382	4	0.871
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1138-1168	4	0.871
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151726-151768	4	0.907
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153115-153157	4	0.907
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153433-153475	4	0.907
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154237-154279	4	0.907
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154393-154435	4	0.907
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154447-154489	4	0.907
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154609-154651	4	0.907
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154843-154885	4	0.907
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155593-155635	4	0.907
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155629-155671	4	0.907
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157099-157141	4	0.907
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157225-157267	4	0.907
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1090-1132	4	0.907
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1108-1150	4	0.907
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1792-1834	4	0.907
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2482-2524	4	0.907
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1036-1078	4	0.907
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1090-1132	4	0.907
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151462-151498	4	0.892
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151846-151882	4	0.892
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153103-153139	4	0.892
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154009-154045	4	0.892
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154153-154189	4	0.892
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154759-154795	4	0.892
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154957-154993	4	0.892
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155155-155191	4	0.892
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155389-155425	4	0.892
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156661-156697	4	0.892
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9955-9991	4	0.892
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1072-1096	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1108-1132	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1810-1834	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1918-1942	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2632-2656	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3274-3298	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3448-3472	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3508-3532	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3742-3766	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3760-3784	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151384-151408	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151420-151444	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151528-151552	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151546-151570	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151564-151588	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151582-151606	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151600-151624	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151672-151696	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151858-151882	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151984-152008	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152056-152080	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153187-153211	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153361-153385	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153649-153673	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153667-153691	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153685-153709	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153787-153811	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154147-154171	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154303-154327	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154681-154705	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154699-154723	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154717-154741	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154897-154921	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154915-154939	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155059-155083	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155095-155119	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155113-155137	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155293-155317	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155329-155353	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155347-155371	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155683-155707	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155725-155749	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155863-155887	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155971-155995	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155989-156013	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156061-156085	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156805-156829	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156823-156847	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156955-156979	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156973-156997	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156991-157015	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157099-157123	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157279-157303	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157333-157357	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16094-16118	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16226-16250	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16358-16382	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16634-16658	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16658-16682	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16700-16724	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16868-16892	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16946-16970	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16970-16994	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17036-17060	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17384-17408	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17438-17462	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17600-17624	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17828-17852	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17846-17870	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17870-17894	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17942-17966	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18302-18326	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18326-18350	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18350-18374	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18584-18608	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18602-18626	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18698-18722	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18752-18776	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18848-18872	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18938-18962	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19046-19070	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19070-19094	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19310-19334	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19328-19352	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19352-19376	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19424-19448	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19802-19826	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19976-20000	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21121-21145	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21283-21307	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21301-21325	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21319-21343	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21355-21379	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15760-15784	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15904-15928	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15922-15946	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9679-9703	4	0.84
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9985-10009	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154483-154507	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154537-154561	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154591-154615	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154753-154777	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154807-154831	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155023-155047	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155149-155173	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155257-155281	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155383-155407	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155503-155527	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156043-156067	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156283-156307	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156391-156415	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156619-156643	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156655-156679	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156733-156757	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156883-156907	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157081-157105	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157441-157465	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1270-1294	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2026-2050	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2650-2674	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3112-3136	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3148-3172	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3202-3226	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3466-3490	4	0.84
NZ_CP018362_6	6.8\|5246894\|25\|NZ_CP018362\|CRT	5246894-5246918	25	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2887826-2887850	4	0.84
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1168-1192	4	0.84
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1504-1528	4	0.84
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2116-2140	4	0.84
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2200-2224	4	0.84
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2854-2878	4	0.84
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151275-151299	4	0.84
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151366-151390	4	0.84
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153169-153193	4	0.84
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154003-154027	4	0.84
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154057-154081	4	0.84
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155203-155227	4	0.84
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155773-155797	4	0.84
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155917-155941	4	0.84
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156145-156169	4	0.84
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157405-157429	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1396-1420	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2026-2050	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2080-2104	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2116-2140	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151894-151918	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153043-153067	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153871-153895	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154003-154027	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154375-154399	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154483-154507	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154591-154615	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155023-155047	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155257-155281	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155503-155527	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156283-156307	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156463-156487	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156553-156577	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156655-156679	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156733-156757	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156883-156907	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157063-157087	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157081-157105	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157369-157393	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157387-157411	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1162-1186	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21085-21109	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15472-15496	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15580-15604	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15706-15730	4	0.84
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9643-9667	4	0.84
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151840-151864	4	0.84
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151894-151918	4	0.84
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151930-151954	4	0.84
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153613-153637	4	0.84
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153823-153847	4	0.84
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154465-154489	4	0.84
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156097-156121	4	0.84
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156337-156361	4	0.84
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156355-156379	4	0.84
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156571-156595	4	0.84
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21085-21109	4	0.84
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15472-15496	4	0.84
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15580-15604	4	0.84
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15706-15730	4	0.84
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1630-1654	4	0.84
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2650-2674	4	0.84
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2686-2710	4	0.84
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3058-3082	4	0.84
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3202-3226	4	0.84
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3562-3586	4	0.84
NZ_CP018362_6	6.16\|5247392\|25\|NZ_CP018362\|CRT	5247392-5247416	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9643-9667	4	0.84
NZ_CP018362_6	6.2\|5246498\|31\|NZ_CP018362\|CRT	5246498-5246528	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153919-153949	5	0.839
NZ_CP018362_6	6.3\|5246558\|43\|NZ_CP018362\|CRT	5246558-5246600	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151275-151317	5	0.884
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2506-2542	5	0.865
NZ_CP018362_6	6.5\|5246696\|43\|NZ_CP018362\|CRT	5246696-5246738	43	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2764-2806	5	0.884
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3586-3610	5	0.8
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1168-1192	5	0.8
NZ_CP018362_6	6.7\|5246840\|25\|NZ_CP018362\|CRT	5246840-5246864	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3340-3364	5	0.8
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3586-3610	5	0.8
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3340-3364	5	0.8
NZ_CP018362_6	6.9\|5246948\|25\|NZ_CP018362\|CRT	5246948-5246972	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3508-3532	5	0.8
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153235-153259	5	0.8
NZ_CP018362_6	6.14\|5247266\|25\|NZ_CP018362\|CRT	5247266-5247290	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153715-153739	5	0.8
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154831-154867	6	0.838
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155797-155833	6	0.838
NZ_CP018362_6	6.13\|5247194\|43\|NZ_CP018362\|CRT	5247194-5247236	43	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3076-3118	6	0.86
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152044-152080	7	0.811
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16808-16844	7	0.811
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17438-17474	7	0.811
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17642-17678	7	0.811
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18752-18788	7	0.811
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19802-19838	7	0.811
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18404-18440	7	0.811
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19124-19160	7	0.811
NZ_CP018362_6	6.6\|5246768\|43\|NZ_CP018362\|CRT	5246768-5246810	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154825-154867	7	0.837
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18602-18638	8	0.784
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16148-16184	8	0.784
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16280-16316	8	0.784
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16412-16448	8	0.784
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16724-16760	8	0.784
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16766-16802	8	0.784
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17090-17126	8	0.784
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17270-17306	8	0.784
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17558-17594	8	0.784
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17600-17636	8	0.784
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17720-17756	8	0.784
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17762-17798	8	0.784
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18020-18056	8	0.784
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18218-18254	8	0.784
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18482-18518	8	0.784
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18530-18566	8	0.784
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18848-18884	8	0.784
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18962-18998	8	0.784
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19202-19238	8	0.784
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19244-19280	8	0.784
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19502-19538	8	0.784
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19700-19736	8	0.784
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19850-19886	8	0.784
NZ_CP018362_6	6.6\|5246768\|43\|NZ_CP018362\|CRT	5246768-5246810	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155791-155833	8	0.814
NZ_CP018362_6	6.13\|5247194\|43\|NZ_CP018362\|CRT	5247194-5247236	43	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154555-154597	8	0.814
NZ_CP018362_6	6.4\|5246630\|37\|NZ_CP018362\|CRT	5246630-5246666	37	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19742-19778	9	0.757

1. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 0, identity: 1.0

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactctgactccgacagc	Protospacer
*************************

2. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactctgactccgacagc	Protospacer
*************************

3. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactctgactccgacagc	Protospacer
*************************

4. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactctgactccgacagc	Protospacer
*************************

5. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactctgactccgacagc	Protospacer
*************************

6. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattccgactctgacagc	Protospacer
*************************

7. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
ggacagtgactcggattcggacagtgattcg	Protospacer
*********.*********************

8. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.973

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactcggattcggacagcgattcggactct	Protospacer
******************.******************

9. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.973

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactcggattctgacagcgattcggactct	Protospacer
****************** ******************

10. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.973

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactcggattctgacagcgattcggactct	Protospacer
****************** ******************

11. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactctgactccgacagc	Protospacer
************************.

12. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactctgactccgacagc	Protospacer
************************.

13. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactctgactccgacagc	Protospacer
************************.

14. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactctgactccgacagc	Protospacer
************************.

15. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactctgactccgacagc	Protospacer
************************.

16. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggactccgacagt	Protospacer
************ ************

17. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactccgactccgacagt	Protospacer
************.************

18. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggactccgacagt	Protospacer
************ ************

19. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactccgactccgacagt	Protospacer
************.************

20. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactctgactcggacagt	Protospacer
****************** ******

21. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggactccgacagt	Protospacer
************ ************

22. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggactccgacagt	Protospacer
************ ************

23. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

ggatagcgattcggactccgacagc	CRISPR spacer
ggacagcgattcggactccgacagc	Protospacer
***.*********************

24. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

ggatagcgattcggactccgacagc	CRISPR spacer
ggacagcgattcggactccgacagc	Protospacer
***.*********************

25. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

ggatagcgattcggactccgacagc	CRISPR spacer
ggacagcgattcggactccgacagc	Protospacer
***.*********************

26. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

ggatagcgattcggactccgacagc	CRISPR spacer
ggacagcgattcggactccgacagc	Protospacer
***.*********************

27. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 1, identity: 0.96

ggatagcgattcggactccgacagc	CRISPR spacer
ggacagcgattcggactccgacagc	Protospacer
***.*********************

28. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactccgactccgacagc	Protospacer
************.************

29. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactctgactctgacagc	Protospacer
******************.******

30. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactctgactcggacagc	Protospacer
****************** ******

31. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactctgactccgacagc	Protospacer
 ************************

32. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactccgactccgacagc	Protospacer
************.************

33. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactctgactcggacagc	Protospacer
****************** ******

34. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactctgactctgacagc	Protospacer
******************.******

35. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcagactccgacagc	Protospacer
************ ************

36. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactccgacagc	Protospacer
************ ************

37. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactccgactccgacagc	Protospacer
************.************

38. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactccgacagc	Protospacer
************ ************

39. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactccgacagc	Protospacer
************ ************

40. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactccgacagc	Protospacer
************ ************

41. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
ggacagtgattccgactctgacagc	Protospacer
 ************************

42. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
ggacagtgattccgactctgacagc	Protospacer
 ************************

43. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcggactctgacagc	Protospacer
************ ************

44. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcggactctgacagc	Protospacer
************ ************

45. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcggactctgacagc	Protospacer
************ ************

46. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattccgactctgacagc	Protospacer
.************************

47. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattccgactctgacagc	Protospacer
.************************

48. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattccgactctgacagc	Protospacer
.************************

49. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattccgactctgacagc	Protospacer
.************************

50. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattccgactctgacagc	Protospacer
.************************

51. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattccgactctgacagc	Protospacer
.************************

52. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattccgactctgacagc	Protospacer
.************************

53. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattccgactctgacagc	Protospacer
.************************

54. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattccgactctgacagc	Protospacer
.************************

55. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattccgactctgacagc	Protospacer
.************************

56. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattccgactctgacagc	Protospacer
.************************

57. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgactccgactctgacagc	Protospacer
*********.***************

58. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattccgattctgacagc	Protospacer
***************.*********

59. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagcgattccgactctgacagc	Protospacer
******.******************

60. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattccgattctgacagc	Protospacer
***************.*********

61. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgactccgactctgacagc	Protospacer
*********.***************

62. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagcgattccgactctgacagc	Protospacer
******.******************

63. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcggactctgacagc	Protospacer
************ ************

64. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattccgactctgacagc	Protospacer
.************************

65. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcggactctgacagc	Protospacer
************ ************

66. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcagactctgacagc	Protospacer
************ ************

67. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcagactctgacagc	Protospacer
************ ************

68. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcagactctgacagc	Protospacer
************ ************

69. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.96

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcagactctgacagc	Protospacer
************ ************

70. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgattccgattcagacagc	Protospacer
************ ************

71. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgattccgattcagacagc	Protospacer
************ ************

72. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP022118 (Salmonella enterica subsp. enterica serovar Macclesfield str. S-1643 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.938

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctcta	Protospacer
***********************.*****.**

73. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP030176 (Salmonella enterica subsp. enterica serovar Milwaukee str. SA19950795 plasmid pIncFII.1, complete sequence) position: , mismatch: 2, identity: 0.938

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctcta	Protospacer
***********************.*****.**

74. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
ggacagtgattcggattcggacagtgactcc	Protospacer
***************************.**

75. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
ggacagcgattcggattcggacagcgattcg	Protospacer
******.*****************.******

76. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
ggacagtgactcggattcggacagtgactcg	Protospacer
*********.*****************.***

77. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
cgacagtgattcggattccgacagtgattcg	Protospacer
 ***************** ************

78. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
cgacagtgactcggattcggacagtgattcg	Protospacer
 ********.*********************

79. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
ggacagcgattcggattccgacagtgattcg	Protospacer
******.*********** ************

80. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
ggacagtgattcggactcggacagcgattcg	Protospacer
***************.********.******

81. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
ggacagcgattcggattccgacagtgattcg	Protospacer
******.*********** ************

82. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.953

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
tgacagcgattcggactctgacagtgactctgactctgacagt	Protospacer
 ***********************.******************

83. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactcggattcggacagcgattcggactcc	Protospacer
******************.*****************.

84. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactcggattcggacagcgattcggactcg	Protospacer
******************.*****************

85. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
ggacagcgactcggattcggacagcgattcggactct	Protospacer
 *****************.******************

86. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgactcggattctgacagcgattcggactct	Protospacer
.***************** ******************

87. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgactcggattctgacagcgattcggactct	Protospacer
.***************** ******************

88. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgactcggattctgacagcgattcggactct	Protospacer
.***************** ******************

89. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagtgactcggattctgacagcgattcggactct	Protospacer
******.*********** ******************

90. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgattcggattcggacagcgattcggactct	Protospacer
*********.********.******************

91. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.946

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactcggattccgacagcgattccgactct	Protospacer
****************** *********** ******

92. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.946

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactcggattctgacagcgattcggattct	Protospacer
****************** **************.***

93. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactccgactccgacagc	Protospacer
************.***********.

94. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactctgactctgacagc	Protospacer
******************.*****.

95. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactctgactcggacagc	Protospacer
****************** *****.

96. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactctgactccgacagc	Protospacer
 ***********************.

97. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactccgactccgacagc	Protospacer
************.***********.

98. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactctgactcggacagc	Protospacer
****************** *****.

99. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactctgactctgacagc	Protospacer
******************.*****.

100. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcagactccgacagc	Protospacer
************ ***********.

101. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactccgattccgacagt	Protospacer
************.**.*********

102. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgattctgactctgacagt	Protospacer
*********.********.******

103. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgattcggactccgacagt	Protospacer
*********.** ************

104. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgattcggactccgacagt	Protospacer
*********.** ************

105. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggactccgacagc	Protospacer
************ ***********.

106. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactccgactccgacagc	Protospacer
************.***********.

107. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggactccgacagt	Protospacer
.*********** ************

108. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactcggactccgacagt	Protospacer
 *********** ************

109. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggactccgacagt	Protospacer
.*********** ************

110. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggactccgacagt	Protospacer
.*********** ************

111. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggactccgacagt	Protospacer
.*********** ************

112. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggactccgacagc	Protospacer
************ ***********.

113. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggactccgacagt	Protospacer
.*********** ************

114. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggactccgacagc	Protospacer
************ ***********.

115. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggactccgacagc	Protospacer
************ ***********.

116. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggactctgacagt	Protospacer
************ *****.******

117. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggactctgacagt	Protospacer
************ *****.******

118. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagtgactctgactcggacagt	Protospacer
******.*********** ******

119. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgattcggactccgacagt	Protospacer
*********.** ************

120. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagtgactcggactccgacagt	Protospacer
******.***** ************

121. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggattccgacagt	Protospacer
************ **.*********

122. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgattcggactccgacagt	Protospacer
*********.** ************

123. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggactctgacagt	Protospacer
************ *****.******

124. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgattccgactccgacagt	Protospacer
*********.**.************

125. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggactctgacagt	Protospacer
************ *****.******

126. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgattcggactccgacagt	Protospacer
*********.** ************

127. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagtgactcggactccgacagt	Protospacer
******.***** ************

128. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgattccgactccgacagt	Protospacer
*********.**.************

129. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgattccgactccgacagt	Protospacer
*********.**.************

130. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagtgactctgactctgacagt	Protospacer
******.***********.******

131. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgattcggactccgacagt	Protospacer
*********.** ************

132. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactccgattccgacagt	Protospacer
************.**.*********

133. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggactctgacagt	Protospacer
************ *****.******

134. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactccgattccgacagt	Protospacer
************.**.*********

135. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgattcggactccgacagc	Protospacer
 **.*********************

136. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgattcggactccgacagc	Protospacer
 **.*********************

137. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgattcggactccgacagc	Protospacer
 **.*********************

138. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgattcggactccgacagc	Protospacer
 **.*********************

139. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagc	Protospacer
 **.*********************

140. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgattcggactccgacagc	Protospacer
 **.*********************

141. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagc	Protospacer
 **.*********************

142. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

ggatagcgattcggactccgacagc	CRISPR spacer
ggatagcgattcggattctgacagc	Protospacer
***************.**.******

143. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

ggatagcgattcggactccgacagc	CRISPR spacer
ggacagcgattcggactcggacagc	Protospacer
***.************** ******

144. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

ggatagcgattcggactccgacagc	CRISPR spacer
ggacagcgattccgactccgacagc	Protospacer
***.******** ************

145. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

ggatagcgattcggactccgacagc	CRISPR spacer
ggacagcgattcggactctgacagc	Protospacer
***.**************.******

146. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

ggatagcgattcggactccgacagc	CRISPR spacer
ggacagcgattcggactctgacagc	Protospacer
***.**************.******

147. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

ggatagcgattcggactccgacagc	CRISPR spacer
ggacagcgattccgactccgacagc	Protospacer
***.******** ************

148. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

ggatagcgattcggactccgacagc	CRISPR spacer
ggacagcgattcggactctgacagc	Protospacer
***.**************.******

149. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

ggatagcgattcggactccgacagc	CRISPR spacer
ggacagcgattcggactctgacagc	Protospacer
***.**************.******

150. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

ggatagcgattcggactccgacagc	CRISPR spacer
ggacagcgattcggactctgacagc	Protospacer
***.**************.******

151. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagc	Protospacer
 **.*********************

152. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

ggatagcgattcggactccgacagc	CRISPR spacer
ggacagcgattcggactccgacagt	Protospacer
***.********************.

153. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagc	Protospacer
 **.*********************

154. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagc	Protospacer
 **.*********************

155. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagc	Protospacer
 **.*********************

156. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactccgactccgacagc	Protospacer
 ***********.************

157. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactccgacagt	Protospacer
************ ***********.

158. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactctgactcggacagc	Protospacer
.***************** ******

159. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactctgactctgacagc	Protospacer
 *****************.******

160. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactctgactcggacagc	Protospacer
.***************** ******

161. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactctgactcggacagc	Protospacer
 ***************** ******

162. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactctgactcggacagc	Protospacer
 ***************** ******

163. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactccgactccgacagt	Protospacer
************.***********.

164. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactctgactcggacagc	Protospacer
 ***************** ******

165. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcagactccgacagc	Protospacer
.*********** ************

166. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactctgactcggacagc	Protospacer
.***************** ******

167. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggactccgacagc	Protospacer
.*********** ************

168. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactctgactctgacagc	Protospacer
.*****************.******

169. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactccgacagt	Protospacer
************ ***********.

170. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactccgactccgacagt	Protospacer
************.***********.

171. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactctgactcggacagt	Protospacer
****************** *****.

172. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactctgactcggacagc	Protospacer
.***************** ******

173. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgattccgactccgacagc	Protospacer
*********.**.************

174. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactctgacagc	Protospacer
************ *****.******

175. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagc	Protospacer
*********.** ************

176. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagc	Protospacer
*********.** ************

177. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactccgattccgacagc	Protospacer
************.**.*********

178. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgattccgactccgacagc	Protospacer
*********.**.************

179. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactccgactcggacagc	Protospacer
************.***** ******

180. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgattccgactccgacagc	Protospacer
*********.**.************

181. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagc	Protospacer
*********.** ************

182. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagtgactccgactccgacagc	Protospacer
******.*****.************

183. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagtgactcggactccgacagc	Protospacer
******.***** ************

184. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggattccgacagc	Protospacer
************ **.*********

185. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagc	Protospacer
*********.** ************

186. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactccgactcggacagc	Protospacer
************.***** ******

187. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggactccgacagc	Protospacer
.*********** ************

188. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggactccgacagc	Protospacer
.*********** ************

189. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggactccgacagc	Protospacer
.*********** ************

190. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactccgacagt	Protospacer
************ ***********.

191. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactccgacagt	Protospacer
************ ***********.

192. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactctgacagc	Protospacer
************ *****.******

193. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactccgatagc	Protospacer
************ ********.***

194. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactctgacagc	Protospacer
************ *****.******

195. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgattccgactccgacagc	Protospacer
*********.**.************

196. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgattccgactccgacagc	Protospacer
*********.**.************

197. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagtgactctgactctgacagc	Protospacer
******.***********.******

198. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggattccgacagc	Protospacer
************ **.*********

199. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggattccgacagc	Protospacer
************ **.*********

200. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggattccgacagc	Protospacer
************ **.*********

201. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggattccgacagc	Protospacer
************ **.*********

202. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactctgacagc	Protospacer
************ *****.******

203. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagc	Protospacer
*********.** ************

204. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagc	Protospacer
*********.** ************

205. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagtgactctgactctgacagc	Protospacer
******.***********.******

206. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactctgacagc	Protospacer
************ *****.******

207. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactctgacagc	Protospacer
************ *****.******

208. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactctgacagc	Protospacer
************ *****.******

209. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactctgactcagacagc	Protospacer
 ***************** ******

210. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactctgactcagacagc	Protospacer
 ***************** ******

211. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactctgactcagacagc	Protospacer
 ***************** ******

212. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactctgattctgacagc	Protospacer
***************.**.******

213. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactctgattcagacagc	Protospacer
***************.** ******

214. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactctgattcagacagc	Protospacer
***************.** ******

215. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactctgattctgacagc	Protospacer
***************.**.******

216. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactctgattcagacagc	Protospacer
***************.** ******

217. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactctgattcagacagc	Protospacer
***************.** ******

218. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactctgattctgacagc	Protospacer
***************.**.******

219. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactctgattcagacagc	Protospacer
***************.** ******

220. spacer 6.13|5247194|43|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.953

cgacagtgattcggattcggacagcgattcggactcggatagc	CRISPR spacer
cgacagtgattcggattctgacagcgattcggactcggacagc	Protospacer
****************** ********************.***

221. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattcagactctgacagc	Protospacer
.*********** ************

222. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattcggactctgacagc	Protospacer
.*********** ************

223. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagcgattccgactctgacagt	Protospacer
******.*****************.

224. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattccgactccgacagc	Protospacer
.*****************.******

225. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgactcggactctgacagc	Protospacer
*********.** ************

226. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcggactcggacagc	Protospacer
************ ***** ******

227. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcggattctgacagc	Protospacer
************ **.*********

228. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagcgattctgactctgacagc	Protospacer
******.*****.************

229. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcggattctgacagc	Protospacer
************ **.*********

230. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgactccgactccgacagc	Protospacer
*********.********.******

231. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgactctgactctgacagc	Protospacer
*********.**.************

232. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcggattctgacagc	Protospacer
************ **.*********

233. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattccgactctgacagc	Protospacer
.*****.******************

234. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcggactctgacagt	Protospacer
************ ***********.

235. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgactccgactctgacagc	Protospacer
.********.***************

236. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattccgactccgacagt	Protospacer
******************.*****.

237. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
ggacagcgattccgactctgacagc	Protospacer
 *****.******************

238. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattccgactctgacagc	Protospacer
.*****.******************

239. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagcgattccgactccgacagc	Protospacer
******.***********.******

240. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagcgattccgactccgacagc	Protospacer
******.***********.******

241. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagcgattcggactctgacagc	Protospacer
******.***** ************

242. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattccgattcggacagc	Protospacer
***************.** ******

243. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgactccgattctgacagc	Protospacer
*********.*****.*********

244. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattccgattcggacagc	Protospacer
***************.** ******

245. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattccgattcggacagc	Protospacer
***************.** ******

246. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattccgattcggacagc	Protospacer
***************.** ******

247. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattccgattcggacagc	Protospacer
***************.** ******

248. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgactccgactccgacagc	Protospacer
*********.********.******

249. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattccgattccgacagc	Protospacer
***************.**.******

250. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagcgattccgattctgacagc	Protospacer
******.********.*********

251. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattccgattcagacagc	Protospacer
***************.** ******

252. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagcgattccgactccgacagc	Protospacer
******.***********.******

253. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgactctgactctgacagc	Protospacer
*********.**.************

254. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagcgattcggactctgacagc	Protospacer
******.***** ************

255. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcggactcggacagc	Protospacer
************ ***** ******

256. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcggactcggacagc	Protospacer
************ ***** ******

257. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagcgattccgattctgacagc	Protospacer
******.********.*********

258. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
************ ***** ******

259. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
************ ***** ******

260. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
************ ***** ******

261. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
************ ***** ******

262. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
************ ***** ******

263. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
************ ***** ******

264. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
************ ***** ******

265. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
************ ***** ******

266. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
************ ***** ******

267. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
************ ***** ******

268. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
************ ***** ******

269. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
************ ***** ******

270. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
************ ***** ******

271. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
************ ***** ******

272. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
************ ***** ******

273. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgattcggattctgacagt	Protospacer
****************** *****.

274. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattccgattcagacagc	Protospacer
.*********** ************

275. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgattccgattccgacagc	Protospacer
************ ***** ******

276. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgattccgattccgacagc	Protospacer
************ ***** ******

277. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagcgattcggattctgacagc	Protospacer
******.*********** ******

278. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagcgattcggattctgacagc	Protospacer
******.*********** ******

279. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagcgattcggattctgacagc	Protospacer
******.*********** ******

280. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgactcggattcggacagc	Protospacer
*********.********.******

281. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgattcggactccgacagc	Protospacer
***************.** ******

282. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgactcggattccgacagc	Protospacer
*********.******** ******

283. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagcgattcggattctgacagc	Protospacer
******.*********** ******

284. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagcgattcggattcggacagc	Protospacer
******.***********.******

285. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagcgattcggattcggacagc	Protospacer
******.***********.******

286. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgactcggattccgacagc	Protospacer
*********.******** ******

287. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgattccgattcggacagc	Protospacer
************ *****.******

288. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgattccgattccgacagc	Protospacer
************ ***** ******

289. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgattccgattccgacagc	Protospacer
************ ***** ******

290. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagcgattcggattctgacagc	Protospacer
******.*********** ******

291. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
agacagtgattcagattcagacagc	Protospacer
 ***********.************

292. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcagattcagacagc	Protospacer
.***********.************

293. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcagattcagacagc	Protospacer
.***********.************

294. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
agacagtgattcagattcagacagc	Protospacer
 ***********.************

295. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcggattcggacagc	Protospacer
.*****************.******

296. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcggattcggacagc	Protospacer
.*****************.******

297. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcggattctgacagc	Protospacer
.***************** ******

298. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcggattctgacagc	Protospacer
.***************** ******

299. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcggattcggacagc	Protospacer
.*****************.******

300. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcggattcggacagc	Protospacer
.*****************.******

301. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcggattctgacagc	Protospacer
.***************** ******

302. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgattcggactctgacagc	Protospacer
***************.** ******

303. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgactcggattctgacagc	Protospacer
*********.******** ******

304. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgactcggattctgacagc	Protospacer
*********.******** ******

305. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgactcggattctgacagc	Protospacer
*********.******** ******

306. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgactcggattccgacagc	Protospacer
*********.******** ******

307. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgattcggactcggacagc	Protospacer
***************.**.******

308. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgattccgattccgacagc	Protospacer
************ ***** ******

309. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgactcggattctgacagc	Protospacer
*********.******** ******

310. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagcgattcggattctgacagc	Protospacer
******.*********** ******

311. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
agacagtgattcagattcagacagc	Protospacer
 ***********.************

312. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
agacagtgattcagattcagacagc	Protospacer
 ***********.************

313. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.92

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagcgattcggattctgacagc	Protospacer
******.*********** ******

314. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP026283 (Klebsiella oxytoca strain KONIH2 plasmid pKOR-e6bf, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

315. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP014073 (Klebsiella quasipneumoniae strain FDAARGOS_93 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

316. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP032197 (Klebsiella pneumoniae strain AR_0097 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

317. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_KP345882 (Escherichia coli strain BK32533 plasmid pBK32533, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

318. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP043048 (Klebsiella pneumoniae strain KLP268 plasmid pKLP268-2, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

319. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP019900 (Raoultella planticola strain GODA plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

320. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP029448 (Serratia marcescens strain CAV1761 plasmid pCAV1761-205, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

321. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_KJ721789 (Klebsiella pneumoniae strain NJ HT1872 plasmid pUSKPC3, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

322. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP025039 (Klebsiella pneumoniae strain NU-CRE047 plasmid pNU-CRE047_2, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

323. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP031811 (Klebsiella pneumoniae strain INF014-sc-2279884 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

324. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP020851 (Klebsiella variicola strain KPN1481 plasmid pKPN1481-2, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

325. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to MN310379 (Klebsiella quasipneumoniae strain A2508 plasmid pA2508-NR, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

326. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to MN310380 (Raoultella ornithinolytica strain 170602815 plasmid p602815-NR, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

327. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP023840 (Klebsiella pneumoniae strain 4/1-2 plasmid p4_1_2.1, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

328. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP018815 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0002 plasmid tig00000003, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

329. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP042483 (Klebsiella pneumoniae strain C51 plasmid pC51_002, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

330. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP027616 (Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed4, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

331. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP010881 (Escherichia coli strain MNCRE44 plasmid pMNCRE44_5, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

332. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP009275 (Klebsiella variicola strain DX120E plasmid pKV1, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

333. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NC_025131 (Klebsiella pneumoniae strain BK30683 plasmid pBK30683, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

334. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP029583 (Klebsiella pneumoniae strain DA33140 plasmid pDA33140-112, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

335. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP010363 (Enterobacter hormaechei subsp. oharae strain 34978 plasmid p34978-139.941kb, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

336. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP029598 (Klebsiella quasipneumoniae subsp. similipneumoniae strain ATCC 700603 plasmid pDA33145-152, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

337. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to CP008701 (Klebsiella variicola strain Kp5-1 plasmid pKp5-1, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

338. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP009773 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH33 plasmid pKPC-63d, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

339. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP009776 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH32 plasmid pKPC-def, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

340. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP006926 (Klebsiella pneumoniae 30660/NJST258_1 plasmid pNJST258N2, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

341. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP022825 (Klebsiella quasivariicola strain KPN1705 plasmid pKPN1705-2, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

342. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP015387 (Klebsiella pneumoniae strain NY9 plasmid pNY9_2, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

343. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP038276 (Raoultella ornithinolytica strain WLK218 plasmid pWLK-107717, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

344. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NC_021199 (Klebsiella pneumoniae subsp. pneumoniae KPX plasmid pKPX-2 DNA, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

345. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP011641 (Serratia marcescens strain CAV1492 plasmid pCAV1492-199, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

346. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP011633 (Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-150, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

347. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP011633 (Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-150, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

348. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP014697 (Klebsiella quasipneumoniae strain ATCC 700603 isolate K6 plasmid pKQPS1, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

349. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP018361 (Klebsiella oxytoca strain CAV1752 plasmid pCAV1752-278, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

350. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP013986 (Klebsiella variicola strain LMG 23571 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

351. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP035211 (Klebsiella pneumoniae strain TH164 plasmid pTH164-2, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

352. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP024543 (Klebsiella pneumoniae strain INF042 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

353. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP045691 (Klebsiella pneumoniae strain TK421 plasmid pTK421_1, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

354. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP026016 (Klebsiella variicola strain 13450 plasmid p13450-2, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

355. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP021900 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0136 plasmid tig00001437_pilon, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

356. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP021778 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0053 plasmid unitig_3, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

357. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP044049 (Klebsiella variicola strain FDAARGOS_627 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

358. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_LR130540 (Klebsiella variicola strain AJ055 isolate AJ055 plasmid 2) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

359. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP032357 (Klebsiella variicola strain 15WZ-82 plasmid p15WZ-82_res, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

360. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP032357 (Klebsiella variicola strain 15WZ-82 plasmid p15WZ-82_res, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

361. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP032357 (Klebsiella variicola strain 15WZ-82 plasmid p15WZ-82_res, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

362. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_MG462728 (Escherichia coli strain AMA1416 plasmid pAMA1416, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

363. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP033755 (Klebsiella pneumoniae strain FDAARGOS_566 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

364. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to NZ_CP054255 (Klebsiella variicola strain FH-1 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.906

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagccaatgcgacaggttgtggctatg	Protospacer
***********************.***** *.

365. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
ggacagtgattcggactccgacagtgattcc	Protospacer
***************.** ***********

366. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
tgacagtgactcggattcggacagcgattcg	Protospacer
 ********.**************.******

367. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
cgacagtgactccgattcggacagtgattcg	Protospacer
 ********.** ******************

368. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
cgacagcgattcggattcggacagcgattcg	Protospacer
 *****.*****************.******

369. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
cgacagcgattcggattcggacagcgattcg	Protospacer
 *****.*****************.******

370. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
cgacagcgattcggattcggacagcgattcg	Protospacer
 *****.*****************.******

371. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
cgacagcgattcggattcggacagcgattcg	Protospacer
 *****.*****************.******

372. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
ggacagtgattcggactcggacagcgattcc	Protospacer
***************.********.*****

373. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
tgacagtgattcggattctgacagtgactcg	Protospacer
 ***************** ********.***

374. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
cgacagcgattcggattctgacagtgattcg	Protospacer
 *****.*********** ************

375. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
cgacagtgattcggattcggacagcgattcc	Protospacer
 ***********************.*****

376. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
tgacagcgattcggattctgacagtgattcg	Protospacer
 *****.*********** ************

377. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
cgacagtgattcggattctgacagcgattcg	Protospacer
 ***************** *****.******

378. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
tgacagtgattcggactcggacagcgattcg	Protospacer
 **************.********.******

379. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
cgacagtgattcggattctgacagcgattcg	Protospacer
 ***************** *****.******

380. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.93

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
cgacagcgattcggactctgacagcgactcggactctgacagc	Protospacer
 ***************************** ***********.

381. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.93

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
ggacagcgattcggactctgacagcgactcggactctgacagc	Protospacer
.***************************** ***********.

382. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.93

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
ggacagcgattcggactccgacagcgactcggactctgacagt	Protospacer
.*****************.*********** ************

383. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.93

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
cgacagcgactcggactctgacagcgactcggactctgacagt	Protospacer
 ********.******************** ************

384. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.93

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
tgacagcgactcggactctgacagcgactcggactctgacagt	Protospacer
 ********.******************** ************

385. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.93

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
agacagcgactcggactctgacagcgactcggactctgacagc	Protospacer
*********.******************** ***********.

386. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.93

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
tgacagcgattcggattctgacagcgactcggactctgacagt	Protospacer
 **************.************** ************

387. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.93

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
tgacagcgattcggactccgacagcgactctgactctgacagc	Protospacer
 *****************.***********************.

388. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.93

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
tgacagcgattcggactctgacagcgactccgactccgacagt	Protospacer
 *****************************.*****.******

389. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
ggacagcgactcggattcggacagcgattcggactcc	Protospacer
 *****************.*****************.

390. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
ggacagcgactcggattccgacagcgattcggactcc	Protospacer
 ***************** *****************.

391. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgactcggattctgacagcgattcggactcg	Protospacer
.***************** *****************

392. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactcggattccgacagcgattccgactcc	Protospacer
****************** *********** *****.

393. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactcggattccgacagcgattccgactcc	Protospacer
****************** *********** *****.

394. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactcggattcggacagcgattccgactcc	Protospacer
******************.*********** *****.

395. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgactcggattcggacagcgattcggattct	Protospacer
.*****************.**************.***

396. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
ggacagcgactcggattccgacagcgattcggattct	Protospacer
 ***************** **************.***

397. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagtgactcggattcggacagcgattcggactct	Protospacer
.*****.***********.******************

398. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgactcggattcggacagcgactcggactct	Protospacer
.*****************.********.*********

399. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgactcggattctgacagcgactcggactct	Protospacer
.***************** ********.*********

400. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgattcggattctgacagcgattcggactct	Protospacer
.********.******** ******************

401. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
ggacagcgattcggattcggacagcgattcggactct	Protospacer
 ********.********.******************

402. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactcggattccgacagcgattcggattcg	Protospacer
****************** **************.**

403. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactcggattccgacagcgattcggattcg	Protospacer
****************** **************.**

404. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgattcggattcggacagcgattcggactcc	Protospacer
*********.********.*****************.

405. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactcggattccgacagcgattcggattcg	Protospacer
****************** **************.**

406. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgactcggattccgacagcgactcggactct	Protospacer
.***************** ********.*********

407. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgattcggattcggacagcgattcggactcc	Protospacer
*********.********.*****************.

408. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactcggattccgacagcgattcggattcg	Protospacer
****************** **************.**

409. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
ggacagcgactcggattcggacagcgattccgactct	Protospacer
 *****************.*********** ******

410. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
ggacagcgactcggattccgacagcgattccgactct	Protospacer
 ***************** *********** ******

411. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
agacagcgactcggactcagacagcgactcggactct	Protospacer
 **************.***********.*********

412. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactcggattctgacagcgactcggactcc	Protospacer
****************** ********.********.

413. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactcggattccgacagcgattccgactcc	Protospacer
****************** *********** *****.

414. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
ggacagcgactccgattccgacagcgattcggactct	Protospacer
 *********** ***** ******************

415. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgactcggatgctgacagcgattcggactct	Protospacer
.*************** * ******************

416. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactcggattctgacagtgattcggactcg	Protospacer
****************** *****.***********

417. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgattcggattctgacagcgattcggactcc	Protospacer
*********.******** *****************.

418. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgactcggattccgacagcgactcggactct	Protospacer
.***************** ********.*********

419. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.919

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgactcggattctgacagcgattcggattct	Protospacer
.***************** **************.***

420. spacer 6.5|5246696|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.93

tgacagtgactccgattccgacagcgattctgattctgacagt	CRISPR spacer
tgacagtgactcggattccgacagcgattccgattctgacagc	Protospacer
************ *****************.***********.

421. spacer 6.5|5246696|43|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.93

tgacagtgactccgattccgacagcgattctgattctgacagt	CRISPR spacer
tgacagcgactccgattccgacagcgattctgactctgacagc	Protospacer
******.**************************.********.

422. spacer 6.6|5246768|43|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.93

tgacagcgactcggattctgacagtgactcggattctgatagt	CRISPR spacer
tgacagcgattcggattctgacagtgactcggattctgacagc	Protospacer
*********.*****************************.**.

423. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactccgactccgacagc	Protospacer
 ***********.***********.

424. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactctgactcggacagc	Protospacer
.***************** *****.

425. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactctgactctgacagc	Protospacer
 *****************.*****.

426. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactctgactcggacagc	Protospacer
.***************** *****.

427. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactctgactcggacagc	Protospacer
 ***************** *****.

428. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactctgactcggacagc	Protospacer
 ***************** *****.

429. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactctgactcggacagc	Protospacer
 ***************** *****.

430. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcagactccgacagc	Protospacer
.*********** ***********.

431. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactctgactcggacagc	Protospacer
.***************** *****.

432. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggactccgacagc	Protospacer
.*********** ***********.

433. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactctgactctgacagc	Protospacer
.*****************.*****.

434. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactctgactcggacagc	Protospacer
.***************** *****.

435. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgattccgactccgacagc	Protospacer
*********.**.***********.

436. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggactctgacagc	Protospacer
************ *****.*****.

437. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgattcggactccgacagc	Protospacer
*********.** ***********.

438. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgattcggactccgacagt	Protospacer
 ********.** ************

439. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgattcggactccgacagc	Protospacer
*********.** ***********.

440. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactccgattccgacagc	Protospacer
************.**.********.

441. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgattccgactccgacagc	Protospacer
*********.**.***********.

442. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactccgactcggacagc	Protospacer
************.***** *****.

443. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactccgactctgacagt	Protospacer
 ***********.*****.******

444. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggactctgacagt	Protospacer
.*********** *****.******

445. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgattccgactccgacagc	Protospacer
*********.**.***********.

446. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgattcggactccgacagc	Protospacer
*********.** ***********.

447. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagtgactccgactccgacagc	Protospacer
******.*****.***********.

448. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagtgactcggactccgacagc	Protospacer
******.***** ***********.

449. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggactctgacagt	Protospacer
.*********** *****.******

450. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggattccgacagc	Protospacer
************ **.********.

451. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgattcggactccgacagc	Protospacer
*********.** ***********.

452. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactccgactcggacagc	Protospacer
************.***** *****.

453. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggactccgacagc	Protospacer
.*********** ***********.

454. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggactccgacagc	Protospacer
.*********** ***********.

455. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggactccgacagc	Protospacer
.*********** ***********.

456. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactctgactctgactct	Protospacer
******************.***  *

457. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggactctgacagt	Protospacer
.*********** *****.******

458. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggactctgacagc	Protospacer
************ *****.*****.

459. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggactccgatagc	Protospacer
************ ********.**.

460. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgattcggactccgacagt	Protospacer
.********.** ************

461. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggactctgacagc	Protospacer
************ *****.*****.

462. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgattccgactccgacagt	Protospacer
 ********.**.************

463. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggattccgacagt	Protospacer
.*********** **.*********

464. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgattccgactccgacagc	Protospacer
*********.**.***********.

465. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgattccgactccgacagc	Protospacer
*********.**.***********.

466. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagtgactctgactctgacagc	Protospacer
******.***********.*****.

467. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggattccgacagc	Protospacer
************ **.********.

468. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggattccgacagc	Protospacer
************ **.********.

469. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggactctgacagt	Protospacer
.*********** *****.******

470. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggattccgacagc	Protospacer
************ **.********.

471. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggattccgacagc	Protospacer
************ **.********.

472. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgattctgacgccgacagt	Protospacer
.********.****** ********

473. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactcggattccgacagt	Protospacer
 *********** **.*********

474. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggactctgacagc	Protospacer
************ *****.*****.

475. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggactctgacagt	Protospacer
.*********** *****.******

476. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgattcggactccgacagc	Protospacer
*********.** ***********.

477. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgattcggactccgacagc	Protospacer
*********.** ***********.

478. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagtgactctgactctgacagc	Protospacer
******.***********.*****.

479. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggactctgacagc	Protospacer
************ *****.*****.

480. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggactctgacagc	Protospacer
************ *****.*****.

481. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactcggactctgacagt	Protospacer
 *********** *****.******

482. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactcggactctgacagc	Protospacer
************ *****.*****.

483. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactctgactcagacagc	Protospacer
 ***************** *****.

484. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactctgactcagacagc	Protospacer
 ***************** *****.

485. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactctgactcagacagc	Protospacer
 ***************** *****.

486. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactctgattctgacagc	Protospacer
***************.**.*****.

487. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactctgattcagacagc	Protospacer
***************.** *****.

488. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactctgattcagacagc	Protospacer
***************.** *****.

489. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactctgattctgacagc	Protospacer
***************.**.*****.

490. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactctgattcagacagc	Protospacer
***************.** *****.

491. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactctgattcagacagc	Protospacer
***************.** *****.

492. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactctgattctgacagc	Protospacer
***************.**.*****.

493. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagt	CRISPR spacer
tgacagcgactctgattcagacagc	Protospacer
***************.** *****.

494. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagt	Protospacer
 **.********************.

495. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgattcggactccgacagt	Protospacer
 **.********************.

496. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagt	Protospacer
 **.********************.

497. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagt	Protospacer
 **.********************.

498. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagt	Protospacer
 **.********************.

499. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgactcggactccgacagc	Protospacer
 **.*****.***************

500. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
ggatagcgattcggattctgacagt	Protospacer
***************.**.*****.

501. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgattccgactccgacagc	Protospacer
 **.******** ************

502. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgattccgactccgacagc	Protospacer
 **.******** ************

503. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgattcggactctgacagc	Protospacer
 **.**************.******

504. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
ggacagtgattcggactccgacagt	Protospacer
***.**.*****************.

505. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
 **.**************.******

506. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgactcggactccgacagc	Protospacer
 **.*****.***************

507. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgactcggactccgacagc	Protospacer
 **.*****.***************

508. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgattcggattccgacagc	Protospacer
 **.***********.*********

509. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgactcggactccgacagc	Protospacer
 **.*****.***************

510. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
ggacagcgattcggactctgacagt	Protospacer
***.**************.*****.

511. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagtgattcggactccgacagc	Protospacer
 **.**.******************

512. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
 **.**************.******

513. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
ggacagcgattccgactccgacagt	Protospacer
***.******** ***********.

514. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattccgactccgacagc	Protospacer
 **.******** ************

515. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattccgactccgacagc	Protospacer
 **.******** ************

516. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
 **.**************.******

517. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
 **.**************.******

518. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
 **.**************.******

519. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
 **.**************.******

520. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
ggacagcgactcggactccgacagt	Protospacer
***.*****.**************.

521. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactcggacagc	Protospacer
 **.************** ******

522. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
 **.**************.******

523. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
 **.**************.******

524. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgactcggactccgacagc	Protospacer
 **.*****.***************

525. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgactcggactccgacagc	Protospacer
 **.*****.***************

526. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgactcggactccgacagc	Protospacer
 **.*****.***************

527. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgattccgactccgacagc	Protospacer
 **.******** ************

528. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
 **.**************.******

529. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
 **.**************.******

530. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgattcggactctgacagc	Protospacer
 **.**************.******

531. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgattcggactcggacagc	Protospacer
 **.************** ******

532. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
 **.**************.******

533. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
 **.**************.******

534. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagt	Protospacer
 **.********************.

535. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagt	Protospacer
 **.********************.

536. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattccgactccgacagc	Protospacer
 **.******** ************

537. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
ggacagcgattcggactctgacagt	Protospacer
***.**************.*****.

538. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
 **.**************.******

539. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
ggacagcgattcggattccgacagt	Protospacer
***.***********.********.

540. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattccgactccgacagc	Protospacer
 **.******** ************

541. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattccgactccgacagc	Protospacer
 **.******** ************

542. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgactcggactccgacagc	Protospacer
 **.*****.***************

543. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactcggacagc	Protospacer
 **.************** ******

544. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
ggacagcgattcggattccgacagt	Protospacer
***.***********.********.

545. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
agatagcgattcggactcagacagt	Protospacer
.***************** *****.

546. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
agatagcgattcagactcagacagc	Protospacer
.***********.***** ******

547. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
agatagcgattcggactcagacagt	Protospacer
.***************** *****.

548. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
agatagcgattcagactcagacagc	Protospacer
.***********.***** ******

549. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
agatagcgattcggactcagacagt	Protospacer
.***************** *****.

550. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
agatagcgattcggactcagacagt	Protospacer
.***************** *****.

551. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
agatagcgattcagactcagacagc	Protospacer
.***********.***** ******

552. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
agatagcgattcagactcagacagc	Protospacer
.***********.***** ******

553. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
cgatagcgattcagactctgacagc	Protospacer
 ***********.*****.******

554. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
cgatagcgattcagactctgacagc	Protospacer
 ***********.*****.******

555. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
cgatagcgattcagactctgacagc	Protospacer
 ***********.*****.******

556. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
cgatagcgattcagactctgacagc	Protospacer
 ***********.*****.******

557. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

ggatagcgattcggactccgacagc	CRISPR spacer
cgatagcgattcagactctgacagc	Protospacer
 ***********.*****.******

558. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgattcggactccgacagc	Protospacer
 ********.** ************

559. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggactctgacagc	Protospacer
.*********** *****.******

560. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactccgattccgacagt	Protospacer
************.**.********.

561. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgattctgactctgacagc	Protospacer
.********.********.******

562. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactcggactctgacagc	Protospacer
 *********** *****.******

563. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgattctgactctgacagt	Protospacer
*********.********.*****.

564. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagtgactccgactccgacagc	Protospacer
.*****.*****.************

565. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggactctgacagc	Protospacer
.*********** *****.******

566. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagt	Protospacer
*********.** ***********.

567. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagtgactctgactctgacagc	Protospacer
.*****.***********.******

568. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagt	Protospacer
*********.** ***********.

569. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgattctgactctgacagc	Protospacer
 ********.********.******

570. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactccgactcggacagc	Protospacer
 ***********.***** ******

571. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggactccgacagt	Protospacer
.*********** ***********.

572. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactcggactccgacagt	Protospacer
 *********** ***********.

573. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggactccgacagt	Protospacer
.*********** ***********.

574. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggactccgacagt	Protospacer
.*********** ***********.

575. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggactccgacagt	Protospacer
.*********** ***********.

576. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggactccgacagt	Protospacer
.*********** ***********.

577. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgattcggactccgacagc	Protospacer
 ********.** ************

578. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgattcggactccgacagc	Protospacer
 ********.** ************

579. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgattccgactccgacagc	Protospacer
.********.**.************

580. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggattccgacagc	Protospacer
.*********** **.*********

581. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgattccgactccgacagc	Protospacer
.********.**.************

582. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggattccgacagc	Protospacer
.*********** **.*********

583. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgattccgactccgacagc	Protospacer
 ********.**.************

584. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactctgacagt	Protospacer
************ *****.*****.

585. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggactctgacagc	Protospacer
.*********** *****.******

586. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactctgacagt	Protospacer
************ *****.*****.

587. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactcggattccgacagc	Protospacer
 *********** **.*********

588. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagtgactctgactcggacagt	Protospacer
******.*********** *****.

589. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactcggattccgacagc	Protospacer
 *********** **.*********

590. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactcggactctgacagc	Protospacer
 *********** *****.******

591. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagt	Protospacer
*********.** ***********.

592. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactcggattccgacagc	Protospacer
 *********** **.*********

593. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactcggactctgacagc	Protospacer
 *********** *****.******

594. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgattcggactccgacagc	Protospacer
.********.** ************

595. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgattcggactccgacagc	Protospacer
.********.** ************

596. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgattcggactccgacagc	Protospacer
.********.** ************

597. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagtgactcggactccgacagc	Protospacer
.*****.***** ************

598. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagtgactcggactccgacagt	Protospacer
******.***** ***********.

599. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggattccgacagt	Protospacer
************ **.********.

600. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgattccgactccgacagc	Protospacer
 ********.**.************

601. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagt	Protospacer
*********.** ***********.

602. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggactctgacagc	Protospacer
.*********** *****.******

603. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactctgacagt	Protospacer
************ *****.*****.

604. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgattccgactccgacagt	Protospacer
*********.**.***********.

605. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggattccgacagc	Protospacer
.*********** **.*********

606. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggattccgacagc	Protospacer
.*********** **.*********

607. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactcggattccgacagc	Protospacer
 *********** **.*********

608. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggattccgacagc	Protospacer
.*********** **.*********

609. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactcggattccgacagc	Protospacer
 *********** **.*********

610. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgattcggactccgacagc	Protospacer
 ********.** ************

611. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggattccgacagc	Protospacer
.*********** **.*********

612. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactcggattccgacagc	Protospacer
 *********** **.*********

613. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgattcggactccgacagc	Protospacer
 ********.** ************

614. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggattccgacagc	Protospacer
.*********** **.*********

615. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactcggattccgacagc	Protospacer
 *********** **.*********

616. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactctgacagt	Protospacer
************ *****.*****.

617. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggactctgacagc	Protospacer
.*********** *****.******

618. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagtgactccgactccgacagc	Protospacer
.*****.*****.************

619. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagt	Protospacer
*********.** ***********.

620. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactcggattccgacagc	Protospacer
 *********** **.*********

621. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactcggactctgacagc	Protospacer
 *********** *****.******

622. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactcggactcagacagc	Protospacer
 *********** ***** ******

623. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagtgactcggactccgacagc	Protospacer
.*****.***** ************

624. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagtgactcggactccgacagt	Protospacer
******.***** ***********.

625. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgattccgactccgacagt	Protospacer
*********.**.***********.

626. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggattccgacagc	Protospacer
.*********** **.*********

627. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgattcggactccgacagc	Protospacer
.********.** ************

628. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgattccgactccgacagt	Protospacer
*********.**.***********.

629. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgattccgactccgacagc	Protospacer
.********.**.************

630. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggattccgacagc	Protospacer
.*********** **.*********

631. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgattcggactccgacagc	Protospacer
.********.** ************

632. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagtgactctgactctgacagt	Protospacer
******.***********.*****.

633. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagtgactctgactctgacagc	Protospacer
.*****.***********.******

634. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgattcggactccgacagt	Protospacer
*********.** ***********.

635. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactccgattccgacagc	Protospacer
 ***********.**.*********

636. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactccgattccgacagt	Protospacer
************.**.********.

637. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggactctgacagc	Protospacer
.*********** *****.******

638. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactcggactctgacagt	Protospacer
************ *****.*****.

639. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactccgattccgacagt	Protospacer
************.**.********.

640. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** ******

641. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** ******

642. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** ******

643. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** ******

644. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** ******

645. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** ******

646. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** ******

647. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** ******

648. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** ******

649. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** ******

650. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** ******

651. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactctgattcagacagc	Protospacer
.**************.** ******

652. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactctgattctgacagc	Protospacer
 **************.**.******

653. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** ******

654. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** ******

655. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** ******

656. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** ******

657. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** ******

658. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** ******

659. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** ******

660. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** ******

661. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** ******

662. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** ******

663. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactctgattcagacagc	Protospacer
.**************.** ******

664. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactctgattctgacagc	Protospacer
 **************.**.******

665. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** ******

666. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** ******

667. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** ******

668. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** ******

669. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** ******

670. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** ******

671. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** ******

672. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** ******

673. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactctgattcagacagc	Protospacer
.**************.** ******

674. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** ******

675. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** ******

676. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** ******

677. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** ******

678. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** ******

679. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** ******

680. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** ******

681. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** ******

682. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** ******

683. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

tgacagcgactctgactccgacagc	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** ******

684. spacer 6.11|5247050|43|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.93

cgacagcgattctgattctgacagtgactccgattctgacagc	CRISPR spacer
tgacagcgattcggattctgacagtgactcggattctgacagc	Protospacer
.*********** ***************** ************

685. spacer 6.11|5247050|43|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.93

cgacagcgattctgattctgacagtgactccgattctgacagc	CRISPR spacer
tgacagcgattctgactctgacagtgactcggattctgacagc	Protospacer
.**************.************** ************

686. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattccgactccgacagc	Protospacer
.*****.***********.******

687. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
.*****.***** ************

688. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattccgactccgacagc	Protospacer
.*****.***********.******

689. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattccgactccgacagc	Protospacer
.*****.***********.******

690. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattcggactcggacagc	Protospacer
.*********** ***** ******

691. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattccgattccgacagc	Protospacer
.**************.**.******

692. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgactccgactccgacagc	Protospacer
.********.********.******

693. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
ggacagtgattcggactcggacagc	Protospacer
 *********** ***** ******

694. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
ggacagcgattctgactctgacagc	Protospacer
 *****.*****.************

695. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
ggacagcgattccgactctgacagt	Protospacer
 *****.*****************.

696. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
ggacagcgattccgactctgacagt	Protospacer
 *****.*****************.

697. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattccgactccgacagt	Protospacer
.*****************.*****.

698. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
ggacagcgattccgactccgacagc	Protospacer
 *****.***********.******

699. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattccgattccgacagc	Protospacer
.**************.**.******

700. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattccgattccgacagc	Protospacer
.**************.**.******

701. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
ggacagcgattcggactctgacagc	Protospacer
 *****.***** ************

702. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
.*****.***** ************

703. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
ggacagtgattccgattccgacagc	Protospacer
 **************.**.******

704. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
ggacagcgattcggactctgacagc	Protospacer
 *****.***** ************

705. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattccgattcagacagc	Protospacer
.**************.** ******

706. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattcggactccgacagc	Protospacer
.*********** *****.******

707. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
.*****.***** ************

708. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattccgactccgacagc	Protospacer
.*****.***********.******

709. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattccgactccgacagc	Protospacer
.*****.***********.******

710. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
ggacagcgattccgactccgacagc	Protospacer
 *****.***********.******

711. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
.*****.***** ************

712. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
.*****.***** ************

713. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
.*****.***** ************

714. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
.*****.***** ************

715. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgactctgactctgacagc	Protospacer
.********.**.************

716. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagcgattcggactctgacagt	Protospacer
******.***** ***********.

717. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
ggacagcgattcggactctgacagc	Protospacer
 *****.***** ************

718. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
cgacagcgattcggactctgacagt	Protospacer
******.***** ***********.

719. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
ggacagcgattcggactctgacagc	Protospacer
 *****.***** ************

720. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
.*****.***** ************

721. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
.*****.***** ************

722. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
ggacagcgattccgactcagacagc	Protospacer
 *****.*********** ******

723. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattccgattcagacagc	Protospacer
.**************.** ******

724. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
ggacagtgattcggactcggacagc	Protospacer
 *********** ***** ******

725. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattccgattctgacagc	Protospacer
.*****.********.*********

726. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattccgattctgacagc	Protospacer
.*****.********.*********

727. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
.*****.***** ************

728. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgactctgactctgacagc	Protospacer
.********.**.************

729. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
.*****.***** ************

730. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattccgattcggacagc	Protospacer
.**************.** ******

731. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattccgattccgacagc	Protospacer
.**************.**.******

732. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
ggacagcgattcggactctgacagc	Protospacer
 *****.***** ************

733. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattccgattccgacagc	Protospacer
.**************.**.******

734. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
.*****.***** ************

735. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattcggactctgacagt	Protospacer
.*********** ***********.

736. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.88

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattcggactctgacagc	Protospacer
.*****.***** ************

737. spacer 6.15|5247320|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.93

tgacagcgattccgactccgatagtgattccgattctgacagc	CRISPR spacer
ggacagcgattccgactccgacagtgactccgattctgacagc	Protospacer
 ********************.*****.***************

738. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
ggacagtgattcggattcggacagt	Protospacer
 *****************.*****.

739. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
ggacagcgattcggattcggacagc	Protospacer
 *****.***********.******

740. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattccgattcggacagc	Protospacer
.*********** *****.******

741. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagcgattcggattctgacagc	Protospacer
.*****.*********** ******

742. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgactcggattctgacagc	Protospacer
.********.******** ******

743. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagcgattcggattcggacagc	Protospacer
.*****.***********.******

744. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
ggacagtgattccgattccgacagc	Protospacer
 *********** ***** ******

745. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagcgattcggattccgacagc	Protospacer
.*****.*********** ******

746. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
ggacagcgattcggattcggacagc	Protospacer
 *****.***********.******

747. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagcgattcggattcggacagc	Protospacer
.*****.***********.******

748. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattccgattcggacagc	Protospacer
.*********** *****.******

749. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagcgattcggattcggacagc	Protospacer
.*****.***********.******

750. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattccgattcggacagc	Protospacer
.*********** *****.******

751. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagcgattcggattcggacagc	Protospacer
.*****.***********.******

752. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattccgattcggacagc	Protospacer
.*********** *****.******

753. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagcgattcggattcggacagc	Protospacer
.*****.***********.******

754. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattccgattcggacagc	Protospacer
.*********** *****.******

755. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattccgattctgacagc	Protospacer
.*********** ***** ******

756. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgattcggactccgacagt	Protospacer
***************.** *****.

757. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattccgattctgacagc	Protospacer
.*********** ***** ******

758. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgattcggactccgacagt	Protospacer
***************.** *****.

759. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
ggacagtgattcggactcggacagc	Protospacer
 **************.**.******

760. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattccgattccgacagc	Protospacer
.*********** ***** ******

761. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgattcggactccgacagt	Protospacer
***************.** *****.

762. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcggactcggacagc	Protospacer
.**************.**.******

763. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcggactcggacagc	Protospacer
.**************.**.******

764. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcggactctgacagc	Protospacer
.**************.** ******

765. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
agatagtgattccgattcagacagc	Protospacer
 **.******** ************

766. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
.***********.**.*********

767. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
.***********.**.*********

768. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
.***********.**.*********

769. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
.***********.**.*********

770. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
.***********.**.*********

771. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
.***********.**.*********

772. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
.***********.**.*********

773. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
.***********.**.*********

774. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
.***********.**.*********

775. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
.***********.**.*********

776. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
.***********.**.*********

777. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
.***********.**.*********

778. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
.***********.**.*********

779. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
.***********.**.*********

780. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcagactcagacagc	Protospacer
.***********.**.*********

781. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
agatagtgattcagattcagacagc	Protospacer
 **.********.************

782. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
agatagtgattccgattcagacagc	Protospacer
 **.******** ************

783. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
agatagtgattccgattcagacagc	Protospacer
 **.******** ************

784. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcggattccgacagt	Protospacer
.***************** *****.

785. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagcgattcggattctgacagc	Protospacer
.*****.*********** ******

786. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagcgattcggattctgacagt	Protospacer
******.*********** *****.

787. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
ggacagcgattcggattctgacagc	Protospacer
 *****.*********** ******

788. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgactcggattccgacagc	Protospacer
.********.******** ******

789. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcggactcggacagc	Protospacer
.**************.**.******

790. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcggactctgacagc	Protospacer
.**************.** ******

791. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagcgattcggattctgacagc	Protospacer
.*****.*********** ******

792. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagcgattcggattctgacagt	Protospacer
******.*********** *****.

793. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcggactctgacagc	Protospacer
.**************.** ******

794. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
ggacagcgattcggattctgacagc	Protospacer
 *****.*********** ******

795. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagcgattcggattctgacagt	Protospacer
******.*********** *****.

796. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagcgattcggattctgacagc	Protospacer
.*****.*********** ******

797. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcggatgctgacagc	Protospacer
.*************** * ******

798. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
ggacagtgattcggactcggacagc	Protospacer
 **************.**.******

799. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagcgattcggattccgacagt	Protospacer
******.*********** *****.

800. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcggactctgacagc	Protospacer
.**************.** ******

801. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagcgattcggattccgacagt	Protospacer
******.*********** *****.

802. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
agatagtgattccgattcagacagc	Protospacer
 **.******** ************

803. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcggactctgacagc	Protospacer
.**************.** ******

804. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.88

tgacagtgattcggattcagacagc	CRISPR spacer
tgacagtgattcggactctgacagt	Protospacer
***************.** *****.

805. spacer 5.3|5140913|32|NZ_CP018362|CRISPRCasFinder,CRT matches to MN310379 (Klebsiella quasipneumoniae strain A2508 plasmid pA2508-NR, complete sequence) position: , mismatch: 4, identity: 0.875

ctggacagccaatgcgacaggttatggcttta	CRISPR spacer
ctggacagctaatgcgacaggttgtggctatg	Protospacer
*********.*************.***** *.

806. spacer 6.1|5246426|43|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.907

agacagtgactccgactcggacagcgatgctgactctgacagt	CRISPR spacer
ggacagcgactccgactcggacagcgattctgactctgacagc	Protospacer
.*****.********************* *************.

807. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
cgacagcgattcggattcggacagtgactcc	Protospacer
 *****.********************.**

808. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
tgacagcgactcggattcggacagtgattcc	Protospacer
 *****.**.********************

809. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
cgacagcgattcggattcggacagtgactcc	Protospacer
 *****.********************.**

810. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
tgacagtgattcggactccgacagtgattcc	Protospacer
 **************.** ***********

811. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
tgacagtgattcggactccgacagtgattcc	Protospacer
 **************.** ***********

812. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
tgacagtgattccgattcggacagcgattcc	Protospacer
 *********** ***********.*****

813. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
cgacagtgattcggattcggacagcgactcc	Protospacer
 ***********************.**.**

814. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
cgacagtgattcggattcggacagcgactct	Protospacer
 ***********************.**.**

815. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
cgacagcgattcggattctgacagtgattcc	Protospacer
 *****.*********** ***********

816. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
tgacagcgattcggattccgacagtgattcc	Protospacer
 *****.*********** ***********

817. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
cgacagtgattcggattcggacagcgactcc	Protospacer
 ***********************.**.**

818. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.871

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
tgacagtgattcggactctgacagtgattcc	Protospacer
 **************.** ***********

819. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.907

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
tgacagcgattcggattctgacagcgactcggactctgacagc	Protospacer
 **************.************** ***********.

820. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.907

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
tgacagcgattcggactctgacagcgactccgattctgacagc	Protospacer
 *****************************.**.********.

821. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.907

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
ggacagcgattcggactctgacagcgactcggattctgacagc	Protospacer
.***************************** **.********.

822. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.907

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
tgacagcgattcggactctgacagcgattcggactctgacagc	Protospacer
 **************************.** ***********.

823. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.907

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
tgacagcgattcggactctgacagcgattccgactctgacagc	Protospacer
 **************************.**.***********.

824. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.907

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
cgacagtgattcggactctgacagtgactctgactctgacagc	Protospacer
 *****.*****************.*****************.

825. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.907

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
ggacagcgattcggactctgacagcgactcggattctgacagc	Protospacer
.***************************** **.********.

826. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.907

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
ggacagcgattcggactctgacagcgactcggattctgacagc	Protospacer
.***************************** **.********.

827. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.907

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
tgacagcgattcggactctgacagcgactcggattctgacagc	Protospacer
 ***************************** **.********.

828. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.907

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
tgacagcgattcggactctgacagcgactcggattctgacagc	Protospacer
 ***************************** **.********.

829. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.907

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
tgacagcgattcggactccgacagtgactctgactctgacagc	Protospacer
 *****************.*****.*****************.

830. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.907

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
tgacagcgactcggactctgacagcgactcggactctgacagc	Protospacer
 ********.******************** ***********.

831. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.907

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
cgacagcgactcggactctgacagcgactcggactctgacagc	Protospacer
 ********.******************** ***********.

832. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.907

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
tgacagcgattcggactccgacagcgactcggactctgacagc	Protospacer
 *****************.*********** ***********.

833. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.907

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
cgacagcgattctgactctgacagcgactctgactccgacagc	Protospacer
 *********** ***********************.*****.

834. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.907

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
tgacagcgattcggatgctgacagcgactctgactctgacagc	Protospacer
 **************. *************************.

835. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.907

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
cgacagcgactcggattctgacagcgactctgactctgacagc	Protospacer
 ********.*****.**************************.

836. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.907

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
tgacagcgattcggattctgacagcgactctgactcggacagc	Protospacer
 **************.******************** *****.

837. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.892

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
ggacagcgactcggattcggacagcgattcggattcg	Protospacer
 *****************.**************.**

838. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.892

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
ggacagcgactcggattccgacagcgattcggattcg	Protospacer
 ***************** **************.**

839. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.892

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgactccgattctgacagcgattcggactcc	Protospacer
.*********** ***** *****************.

840. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.892

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
ggacagcgactcggattcggacagcgattccgactcc	Protospacer
 *****************.*********** *****.

841. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.892

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgactcggattcggacagcgattccgactcc	Protospacer
.*****************.*********** *****.

842. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.892

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgactcggattccgacagcgactcggactcc	Protospacer
.***************** ********.********.

843. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.892

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgactcggattcggacagcgactcggactcc	Protospacer
.*****************.********.********.

844. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.892

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgactcggattccgacagcgactcggactcc	Protospacer
.***************** ********.********.

845. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.892

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgactcggattccgacagcgactcggactcc	Protospacer
.***************** ********.********.

846. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.892

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
ggacagcgactcggattctgacagtgattcggactcc	Protospacer
 ***************** *****.***********.

847. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 4, identity: 0.892

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
agacagcgactccgattcagatagcgattcggactca	Protospacer
 *********** ********.**************

848. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgattcggactccgacagc	Protospacer
 ********.** ***********.

849. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggactctgacagc	Protospacer
.*********** *****.*****.

850. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgattctgactctgacagc	Protospacer
.********.********.*****.

851. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactcggactctgacagc	Protospacer
 *********** *****.*****.

852. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagtgactccgactccgacagc	Protospacer
.*****.*****.***********.

853. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggactctgacagc	Protospacer
.*********** *****.*****.

854. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagtgactctgactctgacagc	Protospacer
.*****.***********.*****.

855. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactccgactccgactct	Protospacer
 ***********.*********  *

856. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgattctgactctgacagc	Protospacer
 ********.********.*****.

857. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactccgactcggacagc	Protospacer
 ***********.***** *****.

858. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgattcggactccgacagc	Protospacer
 ********.** ***********.

859. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgattcggactccgacagc	Protospacer
 ********.** ***********.

860. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgattccgactccgacagc	Protospacer
.********.**.***********.

861. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggattccgacagc	Protospacer
.*********** **.********.

862. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgattccgactccgacagc	Protospacer
.********.**.***********.

863. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggattccgacagc	Protospacer
.*********** **.********.

864. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgattccgactccgacagc	Protospacer
 ********.**.***********.

865. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggactctgacagc	Protospacer
.*********** *****.*****.

866. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactcggattccgacagc	Protospacer
 *********** **.********.

867. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactcggattccgacagc	Protospacer
 *********** **.********.

868. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactcggactctgacagc	Protospacer
 *********** *****.*****.

869. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactcggattccgacagc	Protospacer
 *********** **.********.

870. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactcggactctgacagc	Protospacer
 *********** *****.*****.

871. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgattcggactccgacagc	Protospacer
.********.** ***********.

872. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgattcggactccgacagc	Protospacer
.********.** ***********.

873. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgattcggactccgacagc	Protospacer
.********.** ***********.

874. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagtgactcggactccgacagc	Protospacer
.*****.***** ***********.

875. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgattccgactccgacagc	Protospacer
 ********.**.***********.

876. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggactctgacagc	Protospacer
.*********** *****.*****.

877. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggattccgacagc	Protospacer
.*********** **.********.

878. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggattccgacagc	Protospacer
.*********** **.********.

879. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactcggattccgacagc	Protospacer
 *********** **.********.

880. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggattccgacagc	Protospacer
.*********** **.********.

881. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactcggattccgacagc	Protospacer
 *********** **.********.

882. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgattcggactccgacagc	Protospacer
 ********.** ***********.

883. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggattccgacagc	Protospacer
.*********** **.********.

884. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactcggattccgacagc	Protospacer
 *********** **.********.

885. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgattcggactccgacagc	Protospacer
 ********.** ***********.

886. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggattccgacagc	Protospacer
.*********** **.********.

887. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactcggattccgacagc	Protospacer
 *********** **.********.

888. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggactctgacagc	Protospacer
.*********** *****.*****.

889. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagtgactccgactccgacagc	Protospacer
.*****.*****.***********.

890. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactcggattccgacagc	Protospacer
 *********** **.********.

891. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactcggactctgacagc	Protospacer
 *********** *****.*****.

892. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactcggactcagacagc	Protospacer
 *********** ***** *****.

893. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagtgactcggactccgacagc	Protospacer
.*****.***** ***********.

894. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggattccgacagc	Protospacer
.*********** **.********.

895. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgattcggactccgacagc	Protospacer
.********.** ***********.

896. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgattccgactccgacagc	Protospacer
.********.**.***********.

897. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggattccgacagc	Protospacer
.*********** **.********.

898. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgattcggactccgacagc	Protospacer
.********.** ***********.

899. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagtgactctgactctgacagc	Protospacer
.*****.***********.*****.

900. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactccgattccgacagc	Protospacer
 ***********.**.********.

901. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactcggactctgacagc	Protospacer
.*********** *****.*****.

902. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** *****.

903. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** *****.

904. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** *****.

905. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** *****.

906. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** *****.

907. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** *****.

908. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** *****.

909. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** *****.

910. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** *****.

911. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** *****.

912. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** *****.

913. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactctgattcagacagc	Protospacer
.**************.** *****.

914. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactctgattctgacagc	Protospacer
 **************.**.*****.

915. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** *****.

916. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** *****.

917. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** *****.

918. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** *****.

919. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** *****.

920. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** *****.

921. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** *****.

922. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** *****.

923. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** *****.

924. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** *****.

925. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactctgattcagacagc	Protospacer
.**************.** *****.

926. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactctgattctgacagc	Protospacer
 **************.**.*****.

927. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** *****.

928. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** *****.

929. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** *****.

930. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** *****.

931. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** *****.

932. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** *****.

933. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgatagcgactctgactcagacagc	Protospacer
.**.************** *****.

934. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactctgattcagacagc	Protospacer
 **************.** *****.

935. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
cgacagcgactctgattcagacagc	Protospacer
.**************.** *****.

936. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** *****.

937. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** *****.

938. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** *****.

939. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** *****.

940. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** *****.

941. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** *****.

942. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** *****.

943. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** *****.

944. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** *****.

945. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagt	CRISPR spacer
agacagcgactcagactcagacagc	Protospacer
 *********** ***** *****.

946. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattccgactccgacagt	Protospacer
 **.******** ***********.

947. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgattcggactctgacagt	Protospacer
 **.**************.*****.

948. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactctgacagt	Protospacer
 **.**************.*****.

949. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgactcggactccgacagt	Protospacer
 **.*****.**************.

950. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgattcggactctgacagt	Protospacer
 **.**************.*****.

951. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactctgacagt	Protospacer
 **.**************.*****.

952. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgactcggactccgacagt	Protospacer
 **.*****.**************.

953. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactctgacagt	Protospacer
 **.**************.*****.

954. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgactcggactccgacagt	Protospacer
 **.*****.**************.

955. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagtgattcggactccgacagt	Protospacer
 **.**.*****************.

956. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgactcggactccgacagt	Protospacer
 **.*****.**************.

957. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagtgattcggactccgacagt	Protospacer
 **.**.*****************.

958. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgactcggactccgacagt	Protospacer
 **.*****.**************.

959. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgactcggactccgacagt	Protospacer
 **.*****.**************.

960. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagtgattcggactccgacagt	Protospacer
 **.**.*****************.

961. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattccgactccgacagt	Protospacer
 **.******** ***********.

962. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattccgactccgacagt	Protospacer
 **.******** ***********.

963. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactctgacagt	Protospacer
 **.**************.*****.

964. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgactcggactccgacagt	Protospacer
 **.*****.**************.

965. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgactcggactccgacagt	Protospacer
 **.*****.**************.

966. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggactctgacagt	Protospacer
 **.**************.*****.

967. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgattcggattccgacagt	Protospacer
 **.***********.********.

968. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgactcggactccgacagt	Protospacer
 **.*****.**************.

969. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggattccgacagt	Protospacer
 **.***********.********.

970. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
cgacagcgattcggattccgacagt	Protospacer
 **.***********.********.

971. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
tgacagcgattcggattccgacagt	Protospacer
 **.***********.********.

972. spacer 6.8|5246894|25|NZ_CP018362|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 4, identity: 0.84

ggatagcgattcggactccgacagc	CRISPR spacer
gggctccgattcggactccgacagc	Protospacer
**..  *******************

973. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactccgactccgactcc	Protospacer
 ***********.*********  *

974. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgattcggactccgacagt	Protospacer
 ********.** ***********.

975. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactccgactctgacagt	Protospacer
 ***********.*****.*****.

976. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggactctgacagt	Protospacer
.*********** *****.*****.

977. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggactctgacagt	Protospacer
.*********** *****.*****.

978. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagc	CRISPR spacer
tgacagcgactctgactctgactct	Protospacer
******************.***  .

979. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggactctgacagt	Protospacer
.*********** *****.*****.

980. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgattcggactccgacagt	Protospacer
.********.** ***********.

981. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgattccgactccgacagt	Protospacer
 ********.**.***********.

982. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggattccgacagt	Protospacer
.*********** **.********.

983. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggactctgacagt	Protospacer
.*********** *****.*****.

984. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgattctgacgccgacagt	Protospacer
.********.****** *******.

985. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactcggattccgacagt	Protospacer
 *********** **.********.

986. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagc	CRISPR spacer
cgacagcgactcggactctgacagt	Protospacer
.*********** *****.*****.

987. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactcggactctgacagt	Protospacer
 *********** *****.*****.

988. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
ggacagcgattcggactctgacagt	Protospacer
 *****.***** ***********.

989. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattcggactctgacagt	Protospacer
.*****.***** ***********.

990. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattctgactctgacagt	Protospacer
.*****.*****.***********.

991. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
ggacagcgactccgactctgacagt	Protospacer
 *****.**.**************.

992. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
ggacagtgattcggactccgacagt	Protospacer
 *********** *****.*****.

993. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
ggacagtgactccgattctgacagt	Protospacer
 ********.*****.********.

994. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
ggacagcgattcggactctgacagt	Protospacer
 *****.***** ***********.

995. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
ggacagcgattccgactccgacagt	Protospacer
 *****.***********.*****.

996. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattccgattctgacagt	Protospacer
.*****.********.********.

997. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattccgactccgacagt	Protospacer
.*****.***********.*****.

998. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattcggactctgacagt	Protospacer
.*****.***** ***********.

999. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattcggactctgacagt	Protospacer
.*****.***** ***********.

1000. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattcggactctgacagt	Protospacer
.*****.***** ***********.

1001. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattcggactccgacagt	Protospacer
.*********** *****.*****.

1002. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattcggactccgacagt	Protospacer
.*********** *****.*****.

1003. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattccgattctgacagt	Protospacer
.*****.********.********.

1004. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattcggattctgacagt	Protospacer
.*********** **.********.

1005. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgattcggactccgacagt	Protospacer
.*********** *****.*****.

1006. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattccgactccgacagt	Protospacer
.*****.***********.*****.

1007. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattccgactccgacagt	Protospacer
.*****.***********.*****.

1008. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgactctgactctgacagt	Protospacer
.********.**.***********.

1009. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattcggactctgacagt	Protospacer
.*****.***** ***********.

1010. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgactcggactctgacagt	Protospacer
.********.** ***********.

1011. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgactcggactctgacagt	Protospacer
.********.** ***********.

1012. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagtgactccgattctgacagt	Protospacer
.********.*****.********.

1013. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
agacagtgattcagactcagacagt	Protospacer
 *********** ***** *****.

1014. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
agacagtgattcagactcagacagt	Protospacer
 *********** ***** *****.

1015. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
agacagtgattcagactcagacagt	Protospacer
 *********** ***** *****.

1016. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
agacagtgattcagactcagacagt	Protospacer
 *********** ***** *****.

1017. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 4, identity: 0.84

cgacagtgattccgactctgacagc	CRISPR spacer
agacagtgattcagactcagacagt	Protospacer
 *********** ***** *****.

1018. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagcgattcggattcggacagt	Protospacer
.*****.***********.*****.

1019. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagtgattcggattcagacagc	CRISPR spacer
ggacagtgattcggactccgacagt	Protospacer
 **************.** *****.

1020. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagtgattcggattcagacagc	CRISPR spacer
ggacagcgattcggattctgacagt	Protospacer
 *****.*********** *****.

1021. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagcgattcggattcggacagt	Protospacer
.*****.***********.*****.

1022. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagcgattcggattctgacagt	Protospacer
.*****.*********** *****.

1023. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgattcggactctgacagt	Protospacer
.**************.** *****.

1024. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagcgattcggattctgacagt	Protospacer
.*****.*********** *****.

1025. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagtgattcggattcagacagc	CRISPR spacer
ggacagtgactcggattcggacagt	Protospacer
 ********.********.*****.

1026. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagtgattcggattcagacagc	CRISPR spacer
ggacagtgactcggattcggacagt	Protospacer
 ********.********.*****.

1027. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagcgattcggattctgacagt	Protospacer
.*****.*********** *****.

1028. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagtgattcggattcagacagc	CRISPR spacer
agacagtgattcagactcagacagt	Protospacer
 ***********.**.********.

1029. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagtgattcggattcagacagc	CRISPR spacer
agacagtgattcagactcagacagt	Protospacer
 ***********.**.********.

1030. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagtgattcggattcagacagc	CRISPR spacer
agacagtgattcagactcagacagt	Protospacer
 ***********.**.********.

1031. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tgacagtgattcggattcagacagc	CRISPR spacer
agacagtgattcagactcagacagt	Protospacer
 ***********.**.********.

1032. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgacagtgattcggattcagacagc	CRISPR spacer
ggacagcgattcggattccgacagt	Protospacer
 *****.*********** *****.

1033. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagcgattcggattccgacagt	Protospacer
.*****.*********** *****.

1034. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagcgattcggattctgacagt	Protospacer
.*****.*********** *****.

1035. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagtgactcggattcggacagt	Protospacer
.********.********.*****.

1036. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgacagtgattcggattcagacagc	CRISPR spacer
cgacagcgattcggattccgacagt	Protospacer
.*****.*********** *****.

1037. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgacagtgattcggattcagacagc	CRISPR spacer
ggacagcgattcggattccgacagt	Protospacer
 *****.*********** *****.

1038. spacer 6.16|5247392|25|NZ_CP018362|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 4, identity: 0.84

tgacagtgattcggattcagacagc	CRISPR spacer
agacagtgattcagactcagacagt	Protospacer
 ***********.**.********.

1039. spacer 6.2|5246498|31|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

ggacagtgattcggattcggacagtgattcg	CRISPR spacer
tgactccgattcggattctgacagtgattcg	Protospacer
 ***  .*********** ************

1040. spacer 6.3|5246558|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.884

agacagcgattcggactctgacagcgactctgactctgacagt	CRISPR spacer
ggatagcgattcggattctgacagcgactctgactctgactct	Protospacer
.**.***********.************************  *

1041. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.865

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
ggacagcgactcggatgctgacagcgattcggatgct	Protospacer
 *************** * **************. **

1042. spacer 6.5|5246696|43|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.884

tgacagtgactccgattccgacagcgattctgattctgacagt	CRISPR spacer
tgacagtgactccgactccgacagcgattcggattctgactcc	Protospacer
***************.************** *********  .

1043. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.8

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactctgactccgattcg	Protospacer
 ********************.

1044. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.8

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactccgactccgactcc	Protospacer
 ***********.*********  .

1045. spacer 6.7|5246840|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.8

tgacagcgactctgactccgacagt	CRISPR spacer
ggacagcgactccgactccgactcg	Protospacer
 ***********.*********

1046. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.8

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactctgactccgattcg	Protospacer
 ********************.

1047. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.8

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactccgactccgactcg	Protospacer
 ***********.*********

1048. spacer 6.9|5246948|25|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.8

tgacagcgactctgactccgacagc	CRISPR spacer
ggacagcgactccgactccgactct	Protospacer
 ***********.*********  .

1049. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.8

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattccgactctgactcg	Protospacer
.*****.***************

1050. spacer 6.14|5247266|25|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.8

cgacagtgattccgactctgacagc	CRISPR spacer
tgacagcgattccgactctgactcg	Protospacer
.*****.***************

1051. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.838

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgactcggattctgacagcgattcggatagc	Protospacer
.***************** **************.  .

1052. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.838

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
ggacagcgactcggattctgacagcgattcggatagc	Protospacer
 ***************** **************.  .

1053. spacer 6.13|5247194|43|NZ_CP018362|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.86

cgacagtgattcggattcggacagcgattcggactcggatagc	CRISPR spacer
cgacagtgattcggattcggacagcgattccgacagcgacagt	Protospacer
****************************** ***   **.**.

1054. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.811

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
ggacagcgactcggactctgacagcgattcggatagc	Protospacer
 **************.** **************.  .

1055. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.811

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgactctgattcagacagcgatagcgattca	Protospacer
.*********** ***************   **.**

1056. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.811

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactctgattcagacagcgacagcgattca	Protospacer
************ **************.   **.**

1057. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.811

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgactctgattcagacagcgatagcgattca	Protospacer
.*********** ***************   **.**

1058. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.811

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactctgattcagacagcgacagcgattca	Protospacer
************ **************.   **.**

1059. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.811

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
agacagcgactctgattcagacagcgatagcgattca	Protospacer
 *********** ***************   **.**

1060. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.811

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgatagcgactctgattcagacagcgatagcgattca	Protospacer
***.******** ***************   **.**

1061. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.811

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgatagcgactctgattcagacagcgatagcgattca	Protospacer
***.******** ***************   **.**

1062. spacer 6.6|5246768|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.837

tgacagcgactcggattctgacagtgactcggattctgatagt	CRISPR spacer
tgacagcgactcggattctgacagcgattcggatagcgacagc	Protospacer
************************.**.******  .**.**.

1063. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
agacagcgactctgattcagacagcgacagcgattca	Protospacer
 *********** **************.   **.**

1064. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactctgattcagatagcgacagcgattca	Protospacer
************ ********.*****.   **.**

1065. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactctgattcagatagcgacagcgattca	Protospacer
************ ********.*****.   **.**

1066. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactctgattcagatagcgacagcgattca	Protospacer
************ ********.*****.   **.**

1067. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactctgattcagatagcgacagtgattca	Protospacer
************ ********.*****.   **.**

1068. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgactctgattctgacagcgatagcgattca	Protospacer
.*********** ***** *********   **.**

1069. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactctgattcagatagcgacagcgattca	Protospacer
************ ********.*****.   **.**

1070. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
agatagcgactctgattcagacagcgatagcgattca	Protospacer
 **.******** ***************   **.**

1071. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactctgattcagatagcgacagtgattca	Protospacer
************ ********.*****.   **.**

1072. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
agacagcgactctgattctgacagcgatagcgattca	Protospacer
 *********** ***** *********   **.**

1073. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactctgattcagatagcgacagtgattca	Protospacer
************ ********.*****.   **.**

1074. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgactctgattctgacagcgatagcgattca	Protospacer
.*********** ***** *********   **.**

1075. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactctgattcagatagcgacagcgattca	Protospacer
************ ********.*****.   **.**

1076. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactctgattcagatagcgacagtgattca	Protospacer
************ ********.*****.   **.**

1077. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactctgattcagatagcgacagtgattca	Protospacer
************ ********.*****.   **.**

1078. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactctgattcagatagcgacagcgattca	Protospacer
************ ********.*****.   **.**

1079. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
agacagcgactctgattctgacagcgatagcgattca	Protospacer
 *********** ***** *********   **.**

1080. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactctgattcagatagcgacagcgattca	Protospacer
************ ********.*****.   **.**

1081. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactctgattcagatagcgacagtgattca	Protospacer
************ ********.*****.   **.**

1082. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
tgacagcgactctgattctgacagcgatagcgattca	Protospacer
.*********** ***** *********   **.**

1083. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactctgattcagatagcgacagcgattca	Protospacer
************ ********.*****.   **.**

1084. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
cgacagcgactctgattcagatagcgacagtgattca	Protospacer
************ ********.*****.   **.**

1085. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
agatagcgactctgattcagacagcgatagcgattca	Protospacer
 **.******** ***************   **.**

1086. spacer 6.6|5246768|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.814

tgacagcgactcggattctgacagtgactcggattctgatagt	CRISPR spacer
ggacagcgactcggattctgacagcgattcggatagcgacagc	Protospacer
 ***********************.**.******  .**.**.

1087. spacer 6.13|5247194|43|NZ_CP018362|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.814

cgacagtgattcggattcggacagcgattcggactcggatagc	CRISPR spacer
tgacagtgactctgattcggacagcgattcggatagcgacagc	Protospacer
.********.** ********************.   **.***

1088. spacer 6.4|5246630|37|NZ_CP018362|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.757

cgacagcgactcggattcagacagcgattcggactct	CRISPR spacer
agacagcgactctgattcagatagcgacagcgattca	Protospacer
 *********** ********.*****.   **.**

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

144274 : 176971

Erwinia_phage(30.77%)

head,plate,terminase,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_148719562.1\|144274_145291_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	2.4e-185	99.1
WP_004143398.1\|146441_146837_-	helix-turn-helix domain containing protein	NA	NA	NA	NA
WP_077253535.1\|146885_148232_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_064353086.1\|148561_149095_-	DUF2514 family protein	NA	NA	NA	NA
WP_064351536.1\|149091_149592_-	lysozyme	H9C184	Pectobacterium_phage	2.3e-72	77.0
WP_153675911.1\|149611_149830_-	diacylglyceryl transferase	I6R0S9	Salmonella_phage	4.1e-10	55.9
WP_076752192.1\|149890_150229_-	hypothetical protein	NA	NA	NA	NA
WP_076752195.1\|150230_150842_-	hypothetical protein	NA	NA	NA	NA
WP_076752197.1\|150924_151662_-	hypothetical protein	NA	NA	NA	NA
WP_076752200.1\|151674_153567_-	tape measure protein	NA	NA	NA	NA
WP_049089090.1\|153694_154180_-	hypothetical protein	NA	NA	NA	NA
WP_016808972.1\|154179_154602_-	hypothetical protein	NA	NA	NA	NA
WP_076752202.1\|154604_155963_-	DUF3383 family protein	E5AGB4	Erwinia_phage	5.6e-36	28.1
WP_076752204.1\|155963_156749_-	hypothetical protein	NA	NA	NA	NA
WP_016808975.1\|156748_157003_-	hypothetical protein	NA	NA	NA	NA
WP_004113065.1\|157098_157590_-	hypothetical protein	E5AGB1	Erwinia_phage	2.8e-06	33.8
WP_004113063.1\|157710_158070_-	DUF4054 domain-containing protein	NA	NA	NA	NA
WP_004113060.1\|158079_158334_-	hypothetical protein	NA	NA	NA	NA
WP_004113058.1\|158337_159276_-	DUF2184 domain-containing protein	E5AGA8	Erwinia_phage	2.5e-27	30.4
WP_070585205.1\|159293_160085_-	Ig domain-containing protein	A0A1S5R5Y7	Pseudomonas_phage	2.5e-12	56.5
WP_076752206.1\|160084_161098_-	DUF2213 domain-containing protein	A0A291LCH5	Klebsiella_phage	2.6e-14	35.0
WP_076752208.1\|161069_162431_-\|head	phage head morphogenesis protein	E5AGA5	Erwinia_phage	5.8e-17	29.7
WP_032749059.1\|162417_163791_-	DUF1073 domain-containing protein	NA	NA	NA	NA
WP_032749061.1\|163787_165197_-\|terminase	PBSX family phage terminase large subunit	Q716H3	Shigella_phage	1.0e-56	32.7
WP_004113051.1\|165183_165729_-	hypothetical protein	NA	NA	NA	NA
WP_100290036.1\|166050_166206_-	Hok/Gef family protein	NA	NA	NA	NA
WP_004113049.1\|166547_166943_+	hypothetical protein	NA	NA	NA	NA
WP_076752210.1\|167218_168817_+	ERF family protein	NA	NA	NA	NA
WP_071995717.1\|168834_169350_+	recombinase	Q5QBN4	Enterobacteria_phage	1.7e-33	59.1
WP_142476742.1\|169462_171406_+	hypothetical protein	A0A0F7LA61	Klebsiella_phage	3.7e-57	41.0
WP_032749065.1\|171408_171693_+	hypothetical protein	NA	NA	NA	NA
WP_032749067.1\|172069_172702_-	hypothetical protein	NA	NA	NA	NA
WP_032749069.1\|172701_172938_-	hypothetical protein	NA	NA	NA	NA
WP_004113037.1\|172934_173168_-	hypothetical protein	NA	NA	NA	NA
WP_032749070.1\|173160_173916_-	hypothetical protein	NA	NA	NA	NA
WP_076752214.1\|173915_175325_-\|plate	baseplate J/gp47 family protein	A0A2I7QTL1	Vibrio_phage	1.9e-07	21.4
WP_032749073.1\|175311_175659_-	hypothetical protein	NA	NA	NA	NA
WP_032749074.1\|175873_176251_-	hypothetical protein	NA	NA	NA	NA
WP_032749075.1\|176260_176971_-\|plate	phage baseplate protein	NA	NA	NA	NA

DBSCAN-SWA_2

430626 : 493327

Vibrio_phage(61.11%)

plate,tail,head,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_076752093.1\|430626_431787_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.2e-39	36.4
WP_014229170.1\|432027_433008_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_038424443.1\|433086_434097_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_038424441.1\|434388_435360_-	hypothetical protein	NA	NA	NA	NA
WP_014229167.1\|435981_436749_-	arylamine N-acetyltransferase	NA	NA	NA	NA
WP_038424439.1\|436787_438284_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_014838337.1\|438543_439092_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_163428417.1\|439799_441028_-\|transposase	IS3 family transposase	Q9ZXG3	Shigella_phage	3.3e-160	90.0
WP_038424437.1\|441801_442491_-	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	5.7e-13	29.1
WP_038424436.1\|442774_443395_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_004121015.1\|443643_444123_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_038424435.1\|444186_447339_-	multidrug efflux RND transporter permease subunit OqxB	NA	NA	NA	NA
WP_014229159.1\|447363_448539_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_025107948.1\|448874_449249_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_032751394.1\|449604_449853_-	hypothetical protein	NA	NA	NA	NA
WP_050597590.1\|449860_451819_-	hypothetical protein	A0A0F7LA61	Klebsiella_phage	2.6e-71	33.0
WP_032751395.1\|451828_452704_-\|tail	tail fiber assembly protein	K7PMH7	Enterobacteria_phage	3.5e-23	39.0
WP_032751396.1\|452703_453516_-\|tail	tail fiber protein	E5G6P0	Salmonella_phage	2.6e-25	52.9
WP_016807443.1\|453518_454103_-	YmfQ family protein	M4M9M8	Vibrio_phage	2.2e-45	48.2
WP_076752252.1\|454087_455164_-\|plate	baseplate J/gp47 family protein	A0A2I7S9E5	Vibrio_phage	1.9e-103	53.4
WP_019704449.1\|455150_455603_-	phage GP46 family protein	A0A2I7S9F0	Vibrio_phage	6.6e-26	43.4
WP_076752253.1\|455599_456139_-\|plate	phage baseplate assembly protein	A0A2I7S9F6	Vibrio_phage	1.0e-33	46.6
WP_076752255.1\|456129_457215_-\|tail	phage tail protein	M4M9L5	Vibrio_phage	9.7e-92	48.1
WP_076752256.1\|457207_458464_-	DNA circularization N-terminal domain-containing protein	A0A2I7S9E8	Vibrio_phage	5.4e-86	41.5
WP_076752258.1\|458463_460263_-\|tail	phage tail tape measure protein	A0A2P9JZK0	Alteromonadaceae_phage	3.8e-64	36.1
WP_076752260.1\|460361_460745_-\|tail	phage tail assembly protein	A0A2P9JZJ9	Alteromonadaceae_phage	1.3e-14	41.3
WP_076752262.1\|460748_461102_-\|tail	phage tail tube protein	NA	NA	NA	NA
WP_076752264.1\|461111_462593_-\|tail	phage tail sheath subtilisin-like domain-containing protein	M1Q565	Vibrio_phage	1.1e-165	60.2
WP_076752266.1\|462594_462804_-	DUF2635 domain-containing protein	NA	NA	NA	NA
WP_076752268.1\|462806_463418_-	hypothetical protein	M4MHF0	Vibrio_phage	1.2e-38	41.3
WP_076752270.1\|463414_463957_-	phage virion morphogenesis protein	A0A2I7S9D7	Vibrio_phage	1.1e-59	63.1
WP_048981144.1\|463956_464397_-	DUF1320 domain-containing protein	A0A2I7S9E9	Vibrio_phage	8.4e-34	47.9
WP_076752272.1\|464396_464870_-	hypothetical protein	NA	NA	NA	NA
WP_076752273.1\|465092_465995_-\|head	Mu-like prophage major head subunit gpT family protein	M4MB71	Vibrio_phage	1.1e-101	60.5
WP_049082011.1\|465997_466969_-\|protease	Mu phage protease GpI	M1Q578	Vibrio_phage	8.2e-74	49.7
WP_064176622.1\|467202_468045_-	hypothetical protein	M1PVV7	Vibrio_phage	1.7e-88	57.5
WP_064176623.1\|468037_469609_-	DUF935 domain-containing protein	A0A2I7S9K0	Vibrio_phage	6.6e-158	56.0
WP_064176624.1\|469608_471195_-	hypothetical protein	M4MHG0	Vibrio_phage	1.2e-199	69.1
WP_032751427.1\|471191_471767_-	DUF3486 family protein	M4MCR3	Vibrio_phage	5.8e-51	59.6
WP_032751429.1\|471756_472044_-	hypothetical protein	NA	NA	NA	NA
WP_004114568.1\|472043_472331_-	hypothetical protein	A0A2I7S9D8	Vibrio_phage	8.4e-27	64.5
WP_004114566.1\|472340_472643_-	DUF2730 domain-containing protein	M1Q558	Vibrio_phage	4.3e-13	42.6
WP_023301739.1\|472623_472854_-	TraR/DksA family transcriptional regulator	NA	NA	NA	NA
WP_076752274.1\|472850_473462_-	hypothetical protein	M4MB79	Vibrio_phage	7.1e-23	39.2
WP_032751969.1\|473449_473857_-	hypothetical protein	NA	NA	NA	NA
WP_076752275.1\|474070_474649_-	N-acetylmuramidase	A0A2I7S9B9	Vibrio_phage	7.9e-40	46.5
WP_076752276.1\|474744_475230_-	hypothetical protein	NA	NA	NA	NA
WP_064176649.1\|475238_475628_-	transcriptional regulator	A0A0C4UR27	Shigella_phage	4.6e-36	58.1
WP_076752277.1\|475624_476179_-	regulatory protein GemA	A0A0C4UQU3	Shigella_phage	3.7e-39	46.1
WP_076752278.1\|476175_476763_-	hypothetical protein	NA	NA	NA	NA
WP_076752279.1\|476755_477253_-	hypothetical protein	A0A0A7RUP4	Clostridium_phage	1.9e-05	36.0
WP_049123494.1\|477333_477951_-	DUF3164 family protein	A0A2I7S9B0	Vibrio_phage	4.4e-65	60.9
WP_004114541.1\|477966_478254_-	HTH domain-containing protein	C9DGL7	Escherichia_phage	3.5e-17	48.3
WP_076752280.1\|478256_478496_-	hypothetical protein	NA	NA	NA	NA
WP_049123489.1\|478500_479448_-	AAA family ATPase	A0A0C4UQR3	Shigella_phage	9.9e-141	79.7
WP_076752281.1\|479484_481578_-\|transposase	Mu transposase C-terminal domain-containing protein	A0A2D1GNK9	Pseudomonas_phage	1.3e-185	51.2
WP_049090873.1\|481580_481805_-	helix-turn-helix domain-containing protein	M1PVU4	Vibrio_phage	1.5e-15	57.1
WP_076752282.1\|481986_482550_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_047935461.1\|483098_484394_+	voltage-gated ClC-type chloride channel ClcB	NA	NA	NA	NA
WP_004851267.1\|484346_485042_-	ATP-dependent dethiobiotin synthetase BioD	NA	NA	NA	NA
WP_014229533.1\|485169_486390_-	ROK family transcriptional regulator	NA	NA	NA	NA
WP_014229534.1\|486523_487417_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_038424574.1\|487535_488786_+	MFS transporter	NA	NA	NA	NA
WP_038424575.1\|489214_490702_+	carboxypeptidase M32	NA	NA	NA	NA
WP_009654716.1\|490876_491302_+	acid resistance repetitive basic protein Asr	NA	NA	NA	NA
WP_071889119.1\|491414_491690_-	hypothetical protein	NA	NA	NA	NA
WP_014229539.1\|492514_493327_+\|protease	serine protease	NA	NA	NA	NA

DBSCAN-SWA_3

634001 : 684629

Escherichia_phage(50.0%)

integrase,plate,transposase

attL 627822:627838|attR 651699:651715

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
627822:627838	attL	NA	NA	NA	NA
WP_014229630.1\|634001_634550_+\|integrase	tyrosine-type recombinase/integrase	A0A2L1IV36	Escherichia_phage	7.2e-51	51.9
WP_014229631.1\|635006_635525_+	fimbrial protein	NA	NA	NA	NA
WP_038424607.1\|635625_636315_+	fimbria/pilus periplasmic chaperone	NA	NA	NA	NA
WP_038424608.1\|636374_638945_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_014229634.1\|638960_639962_+	fimbrial protein	NA	NA	NA	NA
WP_014229635.1\|640007_640535_+	type 1 fimbrial protein	NA	NA	NA	NA
WP_014838689.1\|640572_641124_-\|integrase	tyrosine-type recombinase/integrase	A0A2L1IV36	Escherichia_phage	2.6e-53	55.1
WP_014229637.1\|641528_642200_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_014838691.1\|642815_643724_-	DUF535 family protein	NA	NA	NA	NA
WP_119834491.1\|644039_644180_+	hypothetical protein	NA	NA	NA	NA
WP_032719374.1\|644210_644381_-	hypothetical protein	NA	NA	NA	NA
WP_162097154.1\|644918_645197_-	hypothetical protein	NA	NA	NA	NA
WP_004136705.1\|645144_645357_+	cold shock-like protein CspF	NA	NA	NA	NA
WP_014229640.1\|645385_646258_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	4.3e-05	27.3
WP_038424609.1\|646364_647144_+	acetolactate decarboxylase	NA	NA	NA	NA
WP_014229641.1\|647154_648834_+	acetolactate synthase AlsS	NA	NA	NA	NA
WP_032692927.1\|648857_649628_+	(S)-acetoin forming diacetyl reductase	NA	NA	NA	NA
WP_032692928.1\|649684_650755_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.8e-28	32.4
WP_025105882.1\|650747_652517_-	iron ABC transporter permease	NA	NA	NA	NA
651699:651715	attR	NA	NA	NA	NA
WP_038424611.1\|652588_653677_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_148719562.1\|654286_655303_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	2.4e-185	99.1
WP_032692931.1\|655377_655923_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_076752297.1\|655900_656986_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_038424613.1\|656949_658704_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_071889106.1\|658803_659082_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_038424614.1\|659571_663042_-	type VI secretion protein VasK	NA	NA	NA	NA
WP_038424615.1\|663038_664262_-	hypothetical protein	NA	NA	NA	NA
WP_032719392.1\|664348_665158_-	hypothetical protein	NA	NA	NA	NA
WP_038424616.1\|665191_665992_-	hypothetical protein	NA	NA	NA	NA
WP_042945317.1\|666025_666835_-	hypothetical protein	NA	NA	NA	NA
WP_038424617.1\|666868_667675_-	hypothetical protein	NA	NA	NA	NA
WP_038424618.1\|667686_670824_-	hypothetical protein	NA	NA	NA	NA
WP_076752298.1\|670845_671598_-	hypothetical protein	NA	NA	NA	NA
WP_038424619.1\|671702_672467_-	hypothetical protein	NA	NA	NA	NA
WP_077255418.1\|672571_673312_-	hypothetical protein	NA	NA	NA	NA
WP_076752299.1\|673412_676532_-	hypothetical protein	NA	NA	NA	NA
WP_038424622.1\|676556_677429_-	hypothetical protein	NA	NA	NA	NA
WP_038424623.1\|677428_679771_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	1.7e-03	25.0
WP_038424624.1\|679767_680112_-	hypothetical protein	NA	NA	NA	NA
WP_038424626.1\|680893_682606_-	OmpA family protein	NA	NA	NA	NA
WP_076752300.1\|682602_683292_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_038424628.1\|683288_684629_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA

DBSCAN-SWA_4

1005500 : 1069669

uncultured_Caudovirales_phage(29.41%)

holin,terminase,integrase,tail,tRNA,head,transposase

attL 1007391:1007408|attR 1073001:1073018

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004852151.1\|1005500_1006523_+\|tRNA	tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB	NA	NA	NA	NA
WP_014229858.1\|1006746_1007490_-	copper homeostasis protein CutC	NA	NA	NA	NA
1007391:1007408	attL	NA	NA	NA	NA
WP_014229859.1\|1007566_1008136_-	VOC family protein	NA	NA	NA	NA
WP_009652018.1\|1008365_1010099_+\|tRNA	arginine--tRNA ligase	A0A2K9L6Z2	Tupanvirus	4.1e-84	33.4
WP_014229860.1\|1010219_1011359_-	glycoside hydrolase family 105 protein	NA	NA	NA	NA
WP_032750407.1\|1011363_1012947_-	MFS transporter	NA	NA	NA	NA
WP_157870119.1\|1013023_1013209_+	hypothetical protein	NA	NA	NA	NA
WP_004852164.1\|1013311_1013740_+	universal stress protein UspC	NA	NA	NA	NA
WP_014229861.1\|1013766_1015191_-	alpha,alpha-trehalose-phosphate synthase	NA	NA	NA	NA
WP_014229862.1\|1015165_1015969_-	trehalose-phosphatase	NA	NA	NA	NA
WP_004852169.1\|1016127_1017108_-	L-arabinose ABC transporter permease AraH	NA	NA	NA	NA
WP_014229863.1\|1017122_1018637_-	L-arabinose ABC transporter ATP-binding protein AraG	A0A2R8FG22	Brazilian_cedratvirus	1.5e-10	27.6
WP_014229864.1\|1018698_1019679_-	arabinose ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_032693589.1\|1019967_1020525_-	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_032720337.1\|1021025_1021529_+	non-heme ferritin-like protein	NA	NA	NA	NA
WP_014229867.1\|1021853_1023365_+	MFS transporter	NA	NA	NA	NA
WP_014229868.1\|1023411_1023663_-	DUF2766 domain-containing protein	NA	NA	NA	NA
WP_014229869.1\|1023742_1023826_-	stress response protein AzuC	NA	NA	NA	NA
WP_032750412.1\|1024033_1025455_+	MFS transporter	NA	NA	NA	NA
WP_014229871.1\|1025507_1026146_-	RpiB/LacA/LacB family sugar-phosphate isomerase	NA	NA	NA	NA
WP_004852185.1\|1026569_1027067_+	non-heme ferritin	NA	NA	NA	NA
WP_004852186.1\|1027109_1027349_-	YecH family protein	NA	NA	NA	NA
WP_032750415.1\|1027543_1028755_+	tyrosine transporter TyrP	NA	NA	NA	NA
WP_014229873.1\|1028784_1029453_-	YecA family protein	NA	NA	NA	NA
WP_014838847.1\|1029519_1030407_-	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_076752317.1\|1030912_1031272_-	hypothetical protein	R9TPM9	Aeromonas_phage	3.4e-17	45.0
WP_076752318.1\|1031268_1031805_-	lysozyme	K7PM52	Enterobacteria_phage	1.9e-72	70.5
WP_015365951.1\|1031788_1032013_-\|holin	class II holin family protein	A0A0P0ZFW5	Escherichia_phage	2.0e-20	70.1
WP_076752319.1\|1032121_1032406_-	hypothetical protein	NA	NA	NA	NA
WP_187420816.1\|1032406_1033468_-	hypothetical protein	NA	NA	NA	NA
WP_163428417.1\|1033424_1034652_+\|transposase	IS3 family transposase	Q9ZXG3	Shigella_phage	3.3e-160	90.0
WP_117093564.1\|1035147_1036267_+\|transposase	IS3-like element ISKpn34 family transposase	S5WIU1	Leptospira_phage	6.6e-51	43.3
WP_077274237.1\|1036260_1037256_-	hypothetical protein	A0A2H4J3Z5	uncultured_Caudovirales_phage	1.0e-26	41.3
WP_076752320.1\|1037273_1038884_-\|terminase	phage terminase large subunit	A0A2H4JCA3	uncultured_Caudovirales_phage	1.2e-226	70.8
WP_076752321.1\|1038880_1039222_-	hypothetical protein	A0A2H4J7H0	uncultured_Caudovirales_phage	2.0e-19	48.2
WP_064164976.1\|1039283_1039580_-	hypothetical protein	A0A2R9YJP3	Escherichia_phage	2.5e-10	33.3
WP_076752322.1\|1039624_1039927_-	hypothetical protein	NA	NA	NA	NA
WP_076752323.1\|1039940_1042835_-	hypothetical protein	G9L6D4	Escherichia_phage	0.0e+00	70.8
WP_076752324.1\|1042837_1045549_-	transglycosylase SLT domain-containing protein	G9L6D3	Escherichia_phage	1.8e-288	58.7
WP_076752325.1\|1045554_1046043_-	hypothetical protein	A0A2H4J679	uncultured_Caudovirales_phage	1.9e-07	44.8
WP_076752326.1\|1046045_1046495_-	GNAT family N-acetyltransferase	A0A2H4J9Z5	uncultured_Caudovirales_phage	1.2e-22	43.6
WP_076752327.1\|1046497_1048489_-	hypothetical protein	A0A2H4J6H2	uncultured_Caudovirales_phage	7.3e-186	48.4
WP_076752328.1\|1048488_1049052_-	hypothetical protein	A0A2H4JID6	uncultured_Caudovirales_phage	9.0e-49	50.3
WP_076752603.1\|1049111_1050017_-	hypothetical protein	A0A2H4JC66	uncultured_Caudovirales_phage	1.8e-43	38.9
WP_116944824.1\|1050202_1050517_+	hypothetical protein	NA	NA	NA	NA
WP_076752329.1\|1050546_1051395_-	hypothetical protein	A0A2H4JEQ5	uncultured_Caudovirales_phage	5.3e-45	42.5
WP_032409894.1\|1051381_1051615_-	hypothetical protein	NA	NA	NA	NA
WP_076752330.1\|1051611_1053237_-\|head,tail	head-tail connector protein	A0A2H4J3N6	uncultured_Caudovirales_phage	5.2e-174	59.7
WP_032409891.1\|1053240_1053462_-	hypothetical protein	NA	NA	NA	NA
WP_076752331.1\|1053472_1053913_-	hypothetical protein	NA	NA	NA	NA
WP_015365933.1\|1053940_1054237_-	hypothetical protein	NA	NA	NA	NA
WP_155774225.1\|1054240_1054405_-	hypothetical protein	NA	NA	NA	NA
WP_041165551.1\|1054392_1054695_-	DUF968 domain-containing protein	A0A1I9KFA7	Aeromonas_phage	3.6e-28	56.8
WP_076752332.1\|1054706_1055303_-	DUF1367 family protein	H9C173	Pectobacterium_phage	1.3e-77	68.7
WP_076752334.1\|1056087_1056966_-	hypothetical protein	NA	NA	NA	NA
WP_148719562.1\|1057253_1058270_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	2.4e-185	99.1
WP_076752335.1\|1058424_1059015_-	adenine methylase	A0A2R9YJG0	Escherichia_phage	2.3e-95	86.2
WP_015365925.1\|1059178_1059412_-	hypothetical protein	NA	NA	NA	NA
WP_076752336.1\|1059415_1060087_-	hypothetical protein	NA	NA	NA	NA
WP_076752604.1\|1060125_1061520_-	AAA family ATPase	Q76H51	Enterobacteria_phage	2.4e-103	46.7
WP_076752337.1\|1061528_1062521_-	replication protein	A0A067ZIA1	Vibrio_phage	2.8e-29	47.4
WP_015365921.1\|1062523_1062682_-	hypothetical protein	NA	NA	NA	NA
WP_015365920.1\|1062765_1063212_-	hypothetical protein	H9C162	Pectobacterium_phage	1.7e-26	51.4
WP_000364674.1\|1063274_1063508_-	helix-turn-helix transcriptional regulator	A0A0U2S629	Escherichia_phage	2.9e-09	44.4
WP_042946235.1\|1063616_1064072_+	helix-turn-helix domain-containing protein	A0A0U2QW76	Escherichia_phage	2.1e-35	51.7
WP_050597398.1\|1064794_1065028_+	hypothetical protein	NA	NA	NA	NA
WP_049099639.1\|1065035_1065281_+	hypothetical protein	A0A1B1W282	Salmonella_phage	1.1e-14	59.5
WP_076752338.1\|1065310_1067461_+	hypothetical protein	H9C157	Pectobacterium_phage	9.0e-97	34.5
WP_020947876.1\|1067460_1068027_+	siphovirus Gp157 family protein	H9C156	Pectobacterium_phage	4.6e-53	63.0
WP_076752339.1\|1068423_1068669_+	DUF4224 domain-containing protein	H9C153	Pectobacterium_phage	4.8e-07	41.4
WP_076752340.1\|1068652_1069669_+\|integrase	tyrosine-type recombinase/integrase	H9C152	Pectobacterium_phage	4.8e-125	64.2
1073001:1073018	attR	NA	NA	NA	NA

DBSCAN-SWA_5

1277245 : 1285640

Bacillus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032693716.1\|1277245_1278781_+	two-component system sensor histidine kinase BaeS	W8CYF6	Bacillus_phage	2.8e-28	27.6
WP_014230101.1\|1278777_1279500_+	two-component system response regulator BaeR	W8CYM9	Bacillus_phage	2.4e-30	32.7
WP_025107782.1\|1279818_1281180_+\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	1.6e-200	92.0
WP_009654032.1\|1281424_1282318_+	lipid kinase YegS	A0A1V0SBJ0	Catovirus	8.8e-14	28.9
WP_014230103.1\|1282318_1282789_-	hypothetical protein	NA	NA	NA	NA
WP_032693715.1\|1282775_1283576_-	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_014230105.1\|1283992_1284766_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.8e-27	37.7
WP_014230106.1\|1284776_1285640_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.9e-11	28.5

DBSCAN-SWA_6

1398349 : 1470616

Pseudomonas_phage(14.29%)

plate,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014230184.1\|1398349_1398802_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_014230185.1\|1398794_1399331_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_076752346.1\|1399311_1400415_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_076752347.1\|1400369_1402133_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_032693683.1\|1402156_1402891_-	hypothetical protein	NA	NA	NA	NA
WP_014230189.1\|1402955_1403150_-	hypothetical protein	NA	NA	NA	NA
WP_014230191.1\|1403501_1406921_-	type VI secretion protein VasK	NA	NA	NA	NA
WP_014230192.1\|1406907_1408068_-	hypothetical protein	NA	NA	NA	NA
WP_014230193.1\|1408071_1408338_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_076752348.1\|1408367_1409048_-	hypothetical protein	NA	NA	NA	NA
WP_014230195.1\|1409044_1410949_-	LysM peptidoglycan-binding domain-containing protein	S6BFI4	Thermus_phage	3.2e-05	53.5
WP_076752349.1\|1410957_1411497_-	hypothetical protein	NA	NA	NA	NA
WP_014839083.1\|1411489_1414105_-	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_014230199.1\|1414396_1415038_-	hypothetical protein	NA	NA	NA	NA
WP_014839086.1\|1416649_1417141_-	type VI secretion system effector Hcp	NA	NA	NA	NA
WP_171817012.1\|1417145_1418870_-	OmpA family protein	NA	NA	NA	NA
WP_014839088.1\|1418873_1419527_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_014839089.1\|1419523_1420861_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_164504666.1\|1420879_1422424_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_014230205.1\|1422466_1422964_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_075208269.1\|1423276_1423603_-	hypothetical protein	NA	NA	NA	NA
WP_009653963.1\|1423945_1425052_+	AI-2E family transporter	NA	NA	NA	NA
WP_014230206.1\|1425254_1425746_+\|protease	serine protease inhibitor ecotin	NA	NA	NA	NA
WP_076752350.1\|1425790_1427425_-	malate dehydrogenase (quinone)	NA	NA	NA	NA
WP_162097206.1\|1427794_1428952_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	9.4e-77	48.6
WP_014230209.1\|1428914_1430351_-	magnesium transporter	NA	NA	NA	NA
WP_014230210.1\|1430519_1432163_-	multidrug ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	1.2e-08	22.6
WP_014230211.1\|1432239_1432890_-	DNA oxidative demethylase AlkB	NA	NA	NA	NA
WP_014230212.1\|1432889_1433954_-	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	L7Y5F8	Megavirus	1.4e-18	47.2
WP_014230213.1\|1434026_1435079_-	FAD:protein FMN transferase ApbE	NA	NA	NA	NA
WP_076752352.1\|1438134_1440795_+	phosphotransferase RcsD	NA	NA	NA	NA
WP_004103995.1\|1440811_1441462_+	transcriptional regulator RcsB	NA	NA	NA	NA
WP_014230216.1\|1441506_1444353_-	two-component system sensor histidine kinase RcsC	A0A1V0SGX0	Hokovirus	3.4e-43	26.3
WP_004852752.1\|1444483_1447117_-	DNA topoisomerase (ATP-hydrolyzing) subunit A	G3M9Z5	Bacillus_virus	1.6e-92	30.8
WP_014230217.1\|1447302_1448031_+	bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG	NA	NA	NA	NA
WP_014839096.1\|1448375_1450661_+	ribonucleoside-diphosphate reductase subunit alpha	I3UMG3	Colwellia_phage	3.5e-285	63.9
WP_004852757.1\|1450764_1451895_+	ribonucleotide-diphosphate reductase subunit beta	G9IAA3	Pseudomonas_phage	7.3e-175	78.9
WP_004104002.1\|1451894_1452149_+	2Fe-2S ferredoxin-like protein	G9IAA2	Pseudomonas_phage	8.2e-26	64.0
WP_038424725.1\|1452341_1453886_+	GMC family oxidoreductase N-terminal domain-containing protein	A0A1V0SI18	Klosneuvirus	6.8e-38	28.2
WP_038424726.1\|1453930_1454887_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014230221.1\|1454891_1455959_-	glycerophosphodiester phosphodiesterase	A0A220BYK6	Staphylococcus_phage	3.9e-08	42.9
WP_014230222.1\|1455968_1457315_-	glycerol-3-phosphate transporter	NA	NA	NA	NA
WP_076752353.1\|1457586_1459209_+	anaerobic glycerol-3-phosphate dehydrogenase subunit A	NA	NA	NA	NA
WP_038424727.1\|1459198_1460458_+	glycerol-3-phosphate dehydrogenase subunit GlpB	NA	NA	NA	NA
WP_014839098.1\|1460454_1461633_+	anaerobic glycerol-3-phosphate dehydrogenase subunit C	NA	NA	NA	NA
WP_014839099.1\|1461655_1462459_-	2-keto-3-deoxy-L-rhamnonate aldolase	NA	NA	NA	NA
WP_004852770.1\|1462473_1463763_-	MFS transporter	NA	NA	NA	NA
WP_014839100.1\|1463815_1465021_-	L-rhamnonate dehydratase	Q6A202	Oenococcus_phage	1.8e-25	28.3
WP_004852774.1\|1465034_1465817_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_014230228.1\|1466021_1467218_-	nicotinamide mononucleotide deamidase-related protein YfaY	NA	NA	NA	NA
WP_004123076.1\|1467314_1467857_-	membrane protein	NA	NA	NA	NA
WP_014230229.1\|1468126_1469575_+	catalase	A0A2K9L0T1	Tupanvirus	6.9e-101	46.7
WP_038424728.1\|1469623_1470616_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	4.2e-73	56.3

DBSCAN-SWA_7

1806581 : 1812414

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004219972.1\|1806581_1807148_-	phage polarity suppression protein	Q7M2A1	Enterobacteria_phage	3.3e-59	63.8
WP_076752366.1\|1807165_1807411_-	ogr/Delta-like zinc finger family protein	Q7M294	Enterobacteria_phage	5.0e-20	59.3
WP_076752367.1\|1807407_1808145_-	glycoprotein 3	Q7M2A2	Enterobacteria_phage	4.5e-72	60.2
WP_004132554.1\|1808704_1808971_+	AlpA family transcriptional regulator	Q7M299	Enterobacteria_phage	2.6e-30	71.6
WP_076752368.1\|1808967_1809525_+	ash family protein	Q7M2A7	Enterobacteria_phage	5.1e-36	65.9
WP_076752369.1\|1809521_1809749_+	hypothetical protein	NA	NA	NA	NA
WP_004098169.1\|1809745_1810066_+	DUF5375 domain-containing protein	NA	NA	NA	NA
WP_076752370.1\|1810080_1812414_+	toprim domain-containing protein	Q7M2A8	Enterobacteria_phage	0.0e+00	84.3

DBSCAN-SWA_8

2580672 : 2663712

uncultured_Caudovirales_phage(55.0%)

terminase,integrase,capsid,tail,tRNA,portal,head,protease,transposase

attL 2627218:2627235|attR 2643434:2643451

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014226996.1\|2580672_2581161_-\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	4.9e-27	54.7
WP_014226997.1\|2581164_2581803_-	stringent starvation protein A	NA	NA	NA	NA
WP_000829815.1\|2582114_2582507_-	30S ribosomal protein S9	NA	NA	NA	NA
WP_004106200.1\|2582522_2582951_-	50S ribosomal protein L13	NA	NA	NA	NA
WP_032693267.1\|2583170_2584304_-	cell division protein ZapE	NA	NA	NA	NA
WP_004854637.1\|2584494_2584893_+	DUF1043 family protein	NA	NA	NA	NA
WP_014226999.1\|2585065_2586433_+\|protease	serine endoprotease DegQ	A0A1B1IT49	uncultured_Mediterranean_phage	4.3e-20	24.2
WP_009651894.1\|2586519_2587581_+	outer membrane-stress sensor serine endopeptidase DegS	NA	NA	NA	NA
WP_032720211.1\|2587608_2588310_-	membrane protein associated with oxaloacetate decarboxylase	NA	NA	NA	NA
WP_014839646.1\|2588426_2589728_-	oxalacetate decarboxylase subunit beta	NA	NA	NA	NA
WP_014837378.1\|2589743_2591513_-	sodium-extruding oxaloacetate decarboxylase subunit alpha	NA	NA	NA	NA
WP_076752406.1\|2591528_2591780_-	oxaloacetate decarboxylase subunit gamma	NA	NA	NA	NA
WP_014227006.1\|2591936_2592554_-	L(+)-tartrate dehydratase subunit beta	NA	NA	NA	NA
WP_014227007.1\|2592553_2593453_-	L(+)-tartrate dehydratase subunit alpha	NA	NA	NA	NA
WP_032694499.1\|2593485_2594754_-	SLC13/DASS family transporter	Q6A201	Oenococcus_phage	3.0e-60	33.7
WP_014227009.1\|2594964_2595630_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_014227010.1\|2595601_2596246_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_004854646.1\|2596377_2597316_-	malate dehydrogenase	NA	NA	NA	NA
WP_004106225.1\|2597729_2598200_+	transcriptional regulator ArgR	NA	NA	NA	NA
WP_076752407.1\|2598553_2598817_+	peroxide/acid stress response protein YhcN	NA	NA	NA	NA
WP_004106229.1\|2598919_2599186_+	peroxide/acid stress response protein YhcN	NA	NA	NA	NA
WP_004854654.1\|2599236_2599512_-	barstar family protein	NA	NA	NA	NA
WP_032720724.1\|2599651_2601619_-	p-hydroxybenzoic acid efflux pump subunit AaeB	NA	NA	NA	NA
WP_004854657.1\|2601624_2602557_-	p-hydroxybenzoic acid efflux pump subunit AaeA	NA	NA	NA	NA
WP_002918640.1\|2602564_2602768_-	AaeX family protein	NA	NA	NA	NA
WP_004854659.1\|2602899_2603829_+	HTH-type transcriptional activator AaeR	NA	NA	NA	NA
WP_014227013.1\|2603825_2604572_-	L-fucose operon activator	NA	NA	NA	NA
WP_004854666.1\|2604630_2606076_-\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_032720723.1\|2606164_2609962_-	AsmA2 domain-containing protein YhdP	NA	NA	NA	NA
WP_004125826.1\|2610041_2611511_-	ribonuclease G	NA	NA	NA	NA
WP_042946071.1\|2611513_2612095_-	septum formation inhibitor Maf	NA	NA	NA	NA
WP_004125830.1\|2612102_2612591_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_004106252.1\|2612590_2613577_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_002918653.1\|2613646_2614690_-	rod shape-determining protein MreB	F2Y0P3	Organic_Lake_phycodnavirus	6.7e-05	22.3
WP_014227016.1\|2614995_2616936_-	RNase E specificity factor CsrD	NA	NA	NA	NA
WP_032694494.1\|2617173_2618148_+	oxidoreductase	NA	NA	NA	NA
WP_014227018.1\|2618225_2619227_+	protein-methionine-sulfoxide reductase catalytic subunit MsrP	NA	NA	NA	NA
WP_014227019.1\|2619226_2619826_+	protein-methionine-sulfoxide reductase heme-binding subunit MsrQ	NA	NA	NA	NA
WP_032694493.1\|2620219_2620693_+	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
WP_004125846.1\|2620703_2622053_+	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_004125848.1\|2622163_2622406_+	YhdT family protein	NA	NA	NA	NA
WP_014227020.1\|2622395_2623847_+	sodium/pantothenate symporter	NA	NA	NA	NA
WP_032694492.1\|2623858_2624740_+	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
WP_014227022.1\|2624876_2625617_+	carbonic anhydrase family protein	NA	NA	NA	NA
WP_014227023.1\|2625945_2626911_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_000462905.1\|2626935_2627232_+	DNA-binding transcriptional regulator Fis	NA	NA	NA	NA
2627218:2627235	attL	NA	NA	NA	NA
WP_001547818.1\|2627389_2627698_-	DUF3892 domain-containing protein	NA	NA	NA	NA
WP_065805094.1\|2627848_2629510_-\|terminase	terminase large subunit	A0A2H4JB64	uncultured_Caudovirales_phage	0.0e+00	97.5
WP_065805092.1\|2629493_2629850_-\|terminase	phage terminase small subunit P27 family	A0A2H4JHS3	uncultured_Caudovirales_phage	2.7e-59	97.5
WP_047723297.1\|2630126_2630570_-	HNH endonuclease	A0A2H4JAS8	uncultured_Caudovirales_phage	1.4e-76	89.8
WP_000123150.1\|2630569_2630863_-\|head,tail	phage gp6-like head-tail connector protein	A0A2H4JD08	uncultured_Caudovirales_phage	2.7e-44	85.6
WP_065805090.1\|2630859_2631198_-\|head	phage head closure protein	A0A2H4JHK5	uncultured_Caudovirales_phage	4.0e-52	88.4
WP_065805088.1\|2631194_2632421_-\|portal	phage portal protein	A0A2H4JFJ9	uncultured_Caudovirales_phage	1.5e-229	95.6
WP_065805086.1\|2632422_2632983_-\|head,protease	HK97 family phage prohead protease	A0A2H4JB68	uncultured_Caudovirales_phage	2.9e-100	97.3
WP_065805084.1\|2633034_2634201_-\|capsid	phage major capsid protein	A0A2H4JED2	uncultured_Caudovirales_phage	8.3e-206	95.4
WP_065805082.1\|2634479_2634953_+	hypothetical protein	NA	NA	NA	NA
WP_065805080.1\|2635000_2635336_-	hypothetical protein	NA	NA	NA	NA
WP_076752408.1\|2635678_2637814_-	DUF927 domain-containing protein	A0A1W6JPG0	Morganella_phage	7.5e-205	62.3
WP_001549749.1\|2637813_2638179_-	hypothetical protein	NA	NA	NA	NA
WP_058820234.1\|2638175_2638544_-	hypothetical protein	A0A2H4JCX7	uncultured_Caudovirales_phage	7.4e-52	81.1
WP_049007534.1\|2638540_2638855_-	hypothetical protein	NA	NA	NA	NA
WP_058820235.1\|2638847_2639036_-	hypothetical protein	NA	NA	NA	NA
WP_148723012.1\|2639028_2639298_-	host cell division inhibitor Icd-like protein	A0A2H4JGW3	uncultured_Caudovirales_phage	4.2e-44	93.3
WP_046275055.1\|2639493_2639679_+	hypothetical protein	NA	NA	NA	NA
WP_065805154.1\|2639802_2640582_-	phage antirepressor KilAC domain-containing protein	Q8HA02	Enterobacteria_phage	6.2e-40	51.5
WP_065805076.1\|2640590_2640875_-	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_040194014.1\|2641035_2641941_-	hypothetical protein	NA	NA	NA	NA
WP_063159745.1\|2642033_2643260_-\|integrase	site-specific integrase	A0A2H4JB45	uncultured_Caudovirales_phage	1.2e-151	62.4
WP_004854718.1\|2643521_2644163_-	acrEF/envCD operon transcriptional regulator	NA	NA	NA	NA
2643434:2643451	attR	NA	NA	NA	NA
WP_000427623.1\|2645532_2646537_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_014227025.1\|2647021_2650132_+	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
WP_004854727.1\|2650400_2650622_+	hypothetical protein	NA	NA	NA	NA
WP_038423753.1\|2656687_2657242_+	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_014227027.1\|2657217_2657475_-	DUF1488 domain-containing protein	NA	NA	NA	NA
WP_038423755.1\|2657471_2658290_-	shikimate dehydrogenase	NA	NA	NA	NA
WP_038423757.1\|2658293_2658866_-	L-threonylcarbamoyladenylate synthase type 1 TsaC	NA	NA	NA	NA
WP_014227029.1\|2658870_2659413_-	topoisomerase DNA-binding C4 zinc finger domain-containing protein	NA	NA	NA	NA
WP_014227030.1\|2659440_2659914_-	DUF494 domain-containing protein	NA	NA	NA	NA
WP_014227031.1\|2659885_2661010_-	DNA-protecting protein DprA	NA	NA	NA	NA
WP_076752411.1\|2661123_2662197_+\|transposase	IS481-like element ISKpn28 family transposase	A0A0M3LR35	Mannheimia_phage	1.4e-05	21.9
WP_004854751.1\|2662240_2662750_+	peptide deformylase	E3SLL2	Synechococcus_phage	6.7e-19	41.1
WP_038423759.1\|2662764_2663712_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.7e-07	37.8

DBSCAN-SWA_9

5188529 : 5267063

Escherichia_phage(16.67%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004849490.1\|5188529_5189309_+\|tRNA	tRNA uridine 5-oxyacetic acid(34) methyltransferase CmoM	NA	NA	NA	NA
WP_004849491.1\|5189312_5190635_+	chromosome partition protein MukF	NA	NA	NA	NA
WP_004100725.1\|5190615_5191320_+	chromosome partition protein MukE	NA	NA	NA	NA
WP_076752533.1\|5191319_5195768_+	chromosome partition protein MukB	NA	NA	NA	NA
WP_038424272.1\|5195951_5197745_+	L,D-transpeptidase	NA	NA	NA	NA
WP_004130967.1\|5198045_5198597_+	YcbK family protein	NA	NA	NA	NA
WP_014837967.1\|5198610_5199258_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_009653304.1\|5199317_5200508_-	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
WP_004152397.1\|5202057_5203377_+\|transposase	IS1182-like element ISKpn6 family transposase	NA	NA	NA	NA
WP_004199234.1\|5203626_5204508_-	carbapenem-hydrolyzing class A beta-lactamase KPC-2	A0A1B0VBP7	Salmonella_phage	2.2e-73	52.2
WP_004152394.1\|5204894_5205674_-	IS21-like element ISKpn7 family helper ATPase IstB	A0A2L1IVB6	Escherichia_phage	2.5e-89	61.8
WP_004199214.1\|5205670_5206696_-\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	1.4e-87	50.3
WP_004152392.1\|5206802_5209832_-\|transposase	Tn3-like element Tn4401 family transposase	NA	NA	NA	NA
WP_004152391.1\|5209941_5211657_+	Tn3-like element Tn4401 family resolvase TnpR	NA	NA	NA	NA
WP_004849497.1\|5212383_5213784_-\|tRNA	asparagine--tRNA ligase	A0A2K9V902	Bandra_megavirus	5.0e-80	37.0
WP_025107499.1\|5214087_5215290_-	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	6.4e-44	31.1
WP_014228655.1\|5215617_5218233_+	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	6.3e-20	22.8
WP_032695054.1\|5218298_5219072_-	aliphatic sulfonates ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.1e-32	39.0
WP_004849501.1\|5219068_5219860_-	aliphatic sulfonate ABC transporter permease SsuC	NA	NA	NA	NA
WP_009653287.1\|5219916_5220492_-	NADPH-dependent FMN reductase	NA	NA	NA	NA
WP_004130996.1\|5220740_5221751_+	quinone-dependent dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_014837972.1\|5221919_5222462_+	cell division protein ZapC	NA	NA	NA	NA
WP_038424273.1\|5222458_5223568_-	MOSC domain-containing protein	NA	NA	NA	NA
WP_014228658.1\|5223666_5225772_+	bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL	NA	NA	NA	NA
WP_038424274.1\|5225784_5227692_+	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	5.6e-50	29.3
WP_032720968.1\|5227706_5228975_+	membrane integrity-associated transporter subunit PqiA	NA	NA	NA	NA
WP_014228660.1\|5228964_5230602_+	intermembrane transport protein PqiB	NA	NA	NA	NA
WP_004849513.1\|5230601_5231165_+	membrane integrity-associated transporter subunit PqiC	NA	NA	NA	NA
WP_004100764.1\|5231420_5231588_+	ribosome modulation factor	NA	NA	NA	NA
WP_004849514.1\|5231652_5232171_-	bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase	NA	NA	NA	NA
WP_014228662.1\|5232240_5233998_-\|protease	Lon protease family protein	NA	NA	NA	NA
WP_014228663.1\|5234183_5234636_+	macrodomain Ter protein MatP	NA	NA	NA	NA
WP_004849520.1\|5234738_5235809_-	porin OmpA	NA	NA	NA	NA
WP_014228664.1\|5236162_5236672_-	cell division inhibitor SulA	NA	NA	NA	NA
WP_014228665.1\|5237134_5237758_+	TfoX/Sxy family DNA transformation protein	NA	NA	NA	NA
WP_032695057.1\|5237745_5239881_-	TIGR01666 family membrane protein	NA	NA	NA	NA
WP_004849527.1\|5239898_5240345_-	YccF domain-containing protein	NA	NA	NA	NA
WP_038424275.1\|5240467_5242522_+	DNA helicase IV	A7KV33	Bacillus_phage	6.1e-18	27.2
WP_014228668.1\|5242550_5243009_-	methylglyoxal synthase	NA	NA	NA	NA
WP_014228669.1\|5243163_5243577_+	CoA-binding protein	NA	NA	NA	NA
WP_014228411.1\|5243728_5244163_+\|transposase	IS200/IS605 family transposase	Q331U4	Clostridium_botulinum_C_phage	6.8e-20	39.2
WP_076752535.1\|5244809_5252081_+	BapA prefix-like domain-containing protein	NA	NA	NA	NA
WP_014228671.1\|5252248_5253685_+	TolC family outer membrane protein	NA	NA	NA	NA
WP_004849540.1\|5253681_5255829_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	1.6e-24	25.1
WP_014228672.1\|5255825_5257031_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_014228673.1\|5257228_5260372_+	glycosyltransferase	NA	NA	NA	NA
WP_014228674.1\|5260414_5261353_+	peptidase	NA	NA	NA	NA
WP_014228675.1\|5261366_5262068_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_009651933.1\|5262526_5262844_-	heat shock protein HspQ	NA	NA	NA	NA
WP_076752536.1\|5262904_5264107_-	23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI	NA	NA	NA	NA
WP_014228676.1\|5264298_5264853_+	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_014837988.1\|5264869_5265658_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004849561.1\|5265707_5265989_+	acylphosphatase	NA	NA	NA	NA
WP_004849563.1\|5265985_5266315_-	sulfurtransferase TusE	NA	NA	NA	NA
WP_004100829.1\|5266403_5267063_-\|protease	FtsH protease modulator YccA	A0A2H4JFM9	uncultured_Caudovirales_phage	3.8e-46	53.9

DBSCAN-SWA_10

5729200 : 5769506

Salmonella_phage(33.33%)

holin,plate,terminase,integrase,transposase

attL 5728583:5728597|attR 5733390:5733404

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5728583:5728597	attL	NA	NA	NA	NA
WP_014229066.1\|5729200_5729977_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.9e-34	38.4
WP_076752557.1\|5730255_5730765_-	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_032419895.1\|5730997_5732179_+\|integrase	site-specific integrase	A0A0M4QX09	Salmonella_phage	1.3e-201	84.2
WP_009309074.1\|5732159_5732351_-	hypothetical protein	A0A0M4RTZ2	Salmonella_phage	2.3e-20	75.4
WP_032419897.1\|5732361_5732508_-	hypothetical protein	A0A1B5FPC2	Escherichia_phage	5.8e-16	72.9
WP_025714667.1\|5732504_5732729_-	hypothetical protein	A0A286S2B3	Klebsiella_phage	2.8e-17	55.4
WP_049077781.1\|5732712_5733147_-	hypothetical protein	NA	NA	NA	NA
WP_076752558.1\|5733139_5733847_-	Rha family transcriptional regulator	A0A286S260	Klebsiella_phage	1.7e-105	85.8
5733390:5733404	attR	NA	NA	NA	NA
WP_032420387.1\|5733852_5734371_-	hypothetical protein	A0A286S1S7	Klebsiella_phage	3.6e-76	79.1
WP_076752559.1\|5734414_5734846_-	hypothetical protein	A0A286S1S2	Klebsiella_phage	1.6e-74	97.1
WP_128805122.1\|5734842_5735061_-	hypothetical protein	A0A286S1P6	Klebsiella_phage	2.1e-30	91.7
WP_042944958.1\|5735032_5735245_-	hypothetical protein	A0A1B5FPB7	Escherichia_phage	5.6e-20	73.4
WP_049077787.1\|5735237_5735525_-	hypothetical protein	NA	NA	NA	NA
WP_049077790.1\|5735565_5735775_-	hypothetical protein	NA	NA	NA	NA
WP_076752560.1\|5735954_5736368_-	hypothetical protein	NA	NA	NA	NA
WP_049181672.1\|5736530_5737226_-	LexA family transcriptional regulator	A0A1B5FPF4	Escherichia_phage	4.0e-99	79.5
WP_071889436.1\|5737350_5737584_+	helix-turn-helix domain-containing protein	A0A1B5FPK9	Escherichia_phage	9.9e-18	63.9
WP_076752561.1\|5737585_5737840_+	hypothetical protein	NA	NA	NA	NA
WP_076752563.1\|5738447_5740094_+	DEAD/DEAH box helicase	A0A286N2P9	Klebsiella_phage	1.8e-278	82.1
WP_076752564.1\|5740095_5741058_+	toprim domain-containing protein	A0A286N2Q0	Klebsiella_phage	2.9e-180	97.5
WP_076752565.1\|5741054_5741837_+	antitermination protein	A0A286N2Q2	Klebsiella_phage	4.1e-132	88.1
WP_049100455.1\|5742123_5742621_-	hypothetical protein	A0A077K9U2	Edwardsiella_phage	4.7e-33	50.3
WP_158414542.1\|5742619_5742796_+	hypothetical protein	NA	NA	NA	NA
WP_040225058.1\|5743273_5743522_+\|holin	class II holin family protein	NA	NA	NA	NA
WP_076752566.1\|5743523_5744063_+	lysozyme	K7PM52	Enterobacteria_phage	2.2e-81	79.0
WP_075594565.1\|5744288_5744639_+	hypothetical protein	A0A0K2FIW3	Enterobacter_phage	1.4e-12	42.6
WP_021441335.1\|5745364_5745853_+	hypothetical protein	NA	NA	NA	NA
WP_071570694.1\|5745803_5747204_+\|terminase	PBSX family phage terminase large subunit	A0A077KAW0	Edwardsiella_phage	1.2e-187	69.0
WP_004143398.1\|5747435_5747831_-	helix-turn-helix domain containing protein	NA	NA	NA	NA
WP_077253535.1\|5747879_5749226_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_076752568.1\|5749427_5750879_+	DUF1073 domain-containing protein	A0A0M4S6U1	Salmonella_phage	2.9e-192	68.1
WP_076752569.1\|5750934_5751483_+	hypothetical protein	A0A0M4REK0	Salmonella_phage	2.0e-48	55.2
WP_076752570.1\|5751533_5752727_+	DUF2213 domain-containing protein	A0A0M4R5A6	Salmonella_phage	1.8e-110	53.8
WP_076752571.1\|5752738_5753233_+	hypothetical protein	A0A2H4JHM9	uncultured_Caudovirales_phage	2.5e-50	62.7
WP_076752572.1\|5753244_5754186_+	DUF2184 domain-containing protein	A0A2H4J191	uncultured_Caudovirales_phage	1.7e-140	77.1
WP_076752573.1\|5754231_5754513_+	hypothetical protein	NA	NA	NA	NA
WP_076752574.1\|5754481_5754898_+	DUF4054 domain-containing protein	A0A0M5M3S2	Salmonella_phage	9.6e-40	60.7
WP_064168882.1\|5754897_5755395_+	hypothetical protein	NA	NA	NA	NA
WP_064168883.1\|5755394_5755781_+	hypothetical protein	A0A2H4J1A4	uncultured_Caudovirales_phage	1.3e-46	75.0
WP_076752615.1\|5755866_5756316_+	hypothetical protein	A0A2H4J1A0	uncultured_Caudovirales_phage	6.7e-39	51.0
WP_064386285.1\|5756319_5757465_+	DUF3383 domain-containing protein	A0A2H4J8G4	uncultured_Caudovirales_phage	5.9e-156	73.5
WP_076752575.1\|5757475_5757919_+	DUF3277 family protein	A0A0M5M1K6	Salmonella_phage	7.3e-62	81.1
WP_000393949.1\|5757922_5758372_+	hypothetical protein	A0A0M4S6U8	Salmonella_phage	1.1e-36	55.3
WP_016244729.1\|5758413_5758566_+	hypothetical protein	A0A2H4J1A2	uncultured_Caudovirales_phage	1.4e-17	84.0
WP_076752576.1\|5758555_5760478_+	hypothetical protein	A0A0M4REK7	Salmonella_phage	1.5e-188	55.4
WP_049089441.1\|5760477_5761053_+	hypothetical protein	A0A0M3ULD5	Salmonella_phage	2.2e-66	71.7
WP_162661849.1\|5761128_5761356_+	hypothetical protein	A0A2H4J495	uncultured_Caudovirales_phage	1.5e-18	50.7
WP_076752577.1\|5761358_5762423_+	hypothetical protein	A0A0M4QX01	Salmonella_phage	2.0e-134	67.6
WP_032419940.1\|5762422_5762755_+	hypothetical protein	A0A0M4RTY3	Salmonella_phage	1.3e-23	71.2
WP_032419941.1\|5762842_5764072_+	GIY-YIG nuclease family protein	Q9MC01	Enterobacteria_phage	8.5e-92	60.6
WP_187420819.1\|5764116_5764284_+	hypothetical protein	A0A0M5M1K7	Salmonella_phage	2.1e-09	76.7
WP_117093564.1\|5764333_5765453_+\|transposase	IS3-like element ISKpn34 family transposase	S5WIU1	Leptospira_phage	6.6e-51	43.3
WP_076752578.1\|5765509_5766091_+\|plate	phage baseplate protein	A0A0M5M1K7	Salmonella_phage	3.9e-79	73.5
WP_064364844.1\|5766090_5766444_+	hypothetical protein	A0A2H4J629	uncultured_Caudovirales_phage	3.9e-50	79.5
WP_076752579.1\|5766443_5767643_+	hypothetical protein	A0A0M4RD32	Salmonella_phage	6.4e-153	70.9
WP_076752580.1\|5767639_5768416_+	DUF2612 domain-containing protein	A0A2H4J1A9	uncultured_Caudovirales_phage	3.0e-79	56.9
WP_076752581.1\|5768415_5769321_+	hypothetical protein	A0A1I9SEW2	Klebsiella_phage	1.9e-48	59.1
WP_076752582.1\|5769320_5769506_+	hypothetical protein	Q9B026	Phage_GMSE-1	4.0e-06	42.2

DBSCAN-SWA_11

5777263 : 5837226

Escherichia_phage(30.0%)

plate,tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038424382.1\|5777263_5778607_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_014229072.1\|5778603_5779269_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_038424383.1\|5779265_5780954_+	OmpA family protein	NA	NA	NA	NA
WP_014229074.1\|5781098_5781590_+	type VI secretion system effector Hcp	NA	NA	NA	NA
WP_042945025.1\|5781837_5784480_+	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	1.1e-96	32.5
WP_038424388.1\|5784476_5786972_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	1.9e-18	32.4
WP_038424390.1\|5787224_5789192_+	membrane protein	A0A077K801	Ralstonia_phage	5.0e-62	32.4
WP_014229081.1\|5789193_5789454_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_032694505.1\|5789453_5790887_+	hypothetical protein	NA	NA	NA	NA
WP_065365967.1\|5791028_5794262_+	type VI secretion protein VasK	NA	NA	NA	NA
WP_042945026.1\|5794482_5796243_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_032694508.1\|5796206_5797292_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_042945027.1\|5797269_5797809_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_014838282.1\|5797810_5798266_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_076752586.1\|5798289_5799624_+	type VI secretion system ImpA family N-terminal domain-containing protein	NA	NA	NA	NA
WP_076752587.1\|5799786_5801466_-	glycoside hydrolase family 43 protein	NA	NA	NA	NA
WP_162557343.1\|5801520_5802960_-	MFS transporter	NA	NA	NA	NA
WP_014229092.1\|5803855_5805238_+	carbohydrate porin	NA	NA	NA	NA
WP_076752588.1\|5805301_5806261_-	DUF523 and DUF1722 domain-containing protein	NA	NA	NA	NA
WP_014229094.1\|5806275_5806809_-	DUF3833 domain-containing protein	NA	NA	NA	NA
WP_014838292.1\|5806805_5808029_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_014229096.1\|5808025_5808748_-	DUF1365 domain-containing protein	NA	NA	NA	NA
WP_038424403.1\|5808749_5810009_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_038424404.1\|5810005_5810725_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_038424406.1\|5810721_5811156_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_038424407.1\|5811398_5812124_-	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	4.6e-45	46.4
WP_032693677.1\|5812225_5812570_-	DUF1294 domain-containing protein	NA	NA	NA	NA
WP_187420814.1\|5812667_5813855_-	MFS transporter	NA	NA	NA	NA
WP_071889103.1\|5813997_5815134_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_038424411.1\|5815305_5816190_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014838300.1\|5816303_5817188_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_038424413.1\|5817345_5818326_+	nitronate monooxygenase	NA	NA	NA	NA
WP_014229107.1\|5818370_5819201_-	oxidoreductase	NA	NA	NA	NA
WP_038424414.1\|5819395_5820421_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_071532263.1\|5821259_5821448_+	cold-shock protein	NA	NA	NA	NA
WP_014838304.1\|5821817_5822447_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_032720811.1\|5822572_5823154_+	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_004850292.1\|5823350_5823914_+	DUF1440 domain-containing protein	NA	NA	NA	NA
WP_004850294.1\|5823968_5824283_-	PTS cellobiose transporter subunit IIB	NA	NA	NA	NA
WP_004850297.1\|5824460_5824652_-	hypothetical protein	NA	NA	NA	NA
WP_014229113.1\|5824808_5825003_-	hypothetical protein	NA	NA	NA	NA
WP_004850301.1\|5825290_5825713_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	2.6e-32	51.2
WP_038424417.1\|5825712_5826978_+	translesion error-prone DNA polymerase V subunit UmuC	I6RSM4	Salmonella_phage	5.3e-158	66.8
WP_170912124.1\|5827050_5828142_-	oxidoreductase	NA	NA	NA	NA
WP_014229116.1\|5828134_5828878_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.1e-14	27.6
WP_148719562.1\|5829201_5830218_+\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	2.4e-185	99.1
WP_014229117.1\|5830693_5831314_+	response regulator transcription factor	NA	NA	NA	NA
WP_076752590.1\|5831656_5832640_+	zinc transporter ZntB	NA	NA	NA	NA
WP_014229118.1\|5833123_5834497_+	ATP-dependent RNA helicase DbpA	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	6.8e-50	31.8
WP_014838310.1\|5834541_5835477_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	7.0e-139	93.4
WP_038424957.1\|5836287_5837226_+\|protease	omptin family outer membrane protease	NA	NA	NA	NA

DBSCAN-SWA_12

5844447 : 5930133

Vibrio_phage(45.1%)

holin,plate,tail,head,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046877232.1\|5844447_5845149_+	helix-turn-helix transcriptional regulator	K7PKK1	Enterobacteria_phage	2.5e-32	40.0
WP_032720808.1\|5845611_5845974_+	hypothetical protein	C6ZR44	Salmonella_phage	7.1e-31	58.3
WP_009653048.1\|5846050_5846443_+\|holin	phage holin family protein	K7PHB9	Enterobacterial_phage	1.3e-38	66.2
WP_032749344.1\|5846432_5846705_+\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	2.2e-16	55.4
WP_038424420.1\|5846712_5847255_+	glycoside hydrolase family 108 protein	A0A0U2I1S0	Escherichia_phage	1.5e-69	66.1
WP_004850340.1\|5847310_5847730_+	hypothetical protein	Q6UAS0	Klebsiella_phage	9.4e-35	51.5
WP_014229127.1\|5847849_5848512_+\|tail	phage tail protein	I6PBN6	Cronobacter_phage	7.0e-77	65.0
WP_014229128.1\|5848584_5848896_+	hypothetical protein	I6PDG2	Cronobacter_phage	1.5e-32	62.1
WP_071881731.1\|5848958_5849204_+	DUF1799 domain-containing protein	A0A2H4J4F7	uncultured_Caudovirales_phage	6.1e-10	41.2
WP_014229129.1\|5849288_5850398_+\|tail	phage tail tape measure protein	I6PCW3	Cronobacter_phage	5.9e-52	48.5
WP_014229130.1\|5850420_5850768_+\|tail	phage tail protein	I6PBN7	Cronobacter_phage	5.4e-36	60.9
WP_014229131.1\|5850764_5851517_+\|tail	phage minor tail protein L	K7PKU0	Enterobacteria_phage	2.5e-115	76.7
WP_038423189.1\|5851518_5852253_+	C40 family peptidase	Q6UAW4	Klebsiella_phage	5.3e-126	83.6
WP_038424422.1\|5852420_5853035_+\|tail	tail assembly protein	K7PM97	Enterobacterial_phage	5.5e-68	70.1
WP_076752617.1\|5853097_5863417_+	carbohydrate binding domain-containing protein	Q6UAW1	Klebsiella_phage	0.0e+00	49.0
WP_004101621.1\|5863702_5863975_+	DUF333 domain-containing protein	NA	NA	NA	NA
WP_014229134.1\|5863971_5864412_-	heat shock protein HslJ	NA	NA	NA	NA
WP_004112629.1\|5864537_5865527_-	2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	1.9e-70	45.7
WP_038424424.1\|5865676_5866174_-	DedA family protein	NA	NA	NA	NA
WP_038424425.1\|5866369_5869009_+	YdbH family protein	NA	NA	NA	NA
WP_004121063.1\|5869008_5869194_+	YnbE family lipoprotein	NA	NA	NA	NA
WP_004850377.1\|5869201_5869525_+	YdbL family protein	NA	NA	NA	NA
WP_038424426.1\|5869525_5870434_-	transcriptional regulator FeaR	NA	NA	NA	NA
WP_014229139.1\|5870669_5872169_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_032720803.1\|5872325_5873057_-	class II aldolase/adducin family protein	NA	NA	NA	NA
WP_014838319.1\|5873061_5873892_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_038424428.1\|5873915_5874788_-	phytanoyl-CoA dioxygenase family protein	NA	NA	NA	NA
WP_038424429.1\|5874815_5876336_-	amino acid ABC transporter permease/ATP-binding protein	A0A1V0SE00	Indivirus	4.1e-11	26.3
WP_009653045.1\|5876823_5877741_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014229144.1\|5877910_5879170_+	NAD(P)-binding domain-containing protein	NA	NA	NA	NA
WP_004139129.1\|5879193_5879628_+	RidA family protein	NA	NA	NA	NA
WP_014229145.1\|5879624_5880299_+	DUF1028 domain-containing protein	NA	NA	NA	NA
WP_038424431.1\|5880291_5881461_+	acetylornithine deacetylase	NA	NA	NA	NA
WP_004850413.1\|5881484_5882300_+	phytanoyl-CoA dioxygenase family protein	NA	NA	NA	NA
WP_014838325.1\|5882424_5882916_-	DinB family protein	NA	NA	NA	NA
WP_038424432.1\|5883022_5883559_-	dihydrofolate reductase	NA	NA	NA	NA
WP_014838326.1\|5883631_5884750_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_014229150.1\|5885360_5885723_-	cupin domain-containing protein	NA	NA	NA	NA
WP_032693424.1\|5886164_5886734_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_076752591.1\|5887174_5887975_-	hypothetical protein	NA	NA	NA	NA
WP_032720798.1\|5888085_5889009_-	HlyD family secretion protein	NA	NA	NA	NA
WP_014229155.1\|5889005_5889221_-	DUF1656 domain-containing protein	NA	NA	NA	NA
WP_038424434.1\|5889210_5891250_-	FUSC family protein	NA	NA	NA	NA
WP_032751450.1\|5892273_5892912_-	transcriptional regulator	NA	NA	NA	NA
WP_032751971.1\|5893083_5893308_+	helix-turn-helix domain-containing protein	M1PVU4	Vibrio_phage	1.5e-15	57.1
WP_032751449.1\|5893310_5895389_+\|transposase	Mu transposase C-terminal domain-containing protein	A0A2D1GNK9	Pseudomonas_phage	3.7e-172	48.4
WP_032751448.1\|5895424_5896372_+	AAA family ATPase	A0A0C4UQR3	Shigella_phage	2.4e-110	65.0
WP_032751446.1\|5896377_5896713_+	hypothetical protein	NA	NA	NA	NA
WP_032751445.1\|5896690_5896930_+	hypothetical protein	NA	NA	NA	NA
WP_004114541.1\|5896932_5897220_+	HTH domain-containing protein	C9DGL7	Escherichia_phage	3.5e-17	48.3
WP_032751444.1\|5897235_5897853_+	DUF3164 family protein	A0A2I7S9B0	Vibrio_phage	5.8e-65	59.4
WP_032751970.1\|5897933_5898428_+	hypothetical protein	NA	NA	NA	NA
WP_032751443.1\|5898420_5898720_+	hypothetical protein	NA	NA	NA	NA
WP_032751442.1\|5898716_5898941_-	hypothetical protein	NA	NA	NA	NA
WP_032751440.1\|5899010_5899565_+	regulatory protein GemA	A0A0C4UQU3	Shigella_phage	1.3e-39	47.8
WP_032751439.1\|5899561_5899957_+	Middle operon regulator	A0A0C4UR27	Shigella_phage	7.7e-39	62.5
WP_032751438.1\|5899960_5900473_+	hypothetical protein	NA	NA	NA	NA
WP_032751436.1\|5900567_5901146_+	N-acetylmuramidase	A0A2I7S9B9	Vibrio_phage	9.6e-38	47.8
WP_064182397.1\|5901359_5901767_+	hypothetical protein	NA	NA	NA	NA
WP_016807468.1\|5901754_5902366_+	hypothetical protein	M4MB79	Vibrio_phage	2.9e-24	39.8
WP_032751432.1\|5902362_5902593_+	TraR/DksA family transcriptional regulator	NA	NA	NA	NA
WP_016807466.1\|5902573_5902876_+	DUF2730 domain-containing protein	M1Q558	Vibrio_phage	4.3e-13	42.6
WP_016807465.1\|5902885_5903173_+	hypothetical protein	A0A2I7S9D8	Vibrio_phage	8.4e-27	64.5
WP_064182396.1\|5903175_5903451_+	hypothetical protein	NA	NA	NA	NA
WP_016807464.1\|5903440_5904019_+	DUF3486 family protein	M4MCR3	Vibrio_phage	7.6e-51	59.0
WP_064182402.1\|5904027_5905617_+	hypothetical protein	M4MHG0	Vibrio_phage	3.6e-196	69.3
WP_064182395.1\|5905616_5907188_+	DUF935 domain-containing protein	A0A2I7S9K0	Vibrio_phage	3.9e-158	56.2
WP_076752592.1\|5907180_5908023_+	hypothetical protein	M1PVV7	Vibrio_phage	3.5e-89	56.5
WP_032751420.1\|5908256_5909228_+\|protease	Mu phage protease GpI	M1Q578	Vibrio_phage	1.3e-74	49.4
WP_076752593.1\|5909230_5910133_+\|head	Mu-like prophage major head subunit gpT family protein	M4MB71	Vibrio_phage	1.4e-99	57.8
WP_032751416.1\|5910206_5910713_+	hypothetical protein	NA	NA	NA	NA
WP_032751414.1\|5910712_5911153_+	DUF1320 domain-containing protein	A0A2I7S9E9	Vibrio_phage	4.1e-33	47.3
WP_076752594.1\|5911152_5911695_+	phage virion morphogenesis protein	A0A2I7S9D7	Vibrio_phage	6.4e-60	63.7
WP_076752595.1\|5911691_5912303_+	hypothetical protein	M1PJ94	Vibrio_phage	1.1e-39	41.3
WP_064365535.1\|5912305_5912515_+	DUF2635 domain-containing protein	NA	NA	NA	NA
WP_064365534.1\|5912516_5913998_+\|tail	phage tail sheath subtilisin-like domain-containing protein	M1Q565	Vibrio_phage	1.2e-164	59.8
WP_049138388.1\|5914007_5914361_+\|tail	phage tail tube protein	NA	NA	NA	NA
WP_064365533.1\|5914364_5914748_+\|tail	phage tail assembly protein	A0A0C4UR03	Shigella_phage	1.2e-12	46.2
WP_032751402.1\|5914846_5916700_+\|tail	phage tail tape measure protein	M4MHE6	Vibrio_phage	6.5e-120	51.0
WP_032751401.1\|5916699_5917959_+	DNA circularization N-terminal domain-containing protein	A0A2I7S9E8	Vibrio_phage	3.8e-87	42.4
WP_032751400.1\|5917951_5919043_+\|tail	phage tail protein	M4M9L5	Vibrio_phage	4.9e-91	49.7
WP_076752596.1\|5919033_5919573_+\|plate	phage baseplate assembly protein	A0A2I7S9F6	Vibrio_phage	7.8e-34	46.6
WP_019704449.1\|5919569_5920022_+	phage GP46 family protein	A0A2I7S9F0	Vibrio_phage	6.6e-26	43.4
WP_076752252.1\|5920008_5921085_+\|plate	baseplate J/gp47 family protein	A0A2I7S9E5	Vibrio_phage	1.9e-103	53.4
WP_016807443.1\|5921069_5921654_+	YmfQ family protein	M4M9M8	Vibrio_phage	2.2e-45	48.2
WP_032751396.1\|5921656_5922469_+\|tail	tail fiber protein	E5G6P0	Salmonella_phage	2.6e-25	52.9
WP_032751395.1\|5922468_5923344_+\|tail	tail fiber assembly protein	K7PMH7	Enterobacteria_phage	3.5e-23	39.0
WP_050597590.1\|5923353_5925312_+	hypothetical protein	A0A0F7LA61	Klebsiella_phage	2.6e-71	33.0
WP_032751394.1\|5925319_5925568_+	hypothetical protein	NA	NA	NA	NA
WP_014229530.1\|5926210_5927068_-	dimethyl sulfoxide reductase anchor subunit family protein	NA	NA	NA	NA
WP_032719195.1\|5927069_5927687_-	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	4.4e-73	57.6
WP_076752597.1\|5927697_5930133_-	dimethyl sulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	1.6e-219	49.9

Anti-CRISPR protein detection

Acr_ID: NZ_CP018362.1|WP_076752319.1|1032121_1032406_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_CP018362.1|WP_187420816.1|1032406_1033468_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP018362.1|WP_076752319.1|1032121_1032406_-|hypothetical-protein

1032121_1032406_-

94 aa aa

1005500-1069669

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP018362_5	Orphan	5.1\|5140793\|32\|NZ_CP018362\|PILER-CR,CRISPRCasFinder,CRT	5140793-5140824	32	1054035-1054004	1

1. spacer 5.1|5140793|32|NZ_CP018362|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018362 position: 1054035-1054004, mismatch: 1

gtaaaaaactccctactgtgctttaccggcag	CRISPR spacer
gtaaaaaactccctactgtgctttaccgccag	Protospacer
**************************** ***

NZ_CP018362.1|WP_187420816.1|1032406_1033468_-|hypothetical-protein

1032406_1033468_-

353 aa aa

1005500-1069669

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP018362_5	Orphan	5.1\|5140793\|32\|NZ_CP018362\|PILER-CR,CRISPRCasFinder,CRT	5140793-5140824	32	1054035-1054004	1

1. spacer 5.1|5140793|32|NZ_CP018362|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018362 position: 1054035-1054004, mismatch: 1

gtaaaaaactccctactgtgctttaccggcag	CRISPR spacer
gtaaaaaactccctactgtgctttaccgccag	Protospacer
**************************** ***

3. NZ_CP018361

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 12586

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004118344.1\|294_1224_-	copper resistance inner membrane protein PcoD	NA	NA	NA	NA
WP_000025662.1\|1228_1609_-	copper resistance system metallochaperone PcoC	NA	NA	NA	NA
WP_001378118.1\|1648_2539_-	copper resistance outer membrane transporter PcoB	NA	NA	NA	NA
WP_000925242.1\|2544_4362_-	multicopper oxidase PcoA	NA	NA	NA	NA
WP_001023257.1\|4596_5046_+	copper resistance protein	NA	NA	NA	NA
WP_004118669.1\|5334_6072_+	peptidoglycan DD-metalloendopeptidase family protein	A0A2H4JAF5	uncultured_Caudovirales_phage	1.2e-11	32.5
WP_000843497.1\|6105_6303_-	DUF2933 domain-containing protein	NA	NA	NA	NA
WP_128306664.1\|6343_8815_-	Ag(+)-translocating P-type ATPase SilP	A0A218MNH6	uncultured_virus	5.0e-83	34.9
WP_002436620.1\|8912_9353_-	hypothetical protein	NA	NA	NA	NA
WP_076752081.1\|9439_12586_-	Cu(+)/Ag(+) efflux RND transporter permease subunit SilA	S5VTK5	Leptospira_phage	1.0e-61	22.6

DBSCAN-SWA_2

15959 : 68821

Bacillus_phage(10.53%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000697968.1\|15959_16640_+	copper/silver response regulator transcription factor SilR	W8CYM9	Bacillus_phage	2.7e-31	36.0
WP_004118652.1\|16632_18108_+	copper/silver sensor histidine kinase SilS	W8CYF6	Bacillus_phage	1.0e-27	30.1
WP_000790483.1\|18358_18790_+	silver-binding protein SilE	NA	NA	NA	NA
WP_015387186.1\|18933_19284_+	DUF305 domain-containing protein	A0A218MND9	uncultured_virus	3.5e-19	55.0
WP_117093564.1\|20171_21292_-\|transposase	IS3-like element ISKpn34 family transposase	S5WIU1	Leptospira_phage	6.6e-51	43.3
WP_064343518.1\|22144_24454_+	TerB N-terminal domain-containing protein	NA	NA	NA	NA
WP_048757617.1\|24457_25774_+	ATP-binding protein	NA	NA	NA	NA
WP_076752084.1\|25770_27969_+	DEAD/DEAH box helicase	NA	NA	NA	NA
WP_048757527.1\|28443_28767_-	hypothetical protein	NA	NA	NA	NA
WP_048757529.1\|28763_29492_-	plasmid SOS inhibition protein A	NA	NA	NA	NA
WP_142255945.1\|29488_29923_-	conjugation system SOS inhibitor PsiB	NA	NA	NA	NA
WP_048757533.1\|29963_31964_-	ParB/RepB/Spo0J family partition protein	G8DH78	Emiliania_huxleyi_virus	3.0e-22	27.4
WP_076752086.1\|32032_32281_-	DUF905 family protein	NA	NA	NA	NA
WP_064343514.1\|32330_32867_-	single-stranded DNA-binding protein	A0A0A0P1Q9	Enterobacteria_phage	5.9e-50	73.2
WP_064381610.1\|33610_33931_-	hypothetical protein	NA	NA	NA	NA
WP_064381612.1\|33955_34219_-	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	2.0e-14	53.8
WP_020803881.1\|34419_34611_-	hypothetical protein	NA	NA	NA	NA
WP_064381633.1\|34651_35158_-	antirestriction protein ArdA	G9FHQ1	Rhodococcus_virus	6.9e-08	31.9
WP_064381614.1\|35202_35631_-	antirestriction protein	NA	NA	NA	NA
WP_064381616.1\|36055_36823_-	hypothetical protein	NA	NA	NA	NA
WP_060415454.1\|36871_37282_-	DUF1380 family protein	NA	NA	NA	NA
WP_064174388.1\|37327_37549_-	hypothetical protein	NA	NA	NA	NA
WP_064381618.1\|37548_38250_-	DNA methylase	A0A2K9VH43	Faecalibacterium_phage	2.0e-21	33.8
WP_064381621.1\|38686_38917_-	hypothetical protein	NA	NA	NA	NA
WP_032743916.1\|39125_39551_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	4.9e-31	54.7
WP_064381622.1\|39550_40825_+	Y-family DNA polymerase	F1C5A5	Cronobacter_phage	4.6e-157	63.8
WP_064381624.1\|40923_41247_-	hypothetical protein	NA	NA	NA	NA
WP_064381626.1\|41243_41681_-	hypothetical protein	NA	NA	NA	NA
WP_064174383.1\|41680_42712_-	ParB/RepB/Spo0J family partition protein	S5WII0	Leptospira_phage	1.8e-07	27.1
WP_064174382.1\|42711_43578_-	ParA family protein	NA	NA	NA	NA
WP_013815099.1\|43906_44875_+\|transposase	IS5-like element IS903B family transposase	A0A1B0VFY5	Salmonella_phage	1.0e-185	99.1
WP_074177395.1\|45143_46109_-	Abi family protein	A0A1S5S8T0	Streptococcus_phage	7.5e-11	22.6
WP_064381628.1\|46402_47023_+	recombinase family protein	A0A1V0E035	Clostridioides_phage	9.4e-07	29.6
WP_040118531.1\|47042_47306_+	hypothetical protein	NA	NA	NA	NA
WP_064381635.1\|47406_48336_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	3.2e-75	55.0
WP_148719562.1\|48661_49678_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	2.4e-185	99.1
WP_064381406.1\|49721_51569_-	diol dehydratase reactivase subunit alpha	NA	NA	NA	NA
WP_004098899.1\|51581_52013_-	diol dehydratase small subunit	NA	NA	NA	NA
WP_004098897.1\|52009_52600_-	propanediol/glycerol family dehydratase medium subunit	NA	NA	NA	NA
WP_004098894.1\|52613_54281_-	propanediol/glycerol family dehydratase large subunit	NA	NA	NA	NA
WP_004098893.1\|54674_55103_+	heme-binding protein	NA	NA	NA	NA
WP_004098891.1\|55140_56304_+	1,3-propanediol dehydrogenase	NA	NA	NA	NA
WP_004098885.1\|56373_56739_+	glycerol dehydratase reactivase beta/small subunit family protein	NA	NA	NA	NA
WP_004098883.1\|56740_57289_+	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_004098881.1\|57266_59192_-	PTS-dependent dihydroxyacetone kinase operon transcriptional regulator DhaR	NA	NA	NA	NA
WP_004098879.1\|59331_60432_-	glycerol dehydrogenase	NA	NA	NA	NA
WP_004098877.1\|61028_62099_+	dihydroxyacetone kinase subunit DhaK	NA	NA	NA	NA
WP_004098875.1\|62110_62743_+	dihydroxyacetone kinase ADP-binding subunit DhaL	NA	NA	NA	NA
WP_004098873.1\|62759_64187_+	dihydroxyacetone kinase subunit DhaM	NA	NA	NA	NA
WP_101867698.1\|64504_64693_-	hypothetical protein	NA	NA	NA	NA
WP_004098871.1\|64650_65628_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	4.4e-75	59.9
WP_004098869.1\|65889_66168_-	hypothetical protein	NA	NA	NA	NA
WP_076752089.1\|66215_66926_-	HNH endonuclease	NA	NA	NA	NA
WP_000427623.1\|67180_68185_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_003100847.1\|68263_68821_-	recombinase family protein	A0A0C4UR34	Shigella_phage	3.3e-59	63.2

DBSCAN-SWA_3

74416 : 199877

105

uncultured_Caudovirales_phage(20.93%)

integrase,transposase

attL 66904:66963|attR 169614:170979

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
66904:66963	attL	NA	NA	NA	NA
WP_000427623.1\|74416_75421_+\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_001549890.1\|76268_76601_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_076752091.1\|76597_77050_+	NAD(P)H-dependent oxidoreductase	A0A2H4J5V6	uncultured_Caudovirales_phage	2.0e-43	63.1
WP_117093564.1\|77076_78197_-\|transposase	IS3-like element ISKpn34 family transposase	S5WIU1	Leptospira_phage	6.6e-51	43.3
WP_000427623.1\|78498_79503_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_004152284.1\|79906_80917_-	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_016831235.1\|81376_82459_+	DNA-binding transcriptional repressor LacI	C6ZCU4	Enterobacteria_phage	4.4e-185	96.1
WP_023280929.1\|82580_85655_+	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	96.8
WP_029497453.1\|85706_86960_+	lactose permease	NA	NA	NA	NA
WP_040215689.1\|87430_88813_+	carbohydrate porin	NA	NA	NA	NA
WP_040210203.1\|88943_89903_-	DUF523 and DUF1722 domain-containing protein	NA	NA	NA	NA
WP_029497558.1\|89899_90451_-	DUF3833 domain-containing protein	NA	NA	NA	NA
WP_077265736.1\|90569_91538_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	2.9e-172	91.6
WP_029497503.1\|91700_93485_+	ATP-dependent helicase	A7KV33	Bacillus_phage	9.6e-20	26.8
WP_003031967.1\|94015_94984_-\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	2.8e-13	29.1
WP_020316930.1\|97596_98454_-	incFII family plasmid replication initiator RepA	NA	NA	NA	NA
WP_073984493.1\|98446_98494_-	hypothetical protein	NA	NA	NA	NA
WP_000323025.1\|99657_99945_-	type II toxin-antitoxin system mRNA interferase RelE	A0A2H4JBF4	uncultured_Caudovirales_phage	1.4e-29	66.0
WP_000534858.1\|99944_100184_-	type II toxin-antitoxin system antitoxin RelB	A0A2H4JBG1	uncultured_Caudovirales_phage	1.6e-18	54.4
WP_076752093.1\|100312_101473_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.2e-39	36.4
WP_020277922.1\|101669_102593_-	cation transporter	NA	NA	NA	NA
WP_001515348.1\|102792_103365_-	cytochrome b/b6 domain-containing protein	NA	NA	NA	NA
WP_029497477.1\|103840_105079_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	2.4e-09	22.4
WP_000589001.1\|105499_106840_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_004196883.1\|107858_108263_+	IS66 family insertion sequence hypothetical protein	A0A0P0ZCV4	Stx2-converting_phage	1.1e-69	99.3
WP_004196919.1\|108259_108607_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	3.3e-62	99.1
WP_004196907.1\|108655_110194_+\|transposase	IS66-like element ISEc22 family transposase	A0A0P0ZEB3	Stx2-converting_phage	7.4e-295	99.2
WP_076752095.1\|111435_112506_+\|transposase	IS481-like element ISKpn28 family transposase	NA	NA	NA	NA
WP_032435768.1\|113180_113948_-	hypothetical protein	NA	NA	NA	NA
WP_004144453.1\|114001_114421_-	DUF1380 domain-containing protein	NA	NA	NA	NA
WP_001568042.1\|114430_114652_-	hypothetical protein	NA	NA	NA	NA
WP_001568041.1\|114651_115353_-	DNA methylase	A0A2I7RE86	Vibrio_phage	1.6e-26	36.2
WP_001568040.1\|115789_116020_-	hypothetical protein	NA	NA	NA	NA
WP_050888056.1\|116081_116753_-	plasmid partitioning/stability family protein	NA	NA	NA	NA
WP_001568038.1\|116755_117727_-	hypothetical protein	A0A222YXF2	Escherichia_phage	1.1e-73	46.8
WP_004178082.1\|117975_119463_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.2e-31	35.5
WP_015632467.1\|119868_120300_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	7.2e-30	53.7
WP_029497486.1\|120299_121571_+	Y-family DNA polymerase	F1C5A5	Cronobacter_phage	2.2e-151	62.8
WP_011977819.1\|121652_122627_-	ParB/RepB/Spo0J family partition protein	Q38420	Escherichia_phage	1.4e-86	53.8
WP_000368714.1\|122626_123832_-	AAA family ATPase	A0A077SL49	Escherichia_phage	2.4e-163	69.6
WP_012539983.1\|124597_125353_-	replication initiation protein RepE	I3WF20	Macacine_betaherpesvirus	1.7e-135	95.2
WP_012540012.1\|125986_126100_+	hypothetical protein	NA	NA	NA	NA
WP_000764642.1\|126228_126486_+	hypothetical protein	NA	NA	NA	NA
WP_029497485.1\|126543_127323_-\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	7.1e-52	92.0
WP_029497484.1\|127520_128525_-	hypothetical protein	NA	NA	NA	NA
WP_013023785.1\|128711_129017_-	type II toxin-antitoxin system toxin CcdB	NA	NA	NA	NA
WP_004197642.1\|129018_129237_-	type II toxin-antitoxin system antitoxin CcdA	NA	NA	NA	NA
WP_160866775.1\|129406_129868_-	hypothetical protein	NA	NA	NA	NA
WP_001261282.1\|129824_130055_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_001044770.1\|130051_130468_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_004206609.1\|130541_132104_+	AAA family ATPase	NA	NA	NA	NA
WP_000361404.1\|132088_133111_+	helicase UvrD	NA	NA	NA	NA
WP_004181747.1\|136258_137797_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	6.1e-273	91.8
WP_004114612.1\|137846_138194_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	4.1e-60	96.5
WP_131646527.1\|138190_138577_-\|transposase	transposase	B6DZU5	Stx2-converting_phage	3.9e-59	91.5
WP_032454252.1\|139006_139246_+	hypothetical protein	NA	NA	NA	NA
WP_009653207.1\|139446_140844_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_004197671.1\|141083_141362_-	hypothetical protein	NA	NA	NA	NA
WP_004197678.1\|141696_142263_-	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_004197675.1\|142387_144031_-	alpha-D-glucose phosphate-specific phosphoglucomutase	A0A1X9I671	Streptococcus_phage	1.5e-22	25.0
WP_013815099.1\|145011_145980_-\|transposase	IS5-like element IS903B family transposase	A0A1B0VFY5	Salmonella_phage	1.0e-185	99.1
WP_004099052.1\|146352_148545_+	1,4-alpha-glucan branching enzyme	NA	NA	NA	NA
WP_004099051.1\|148674_149958_+	glucose-1-phosphate adenylyltransferase	NA	NA	NA	NA
WP_009653212.1\|150046_151480_+	glycogen synthase GlgA	NA	NA	NA	NA
WP_076752101.1\|151498_153175_+	glycogen/starch/alpha-glucan family phosphorylase	A0A140XAG6	Dickeya_phage	4.2e-25	69.2
WP_013815099.1\|153176_154145_+\|transposase	IS5-like element IS903B family transposase	A0A1B0VFY5	Salmonella_phage	1.0e-185	99.1
WP_019706030.1\|154855_155860_+	hypothetical protein	NA	NA	NA	NA
WP_004118541.1\|156070_159079_-\|transposase	Tn3 family transposase	Q1MVP5	Enterobacteria_phage	0.0e+00	62.8
WP_004118540.1\|159239_159797_+	recombinase family protein	Q1MVP4	Enterobacteria_phage	8.4e-39	47.2
WP_004118538.1\|159928_160261_+	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_011977829.1\|160614_161763_-	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	1.7e-123	65.9
WP_004118534.1\|162037_162412_-	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	4.5e-28	56.0
WP_001549953.1\|162940_164137_+	MFS transporter	NA	NA	NA	NA
WP_004118529.1\|164208_165036_-	universal stress protein	NA	NA	NA	NA
WP_001549885.1\|165054_166533_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	1.6e-198	74.0
WP_001549886.1\|167016_167370_+	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	5.9e-22	57.1
WP_001549887.1\|167465_168749_+	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	2.9e-175	74.6
WP_001549888.1\|168798_169227_+	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	2.3e-52	70.7
WP_000427623.1\|169890_170895_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_002718009.1\|172734_173295_-	chlorite dismutase family protein	NA	NA	NA	NA
169614:170979	attR	NA	NA	NA	NA
WP_000427623.1\|173718_174723_+\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_032693926.1\|175482_176553_-	PD-(D/E)XK nuclease family protein	NA	NA	NA	NA
WP_032693925.1\|176965_178063_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_076752103.1\|178293_179331_+	SIS domain-containing protein	NA	NA	NA	NA
WP_003031957.1\|179336_180167_+	fructoselysine kinase	NA	NA	NA	NA
WP_003031956.1\|180232_180988_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003031955.1\|181031_181694_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003031954.1\|181693_182434_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.7e-29	41.0
WP_077274232.1\|182433_183264_+	TIM barrel protein	NA	NA	NA	NA
WP_076752107.1\|183284_184151_+	DMT family transporter	NA	NA	NA	NA
WP_050595136.1\|184536_184695_+	hypothetical protein	NA	NA	NA	NA
WP_076752109.1\|185085_186162_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_032693914.1\|186357_187179_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_032693912.1\|187252_188065_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_032693911.1\|188066_188813_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.1e-25	37.9
WP_076752111.1\|188812_189886_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_032693909.1\|189918_191037_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_076752093.1\|192519_193680_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.2e-39	36.4
WP_099973685.1\|194912_195719_-	incFII family plasmid replication initiator RepA	NA	NA	NA	NA
WP_009653899.1\|195777_195849_-	RepA leader peptide Tap	NA	NA	NA	NA
WP_032736837.1\|196066_196336_-	replication regulatory protein RepA	NA	NA	NA	NA
WP_032736899.1\|196473_197016_-	phospholipase D family protein	A0A1B2LRT6	Wolbachia_phage	1.8e-17	34.6
WP_076752115.1\|197499_198291_-	thioredoxin domain-containing protein	NA	NA	NA	NA
WP_009653903.1\|198403_198997_-	fertility inhibition protein FinO	NA	NA	NA	NA
WP_032736839.1\|199157_199877_-	type-F conjugative transfer system pilin acetylase TraX	A0A1D6ZIU7	Xanthomonas_phage	7.1e-06	28.7

DBSCAN-SWA_4

224762 : 225731

Salmonella_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_077265736.1\|224762_225731_+\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	2.9e-172	91.6

DBSCAN-SWA_5

233513 : 234347

Faecalibacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_076752137.1\|233513_234347_-	N-6 DNA methylase	A0A2K9V411	Faecalibacterium_phage	2.0e-20	32.9

DBSCAN-SWA_6

241669 : 242383

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013087170.1\|241669_242383_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	8.1e-95	72.3

DBSCAN-SWA_7

245848 : 251740

uncultured_Caudovirales_phage(75.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013087165.1\|245848_246274_-	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	2.5e-51	71.4
WP_012540054.1\|246286_247576_-	arsenite efflux transporter membrane subunit ArsB	A0A2H4J144	uncultured_Caudovirales_phage	4.6e-173	74.5
WP_076752157.1\|247623_249375_-	arsenite efflux transporter ATPase subunit ArsA	NA	NA	NA	NA
WP_012540111.1\|249392_249755_-	arsenite efflux transporter metallochaperone ArsD	NA	NA	NA	NA
WP_012540252.1\|249802_250153_-	As(III)-sensing metalloregulatory transcriptional repressor ArsR	A0A2H4J145	uncultured_Caudovirales_phage	5.3e-23	50.9
WP_087654045.1\|250370_251740_-\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	1.2e-78	69.7

DBSCAN-SWA_8

255817 : 268233

Macacine_betaherpesvirus(37.5%)

integrase

attL 248571:248584|attR 271961:271974

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
248571:248584	attL	NA	NA	NA	NA
WP_004206772.1\|255817_256360_-	single-stranded DNA-binding protein	A0A0A0P1Q9	Enterobacteria_phage	1.0e-49	75.8
WP_032426243.1\|256948_257269_-	hypothetical protein	NA	NA	NA	NA
WP_047727563.1\|257303_257558_-	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	6.8e-12	50.0
WP_004206777.1\|257794_258220_-	antirestriction protein	NA	NA	NA	NA
WP_004206779.1\|258740_258971_-	hypothetical protein	NA	NA	NA	NA
WP_009309980.1\|259185_259611_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	2.9e-31	50.4
WP_004206782.1\|259610_260882_+	Y-family DNA polymerase	F1C5A5	Cronobacter_phage	8.6e-156	64.0
WP_004206783.1\|260960_261212_+	plasmid stabilization protein	NA	NA	NA	NA
WP_047368871.1\|261265_261571_+	hypothetical protein	NA	NA	NA	NA
WP_076752159.1\|262896_263868_-	ParB/RepB/Spo0J family plasmid partition protein	I3WF22	Macacine_betaherpesvirus	1.2e-154	89.1
WP_000523812.1\|263867_265034_-	plasmid-partitioning protein SopA	A0A2I6B2X3	Macacine_betaherpesvirus	3.0e-224	97.7
WP_000200070.1\|265784_266795_+	replication initiation protein	J9Q7H0	Salmonella_phage	3.0e-87	54.3
WP_022064517.1\|267492_268233_-\|integrase	site-specific integrase	I3WFA4	Macacine_betaherpesvirus	5.4e-25	58.6
271961:271974	attR	NA	NA	NA	NA

DBSCAN-SWA_9

275778 : 277179

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002436614.1\|275778_277179_-	copper resistance membrane spanning protein PcoS	W8CYF6	Bacillus_phage	2.4e-18	26.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP018360

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP018362

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

3. NZ_CP018361

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection